1J6PA

Crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
407
structure length
407
Chain Sequence
HHMIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METAL-DEPENDENT HYDROLASE OF CYTOSINEDEMANIASE/CHLOROHYDROLA
publication title Crystal structure of Metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (TM0936) from Thermotoga maritima at 1.9 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 132
structure length 407
sequence length 407
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1j6pA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6pA02
1K70A 1J5SA 1A5MC 1FWIC 2A3LA 1QW7A 4C6FA 4WHBA 2KAUC 3FEQA 3GTIA 1FKXA 5FSEC 4JOMA 3MKVA 4B90A 1NFGA 4RDZA 2FVMA 1RA0A 1XRFA 3QGAC 1W1IE 3PANA 3CAKA 4C6QA 4H9UA 4P5UA 4LANA 4QSFA 2HNHA 4BKNA 1FWHC 3E38A 4G7EB 1M68A 1EJVC 2WJDA 4LCSA 4H9YA 1VFLA 4QS5A 1EJXC 3IGHX 4DO7A 1UIPA 1JGMA 3NEHA 3T81A 3MSRA 1KRCC 1R9YA 1KRMA 3PAOA 1EJUC 3ICJA 1ADDA 1V77A 3NURA 3WMLA 1YNYA 4C5ZA 2GZXA 5CH9A 4IH3A 4R85A 1A5LC 3GGMA 4WGXA 3F2DA 4WVXA 4LCRA 4R88A 3IARA 4ERIA 1NDZA 1V79A 3K4WA 4HK5A 3HM7A 2Z2BA 3GRIA 3LNPA 3PNUA 4C6OA 4GXWA 3GU2A 3O0FA 2BGNE 4NI8A 1NDVA 4QROA 3FDKA 4C6LA 3KM8A 1S3TC 3UPMA 2P50A 4HK6A 3PBMA 4IF2A 2Z2AA 4GZ7A 2VM8A 3URAA 1GKRA 3RYSA 4C6MA 4IG2B 3GU9A 2Z29A 1J79A 2E25A 4EPDC 5AKQA 1BF6A 1KRBC 2O4QA 3CS2A 1YIXA 4EPBC 2P53A 1WXZA 5HMFA 4B92A 2Q09A 4DLMA 4ICMA 1ZZMA 2PGRA 1K1DA 4INFA 4Z42C 3GTFA 1V7AA 4HK7A 3RHGA 4KESA 2UBPC 4G7EA 4C6DA 1NDYA 1POKA 2D2GA 4LEFA 5E5CA 4BY3A 4DZIA 2UZ9A 2DVXA 2FFIA 3C86A 4BJHA 1IE7C 3QY8A 1A5KC 3GTXA 4XAGA 2AQVA 2VUNA 3GIQA 4CEUC 1KCXA 2OOFA 4QTGA 4XD4A 4PCNA 4RZBA 3DC8A 4CQBA 3QY6A 3T8LA 4LALA 4GX8A 1O12A 1FWJC 4DI9A 4KETA 3K2GA 4H9TA 3IV8A 3MJMA 2GOKA 4XAFA 2YXOA 2YZ5A 2Z26A 1XGEA 4QRNA 4PBEA 3JZEA 3ITCA 4I6KA 1M7JA 4H00A 4GK8A 3MPGA 4LAOA 2AQOA 2OQLA 4UB9A 3OJGA 1ITQA 1KRAC 1E9ZB 3S2NA 4C60A 4CQDA 3TN5A 2Z27A 4GBDA 3F4DA 3GIPA 1RK6A 3MVTA 4IG2A 3AUOA 4EPEC 2HPIA 4L6DA 3S2JA 4H9XA 5HMEA 5FSDC 1FWGC 3GG7A 3ORWA 1FWEC 2Z4GA 3AU6A 4DYKA 4OFCA 3LA4A 3R0DA 3MTWA 4XAYA 3MVIA 3QY7A 2DVUA 4GX9A 2XIOA 2OGJA 4L9XA 1P6BA 2Z00A 1R9XA 1A4LA 4QS6A 3A3XA 2PGFA 3F2BA 4V1XA 3DCPA 2EG6A 3A4JA 4CQCA 3ID7A 3AU2A 3GTHA 3BE7A 1HZYA 3E2VA 5LXXA 1ONWA 3QGKC 4LAMA 3G77A 1FWFC 3B0YA 1RA5A 3F4CA 4ERGA 2BB0A 1GKQA 4F0RA 4DIAA 3E74A 3K5XA 1A4MA 1EJRC 2EG7A 4H9ZA 3PNZA 4C6EA 4AQLA 3WYZA 4C6NA 2Y1HA 3IPWA 1RK5A 2QVNA 2QPXA 1YMYA 4I6VA 3B40A 4ZSUA 4E3TA 2VHLA 3N2CA 3NQBA 2I9UA 4XAZA 1UIOA 1EF2A 3RN6A 1EJTC 1EYWA 3LU2A 2Z28A 1I0DA 3OQEA 1V4YA 3O7UA 3OU8A 4PCPA 3URNA 4IGMA 4C6JA 1XRTA 1DPMA 4V1YA 4C5YA 2I5GA 1POJA 3LSCA 2F6KA 2Z25A 5HMDA 3V7PA 2RAGA 2R1LA 4NP7A 1GKPA 4H01A 2FVKA 3E0LA 2FTWA 4UBPC 2YB1A 1P6CA 4TQTA 3HPAA 2CZVA 4IFKB 1UMLA 2QT3A 2Q01A 4HA0A 3E3HA 3EGJA 1FWDC 4GY7A 2ADAA 2D2JA 1FWAC 4CEXC 4DI8A 1EJWC 1M65A 4F0LA 2R1PA 3FDGA 4B3ZA 4KEUA 4H9MA 3WZ0E 4H9VA 3GU1A 4MUPA 1V51A 3T1GA 3UBPC 1E9YB 1EZ2A 4C6PA 4YIWA 2O4MA 1R9ZA 1ONXA 2WJEA 4GYFA 1I0BA 4LAKA 4KEVA 2R1KA 2GSEA 2GWGA 3IJ6A 2PUZA 4C6BA 1RAKA 3IRSA 1PB0A 2VC5A 1YBQB 4LCQA 2WJFA 3OODA 4KQNA 1A5OC 4RE0A 4HJWA 2PAJA 3URBA 1J6PA 2P9BA 1YRRA 4IFOA 4R7WA 1FWBC 4G2DA 3TN4A 5A6TC 4XD3A 1PTAA 2GWNA 4XD6A 4KF1A 4CNTA 3UF9A 2ICSA 3OVGA 2HBVA 4C65A 3EWDA 3D6NA 2G3FA 4KERA 4J5NA 3S2LA 4RDYA 3IACA 4F0SA 4LFYA 4IFKA 4KEZA 2YB4A 1J6OA 1P1MA 3LS9A 4D8LA 2HPMA 1FKWA 4M51A 2DVTA 1PSCA 2VR2A 4IFRA 3S4TA 3F2CA 4GY0A 2AMXA 3OOQA 4EP8C 3URQA 4J2MA 2HBXA 3LGGA 3ISIX 4PE8A 1RJPA 4CNSA 3S2MA 4ZSTA 4C6KA 4XD5A 1QXLA 4AC7C 4B91A 2ANUA 3A3WA 2R1MA 3SFWA 3GUWA 2EG8A 1K6WA 1FWCC 3MDWA 4J35A 4EPKA 4C6CA 2WM1A 2PLMA 2OODA 2E1WA 4RDVA 3MDUA 2ZC1A 3B0XA 4LH8A 2D2HA 1YBQA 3TNBA 3HTWA 4DNMA 4KIRA 3LY0A 3CJPA 3EWCA 3TN6A 1ITUA 2QS8A 4DZHA 4ERAA 1WXYA 4IGNA 4PBFA 2HQAA 2Z7GA 1RJRA 2W9MA 2VC7A 1NDWA 4NG3A 3UR2A 1RJQA 2Z24A 4GY1A 4RDWA 2R1NA 3RCMA 3TN3A 3LGDA 5G4HC 3DUGA 1UBPC 2OB3A 2FTYA 1O5RA 1EJSC 3LSBA 3SO7A 4DLFA 1XWYA 3UR5A 4CNUA 4IQJA 1PO9A 3E0FA 4GOAA 4GC3A 1A5NC 2IMRA 4C6IA
chains in the Genus database with same CATH superfamily
1VH7A 1E70M 1TPWA 4X2PA 3OQ8A 1H1ZA 3GXTA 2ATMA 1VFSA 2OGYA 5FSEC 2FFCA 4Q4RA 1B1YA 4XIMA 1NFGA 3EOEA 4RDZA 4HU8A 4DM1A 3AI0A 2DZAA 2G3MA 5LGZA 4N02A 3N17A 3LCFA 3TAOA 3JS3A 1UWUA 2ZUVA 4QAIA 2EJAA 4K68A 5KTLA 2ZXBA 4GYPA 1B57A 3S47A 1IWBA 1H7WA 1TWDA 4JAWA 4ACYA 1NAL1 3MC5A 3CQHA 1QK0A 2YLLA 4PH6A 2V9DA 3F2DA 1GORA 4MKNA 3RIKA 3WF0A 4ERIA 4XAPA 3D47A 1XRVA 4WJ8A 3G1DA 1K6AA 3W28A 2XN2A 4X9SA 5EU9A 2EF9A 1VKFA 3FDKA 4R27A 1S3TC 2IPFA 1GOXA 1VPQA 1HNYA 2JEGA 5HMSA 1T6MA 4FS2A 4P7NA 4HD5A 3KVLA 4IRDA 1W9VA 4MNLA 4LVFA 2XGIA 3GHRA 3CS2A 3FLUA 1XCFA 1WXZA 5BMXA 1K1DA 1XKJA 2YA0A 3LDVA 3VE9A 3SSZA 3H2AA 3SQLA 4DL7A 3WH6A 1Q6FA 4PMNA 2JEIA 4O28A 2DVXA 2FFIA 3BAJA 1GYLA 2JE8A 2JIEA 4AXNA 1IEWA 4ZQRA 5A6MA 1T0OA 3ZR4A 5LNSA 3CPGA 3QY6A 5G2IA 3VO0A 5A6KA 2GOKA 3MSDA 2ACUA 3ONBA 1EJ7L 2VOMA 4XZ9A 1YXCA 1WYIA 3HO8A 3UZZA 1ZAHA 2ASJA 3KTSA 3NZ1A 3PC0A 3AHZA 1KFKA 5KT4A 1G94A 1B3WA 1C8QA 2PWUA 3DHDA 1J8VA 4WSHA 3PZIA 4P8WA 4IG2A 3OEXA 4GISA 4AF0A 5HPOA 3LUTA 4L6DA 1BPLB 3QOKA 1QASA 2YCJA 5H6HA 4GYPC 4DBSA 3NVDA 1CLVA 4J28A 2CERA 3I7SA 4GYKA 4M3PA 1EBGA 1VJIA 2H3DA 3QMSA 2BASA 3BW3A 4P8UA 3M7WA 3QLDA 4LNCA 4ED7A 4JY9A 5BROA 4ZODA 4S3BA 3GVGA 2EPMX 5G5IA 1HZYA 2OO6A 4LAMA 1E55A 4WCJA 3HPXA 3H40A 5HUOA 1QCWA 4UTLA 1S1RA 4GC7A 1I2PA 2PGEA 1EJRC 2WHJA 3VIJA 4AH7A 3BO9A 3GHTA 1LL6A 5C5YA 3SCWA 3IGXA 3OBEA 5AFDA 4HYKA 5DEZA 3OB8A 3XIMA 1BXNA 3ITYA 4GRSA 3MMDA 4PUWA 1XLAA 5KG3A 4LVAA 3UETA 4X9YA 1CDGA 3SGZA 2Z28A 3CUFA 1W1PA 1XQLA 4NUWA 2A79A 3LHTA 1KO0A 4H01A 3BJSA 4ZB2A 3E0LA 1P48A 1XCXA 2Q01A 3OA3A 4UFKA 2GYIA 4Y9OA 5IBXA 4H04A 4BHYA 4RNIA 2E7FA 3TUUA 1SO4A 3N25A 4US6A 1FUYA 3G18A 3P84A 2D0FA 1WUFA 1EDGA 1Q6DA 3ZVHB 4CVWA 3PJWA 3PR2A 2VEPA 5L9FA 1QU4A 3CV6A 4AHPA 4KEVA 1VR6A 2RDXA 1GONA 4Z2GA 4Q8FA 2BQUA 3WK2A 4HZMA 2EPOA 2CFFA 1K7EA 3CU2A 3K13A 2QJIA 4ADUA 1BQGA 3WNMA 2B31A 2P9BA 3BCDA 3NO3A 5A5WA 1R0MA 1K8ZA 3N4AA 5HNRA 1W9PA 4NZJA 3DG6A 1F5ZA 1YDOA 4BWLC 1W17A 3NA8A 1NWTA 4U4MA 4G5DA 4XWUA 4YLWA 3BJYA 3OIHA 3AS0A 1M6JA 4DPPA 2BV9A 1Z44A 3VGFA 1GOWA 4HMDA 4WRHA 2DVTA 3RX4A 1PSCA 3LB0A 2HJPA 4IFRA 3KOWA 4EP8C 1W5QA 2DZPA 1JPHA 1KM5A 4J2MA 3SN0A 3FN9A 2PMQA 4E38A 3AIQA 3SFWA 2YCLB 3QSRA 4PA8A 2JF7A 2W63A 5LSMA 2FPTA 3QGVA 4L4OA 1CLXA 5FJRA 4DF1A 3AYTA 3GW3A 3T2PA 2WHKA 3T05A 3LTSA 4HTYA 5KZDA 1WXYA 2PU1A 2HQAA 3KEHA 1SJCA 4S3AA 4HU3A 4HZ7A 2QW5A 3QC3A 1NQKA 1EZWA 3EX2A 4KKXA 2OKOA 1NOWA 1FTXA 2C0AA 4W93A 4ADSA 3N34A 1KKRA 2ZUUA 4DWSB 4EBDA 5IDIA 2BVYA 3WDQA 2F9RA 2QIIA 1G7VA 4ATLA 5D8WA 3G0XA 3M9MB 4BQ2A 2Q8XA 4C6FA 3MT1A 3GFXA 1OIFA 2WC7A 2DQXA 2XFFA 4LUSB 1EDTA 4FX6M 2J7BA 4WXYA 4F66A 1O5QA 2IQTA 3DENA 4MUZA 4OKDA 3UY8A 1YADA 1OSEA 5RUBA 1LT7A 1E1CA 4YVVA 3TW7A 2HROA 3ITTA 4IIFA 1E56A 1SJDA 3W1LA 5DANA 4YWSA 1J96A 3B8TA 1FWTA 1P0EA 2Z1WA 3WLKX 1A3XA 6CGTA 4LC6A 3VINA 1A49A 4HCDA 5HDRA 3L4WA 2JK2A 4R85A 4W88A 2ZE3A 6TIMA 1R7OA 1YLVA 4W5ZA 4GIAA 4J7RA 3C56A 2Y61A 2RH9A 5ABTA 1RVGA 3DFOA 1OD8A 4HNLA 3HV8A 1P1XA 1RP8A 2Q8ZA 1BWVA 3CTLA 5HR7A 2C71A 4EIVA 2ALZA 4KWOA 1TTJA 3FV9A 4B92A 1TVPA 2P5NA 2WVUA 2IKGA 3GTFA 3B0VC 1GUVA 3RHGA 2ZTKA 1OX6A 3N4EA 1O68A 2CHNA 1BHGA 1JDEA 3HPZA 4BJHA 2DJXA 3G22A 3PUOA 2PODA 3TQ1A 3WLMA 2X8RA 3O6CA 3BARA 2PD9A 1BXCA 2I5IA 3IRDA 4HIBA 5EFDA 4OV9A 2HXUA 2V3GA 3KZPA 2VT0A 4PULA 1XLLA 2W27A 3U0HA 2OPJA 4ZTYA 3U9IA 2G37A 2G0WA 3M0HA 3MKCA 1M7JA 1FP8A 4GK8A 3MPGA 2ATLA 3GDRA 1JCNA 3VOCA 4G7FA 1KXVA 3A4XA 4ATWA 3STCA 3W1NA 1E15A 1Q45A 3CV2A 4EPEC 2IXVA 3VNLA 2XH2A 3LBOA 3M0XA 5LNVA 4HYRA 5AVHA 3AU6A 1WAWA 3LZ5A 5HAOA 1CIUA 3M47A 3WBXA 1QNRA 5I0DA 2HDJA 3LNMA 3ARSA 4HPNA 2A3BA 2OGJA 1H51A 3OHIA 4J3ZA 3MR5A 1FH7A 3NQCA 1DYSA 2RFGA 2J8GA 3UD6A 2FKPA 4M7SA 1XG4A 1IQ8A 4JTLA 4PBGA 1P0DA 1WDDA 1JIHA 5CKSA 3QGKC 4QNWA 4A21A 2D0GA 2ZUNA 1A0DA 3T4WA 5CLWA 3NG3A 3PUDA 4L64A 4GFSA 1WDPA 2DUAA 1A4MA 1IT8A 2Y1HA 3A47A 4ZEPA 4PUMA 1FDJA 4ZQMA 5CZ0A 4LY8A 4QEEA 1SZRA 3H2OA 1Q7QA 5MKGB 1Z3NA 4MWAE 3H7RA 3E2RA 1UCWA 4PCPA 1UOKA 3ZFHA 1G5AA 2GDUA 4NP7A 4ORIA 1LLZA 4NL1A 3W23A 5JIWA 3IIPA 3KDNA 3Q2DA 3AALA 4PTVA 2CITA 4DL4A 1D2KA 3FDSA 1TTPA 1HKJA 3QW4B 3BLDA 4J9KA 1EFZA 8A3HA 4LPCA 4QNEA 2ACRA 4JKLA 3VABA 1BGGA 3AWOA 3EMQA 3KOFA 4GUGA 1OGGA 1AQFA 3FAWA 1MXGA 3DBNA 2YX0A 5KFFA 1GTHA 1MRAA 4WKHA 3P81A 5BCAA 3M46A 3RBDA 3DAQA 1RCOB 4XUYA 3UWQA 3G6LA 1D7FA 4XVDA 5HWMA 5FAGA 1B9ZA 1X6LA 1RCQA 1GW9A 2XH0A 2IPGA 4FS1A 2EPNA 1LTDA 1BVWA 1QAPA 1W9DM 2QCLA 4TX8A 3NEVA 1Z9AA 1H0GA 5DELA 4HN4A 4B4FA 3TWAA 3T5HA 4O4VA 4OJYA 4C65A 3A9BA 4J5NA 1NM9A 3DHUA 8XIAA 5I06A 4DL3A 1JFHA 3AHYA 1EUAA 1JF6A 4DL6A 4E2VA 3S1WA 2CLEA 3KHGA 1VCGA 2DU2A 4XZIA 4PCTA 3LHYA 5EFFA 3A21A 4O8AA 3WDIA 1XGZA 5HINA 3ELFA 4IZGA 1MNZA 1BYBA 3A22A 4NX5A 3VGGA 2BHUA 3R2GA 2PDJA 3AMGA 1V6YA 1O60A 3OVPA 3OTRA 4LTSA 4AC7C 3R0UA 1YEYA 4TV6A 3BJFA 2X40A 1FWCC 2HCVA 4EPKA 1Z42A 2PLMA 3I10A 3QFEA 4JDYA 2OODA 4ZENA 3WMCA 3TNBA 1PTGA 1DJGA 1ZL1A 4M24A 3UNTA 1D7KA 4MB4A 4ZO6A 1XDJA 1UH2A 3VIFA 1A3HA 4QGCA 2FLLA 3EPGA 2VXNA 3DXIA 2BTMA 1DWGM 4OWGA 5KFVA 1ZCOA 3WLJA 3ZYZA 2AL1A 3ARUA 3LSBA 3CHEA 3VMPA 5H8PA 1B4KA 3NQ8A 3QEZA 1XWYA 2R8IA 1YTEA 9XIAA 5CG0A 1W5OA 4GC3A 2BY2A 1E6ZA 2DV0A 1IT0A 1E72M 1BGAA 2HNEA 1G9HA 2A3LA 2H9AA 2YLAA 1FWRA 4GINA 3PS7A 3ABXA 3W01A 5BOOA 2G3IA 3B0UX 3S5YA 4UCGA 4IRKA 3WMSA 4GI6A 3HQOA 4AEOA 5DBUA 1AG1O 4AFYA 1LRNA 2C1HA 4EXAA 1KFLA 3NQ6A 5AY7A 4QWCA 3LPOA 4UMBA 5HQLA 5I2UA 5FEZA 3OIXA 4OV4A 3UWEA 4WUIA 4OE7A 3RR1A 4KPLA 5GPRA 2VZTA 3IWPA 1V3LA 4MNJA 2BY1A 2E8YA 4A3HA 3RU6A 1B3OA 4FA3A 1EYEA 2FHBA 4HNTA 4DO5A 1W91A 3HPSA 4ZA0A 1UWSA 3WJWA 1VFTA 3B8VA 1UC4A 2Y6ZA 5CPNA 2QCEA 2ISVA 3KBJA 4IPNB 2Q3RA 4C6MA 3V16A 5AKQA 3I7RA 3W86A 1ME8A 5I23A 4Q8VA 4JFUA 5HMFA 3F4NA 4ICMA 1ZZMA 3GILA 4CN4A 3FYOA 3MYPA 4FLQA 2WO5A 2EGZA 4GHRA 2UBPC 2IQDA 1TV8A 3W7QA 1L2UA 1E0XA 1ZSXA 5LIWX 1KCLA 3UGRA 4PMRA 4HBKA 6ENLA 1EGVA 5ECUA 3W00A 3H2EA 5FOOA 3TVAA 3OPSA 4POCA 2GDVA 3F5JA 3KP1A 3FIGA 1JD7A 2CIPA 3GW0A 3EPOA 4H4IA 4DELA 1UKSA 2WZTA 1E5JA 3TQVA 4H9TA 3IV8A 3PG9A 2E5DA 1TUXA 2W62A 3HFYA 2J9YA 4XBKA 1V02E 7ODCA 2WQDA 3OVQA 4ECXA 3NPXA 3CUIA 1KBLA 3FFSA 2D2OA 3GKAA 4YL2A 2VJXA 3AYSA 1SM9A 1SZFA 3VFLA 3C2EA 1T96A 3N9KA 3K30A 5D33A 3P14A 1S0NA 2GJNA 4WSJA 1QNOA 1QR7A 2PDIA 4M7TA 5DT7A 1SJAA 4NYUA 2DZTA 2GQ8A 1N8IA 1QW8A 1EPVA 3DHPA 1T5AA 3OBKA 1DBTA 4MVAA 3ITLA 4L9XA 1P6BA 2P3ZA 2QDDA 3F2BA 4F8XA 2CLMA 5DLFA 1AJ2A 3CB3A 3QVQA 2ZZ1A 4B5WA 3ID7A 2XHYA 3C3NA 4P7RA 3KHDA 2QF8A 4I7WA 3Q4DA 5ABFA 2VMFA 4QCEA 3WY1A 3WLOA 1CPUA 4V2XA 5BWAA 4F0RA 3K5XA 4KRTA 3GDBA 3W2NA 3LMZA 2PLJA 1H7OA 1MZRA 2WAGA 1ZBWA 1LWHA 2VGBA 1KC7A 3B40A 3ZR6A 3W2MA 5DG8A 2QJMA 2VR5A 3N2CA 5KFHA 2YCEA 3OSPA 5M1TA 5B80A 1HL9A 2E28A 4KWSA 3UW6A 4AZBA 3LBMA 5DO8A 3OQEA 3PAJA 5AC7A 4IMEA 4G8TA 1AQMA 3QMRA 4C5YA 1MI3A 2XIBA 3P0XA 1XYCA 3BV4A 3P61A 4ZE4A 3AS3A 3QHNA 3K8LA 4TIMA 4AG0A 3EGJA 1ITXA 3L4TA 4S3EA 1FWAC 2QMKA 1MEIA 3R1ZA 5FEXA 6A3HA 4F0LA 1CWYA 2R1PA 4YCOA 3WUBA 2WSPA 3UWYA 4H9MA 5H1WA 1J11A 4K1GA 4R7JA 3U4FA 2XISA 1G4TA 5TQLA 4UFLA 4LWWA 1XH0A 1IZJA 4RW5A 2R1KA 2JEPA 3IJ6A 4DUOA 3AXXA 1REQA 2AKMA 3GG0A 3RLGA 5C0QA 1FA2A 2CBUA 3OODA 1Y5XA 1K4GA 2PAJA 5CSUA 2VGGA 2XVGA 4QWBA 2W8KA 1QT1A 2BVWA 1EIXA 2PWVA 5KFMA 3BW4A 4O17A 4JHOA 3L68A 4QWAA 2P0OA 1JULA 3WELA 1VC4A 4X2RA 4XZHA 1W1VA 4OOZA 1EEPA 2OZ3A 1DQWA 1DXIA 1TWZA 4KERA 1E51A 4BK9A 5DMNA 1E0VA 3VCRA 5BU6A 3NZPA 3BQ6A 5C71A 3T09A 1XINA 2X1UA 4UZUA 2VFEA 3EX3A 2VDGA 2A7PA 2INZA 4GKTA 1EQCA 2VR2A 1BTCA 4QITA 4F4ZA 2G96A 3OOQA 4MLRA 5BYWA 3N6HA 3LD5A 3LCWA 1RLDA 5HWNA 3G5EA 1GVFA 2BGSA 2PDGA 4BEUA 3VKJA 2TPSA 3GUWA 3LGEA 3ZJ7A 3C5QA 1MW2A 5EMJA 4JNMA 3MV01 1OJXA 3NDOA 2E1WA 3HPFA 1KM6A 3MDUA 5CAKA 3GIMA 4LEQA 2B7OA 1ZB5A 3L4YA 2QS8A 1CW2A 3CIXA 4HQVA 3PULA 1Q85A 1J0JA 4JHMA 1LBMA 4KMQA 4R33A 2NV1A 2Z24A 3KRSA 1W37A 3PUEA 2OB3A 1LJYA 3ZO9A 2Y89A 1LL7A 5FD0A 3T40A 3NSMA 5DCDA 3SO7A 1GQKA 4Z08A 1O5KA 5KG1A 4RW3A 3W22A 3S6DA 1DXFA 3E0FA 2EPLX 4JX6A 1DORA 1MXDA 1FWIC 1ZJHA 4H6EA 2VFDA 1IXPA 4UQDA 2WMJA 3HV9A 4JOMA 4DNHA 1TQJA 3MKVA 3BJTA 1G7UA 4ILSA 3EOOA 2D24A 1XRFA 1XG3A 3CAKA 4H9UA 5HULA 5AYZA 1FWWA 3MWCA 4MB1A 3ES8A 3WLLA 5EPDA 2V6AA 1JCJA 2XIJA 3G0SA 3MWAA 4EX4A 2IQ0A 4QLKA 4WDXA 5E1QA 3IEBA 3PTMA 3HQ1A 4JTUA 1KRMA 2J6XA 3MHGA 3RRAA 1TV4A 1W2PA 3COTA 4UQAA 1UH4A 4Q3MA 1X6UA 1TJRA 1O6IA 3PK7A 1QOQA 5JBFA 4AZ7A 2W3ZA 1P5BA 4TR9A 5REQB 5DQIA 2Z2BA 2CZEA 1UH3A 1ADOA 1TJPA 3O0FA 4AEEA 2TYSA 1TKKA 1Q6CA 2NLIA 4S3DA 3SAZA 1XPGA 3AXHA 1JNDA 2A85A 2YOCA 5D9OA 2VEGA 2PD5A 2WVTA 4HMNA 1IZCA 3QLLA 3GU9A 4IT1A 1DJYA 3GXDA 2YXXA 1ZETA 1M1BA 4A3YA 1TZ7A 1DWFM 3DDMA 2G97A 3TFCA 4IR9A 1EB3A 4RZ4A 2VD8A 3CQJA 3U6WA 3RLVA 4DXVA 2QVHA 4DLMA 1J0YA 5KG4A 4QIUA 3Q8PB 4KWVA 4J9RA 1DV7A 4QE1A 5J5DA 5KFEA 3ATYA 1O66A 3OLIA 5LNUA 1TPB1 4W8LA 1LDCA 4DZIA 5DF0A 3QY8A 2WKGA 3L9CA 1ZBKA 1LYXA 5AHLA 1R7AA 3IUIA 2GVEA 4FLOA 2ZBTA 4MLJA 3XISA 2PTWA 3UG5A 3WQWA 3NZQA 1YXYA 1TPVA 1UZ4A 4PSRA 4QJ3B 2FYMA 3R10A 5AC4A 5T14A 1EP1A 5DY2A 1TE1A 2BXZA 3AZSA 4OOUA 1VRXA 3FA3A 2DGAA 3OJGA 2IKHA 1C91A 5LNRA 1C9DA 3LI1A 4NNCA 3B05A 3RGTA 5CZKA 2E9LA 3SB0A 2QPSA 1XLBA 4MFDA 1QJWA 5K7JA 2AMGA 3M0IA 4OGZA 3AUOA 4LYPA 1UKTA 2XSAA 2ZYFA 2OWCA 4FF5A 3W88A 3WH8A 3B8DA 1FWEC 5IFPA 4J9NA 1QWGA 1YPXA 2PCEA 3H54A 3RK8A 3D5HA 3TK7A 1E9LA 4TQRA 2IUZA 4CUCA 3FEMA 2J78A 4L4LA 2ALRA 4P7LA 4U28A 4XAYA 4FOJA 2DVUA 3SUWA 3ZJ6A 1R9XA 2X09A 3GXIA 3A3XA 1BF2A 3T0DA 1F74A 3WQOA 4JKKA 2AL2B 2BGQA 4N4QA 4IIDA 1N2VA 2A3CA 3BE7A 4D1IA 3S5NA 3QQ0A 4DXXA 1I2RA 4IHCA 2PB1A 4WD0A 4ERGA 3DZ1A 3N6JA 1ITCA 1Z69A 2XFYA 1HJQA 3AIBA 5A2AA 1NFPA 1US2A 1E9IA 2J7GA 2QPXA 4BCEA 1S0MA 2XC9A 2V69A 2I9UA 1XLFA 3W2UA 1V6XA 3L0GA 4GJJA 2J8FA 1CX9A 2RDJA 3S6OA 3OU8A 3POCA 5TD4A 1RV8A 2BNJA 2ZZ4A 3ARQA 4S3KA 2I5GA 3W1MA 4I9AA 3JUGA 3WLTA 4YCPA 2CZVA 1ECQA 1JL8A 4X0NA 4QBXA 5KZMA 5D2YA 4CEXC 2W9AA 4ECSA 1EJWC 4KEUA 1K8CA 1FBAA 2J74A 3VOHA 3AHTA 2J8TA 2PWFA 4IR1A 3PY2A 1E9YB 3QZ8A 3RB4A 3CHVA 4GVHA 1ML1A 3MS8A 1PIIA 5JUMA 4YHGA 2E1DA 4IPIA 4BI5A 1RAKA 3V75A 4KS0A 4LB3A 1VEPA 3GC2A 3W1XA 3T0TA 4JIQA 4FBTA 1SFJA 1TQXA 4HJWA 2J6SA 1TA3B 2YL8A 2DW6A 4F0HA 3BDKA 1YRRA 2QEZA 2BR0A 4YVXA 4ECVA 1BQCA 3TN4A 1F76A 4XSMA 1YTKA 4GI4A 3FA4A 1NSJA 3VGDA 4WX2A 3GH7A 2V0TA 3Q8SB 2YA1A 3MBFA 2E3ZA 3C0QA 2FLPA 5CC7A 4UCFA 4ZFCA 4Z1CA 1M7OA 2DJLA 3W7KA 3TCEA 4NZFA 1OADA 3KTXA 1VFOA 4Q44A 4D8LA 1FKWA 4M51A 5HNTA 1AA1B 3H4BA 1ZP4A 2ZE0A 1DJQA 5EYWA 1MXSA 5K3VA 2ISFA 3WH5A 3F2CA 1MMFA 2NUXA 3FKRA 1OABA 2B0MA 2CLFA 2PP0A 3M0ZA 5DCBA 1FXPA 4F0KA 4HNOA 5L6UA 3SIMA 2Z0IA 1G01A 1WQ5A 5C9ZA 5CSRA 3KRBA 2WHLA 4LF1A 3BG3A 1IYXA 4M6VA 2ZX5A 4R7OA 3HGOA 3E0WA 1A47A 2A7RA 3SJ3A 3PZQA 3WSUA 3CL6A 3GKFA 4J9QA 4YPJA 5HJYA 4E8DA 3LHWA 4UMCA 2WWDA 3UR2A 3TJLA 1N82A 4FIQA 2QULA 5I6SA 3Q67A 2CWXA 2Y63A 1F8MA 2OFJA 3IV3A 4O4WA 1SW0A 2PA6A 3MP4A 4ZMGA 4BI6A 2W67A 1JG9A 2WK2A 3C6CA 4YTQA 4IXHA 5A6BA 3CAVA 3LZ3A 1JDAA 4JS3A 3ZT5A 4EF8A 3FEQA 3BZGA 1IWAA 4WOZA 3S6TA 1JYXA 4FIRA 3HQPA 4NJJA 1R86A 4N9CA 2D3NA 2VELA 1FWHC 4EACA 1UJPA 4JTGA 1CGUA 4ZXOA 5PTDA 1GQLA 4ZE5A 4HNCA 2YJQA 2DORA 2QUTA 1F73A 1EA9C 4B15A 1FOBA 1KRCC 2O0TA 4M0XA 1MW0A 3T55A 2FH6A 5LA1A 4Z2LA 3RAXA 3LQGA 3OG3A 1L6WA 4UFHA 1A5LC 3C0LA 2NWSA 4AWTA 2XFRA 4DWSC 1XRSA 3GU2A 5KZEA 1OVDA 2BGNE 1C8XA 3ARPA 3STPA 4Z2IA 2VCCA 2B7PA 4B5VA 1XJBA 4LW7A 5EWEA 2VM8A 4IG2B 1EDQA 2E25A 2ZRUA 4AF0B 2ZOXA 2O4QA 2MANA 8RUCA 1MDRA 1Q65A 1U1UA 4O14A 2ZVRA 4TO8A 1PHQA 4W4QA 4LAUA 3TEVA 1WZKA 3TW6A 1R3VA 3TONA 3TTEA 4US5A 4LEFA 2C14A 1SFTA 1U1HA 4JV1A 1TRDA 2PDWA 3B0PA 3TSBA 1Q2RA 1XW8A 2WPBA 3WUGA 4YR0A 2Y5SA 2VZOA 3KOZA 3CGTA 4I5UA 3HJZA 4BQ3A 1EO7A 4J9OA 3M44A 4PTWA 4HSNA 1KKOA 2AOSA 1UR3M 2C8NA 4QWDA 4IMGA 3UZJA 2PDFA 1Q8AA 1E6SM 3VXGA 5KFKA 2F7FA 1SR0A 1US0A 3VC5A 4JKMA 2AQOA 2ZCGA 3MP5A 4Q8NA 3GXPA 1KGWA 2QJJA 2Y85A 4QE4A 3TN5A 2Z27A 3FHQA 1RQHA 2GOUA 1SZNA 4GD0A 5G4EA 2QJHA 2HPIA 1R87A 2Z1BA 5J8LA 3A13A 5LHEA 4G1NA 1W5PA 3GIIA 3BQ0A 2IBKA 1TE6A 3FHAA 4KEMA 1ME9A 3GC5A 2BMBA 4H2HA 3QTGA 4LV9A 3I6EA 4TX9A 4AXKA 4PTXA 1OBAA 4NX0A 4UTWC 5KEZA 2FQIA 4MJ2A 2F38A 1QRQA 1JI2A 3LXCA 3ZT6A 3EB3A 4WKFA 2JGYA 3E74A 1P7TA 4RPQA 5G4WA 7CGTA 1V8EA 1LWIA 2CKSA 3MZ2A 3EEGA 2WCSA 4M81A 4XZWA 3OLEA 4E3TA 4ED0A 4K38A 1WOAA 1UIOA 5CGTA 4HSHA 4L1XA 2PDYA 3HG3A 2ZWYA 5KFNA 2VURA 2X1TA 4KRZA 1DIOA 3URNA 1AVAA 3W6YA 5U4NA 1QNQA 4FMVA 3VNIA 4JZ5A 4V1YA 3CQIA 3U5YA 3T5JA 1WPCA 3RM4A 2I17A 5A6AA 4CD6A 1GHSA 2YSWA 3SJNA 3L5LA 2QCHA 3VOFA 3FDGA 4WOQA 2X05A 2XFWA 3OVRA 4JN6A 3VKKA 2YBVA 1MW3A 3VNMA 1SW3A 3T07A 4H8NA 1OFQA 1TO3A 1W1A1 4MFEA 1RBLA 1OHLA 4GYFA 1D3GA 1JRBA 5EMYA 4LVDA 3PW4A 4NYYA 4DWDA 3WBYA 3GNXA 1H7RA 3PR4A 3FJ4A 4C6BA 4IQLA 1X8CA 4L6OA 4QM1A 2PFHA 3GHUA 1XHGA 2D23A 2UVRA 3URBA 1K02A 4QE5A 5KT2A 4ZCWA 3MSYA 3BOXA 4MM1A 1RQBA 4IFOA 3WDJA 4AHOA 4REQA 3ZLHA 4DBUA 2Y24A 1JZ5A 1ZCCA 2NSOA 4QDMA 2XIIA 5B7ZA 3DYPA 3DX5A 4O3SA 3RJYA 5I77A 4PMUA 4IIHA 4CVUA 3NGDA 4DJEA 3RITA 3G24A 3A23A 4KEZA 3S1UA 1VJZA 1SU5A 1M01A 2DP3A 1TTQA 7TIMA 3GNNA 1MEHA 3W07A 4L1GA 3H7UA 4Q4OA 4XTDA 1GGOA 3VNYA 3D3FA 4LT9A 1HG3A 5FF3A 4KCUA 5CPTA 5HJXA 1OYBA 3EBVA 3MCNA 1HN1A 1UASA 3VPLA 3IIOA 1E1CB 4L9YA 9CGTA 4PRWA 5FF0A 3EPIA 4YN5A 4C6CA 2C15A 7A3HA 3K46A 2C22A 4AHQA 1NIUA 1I75A 4FO4A 4C90A 1XGDA 1TMHA 3AMLA 3TAKA 3T7VA 1ZUAX 1AH3A 2V81A 3PZOA 2GFTA 3RCMA 2YYTA 5KFZA 3WQEA 2ODOA 4QW8A 2O9RA 2VENA 3FSTA 4JXCA 1UBPC 3UG8A 3CB8A 1O5RA 3T5KA 2B7NA 3PZNA 4LNYA 1AW2A 5G2WA 1S5VA 2DT0A 4DLFA 3TTSA 1JDFA 4CNUA 3ZSSA 3H55A 4IUOA 1E5NA 3M0JA 4JY8A 3XINA 4ACZA 4ED3A 5I3IA 3WJZA 2GJLA 4HVXA 5IXEA 4Y7EA 4YWIA 1ZTVA 4N9BA 5D4YA 2ZDSA 2XCAA 2DZVA 5ECVA 3CC1A 4PUNA 2RDWA 2E6FA 1TPC1 3W1RA 3G6YA 3S8HA 3LRKA 4OTKA 3NL5A 3BAIA 4KRUA 1W1IE 3QZ7A 2ACQA 2E4TA 1KWKA 2J7CA 3FXGA 3TQ0A 3JR2A 4FS9A 2VCAA 3B9DA 2O7QA 1EJVC 3U7VA 2H3BA 2POZA 2ZA2A 1UIPA 3R94A 2AGKA 4DJEC 3DFNA 1H11A 1DJZA 2JBMA 5D9MA 4R9XA 3E5BA 4GQBA 5DY3A 3WMLA 4TU1A 5CH9A 2Z1XA 4DX3A 4S3FA 3FAXA 2D73A 4KWUA 1I4NA 1NQ6A 1KWGA 1GYMA 3O15A 3CTTA 3PNUA 3KWXA 3PHAA 4UR7A 5GQBA 3QBUA 5FI8A 3L7RA 4C91A 3PBMA 1Y0EA 4GZ7A 2R24A 1GKRA 3C2FA 4D71A 3WLQA 1J0KA 1G6CA 3SUSA 2W79A 2PZNA 3STEA 1R3TA 2YDAA 2O9PA 2R6OA 1H3GA 5C70A 1W3KA 1V6UA 4DJFC 4XX6A 4MY8A 3TSDA 3GR4A 3LLDA 4RE4A 2HRWA 3BWWA 4C6DA 1P4CA 1ZRQA 2D2GA 5E5CA 3SCQA 1US3A 4N7QA 1MNSA 3IIVA 4N4PA 2AQVA 3GIQA 4F50A 4K36A 4GJ1A 1BEUA 1SFSA 4AISA 2D0HA 1OX4A 2O7SA 3EYPA 1HKVA 3ANVA 3GE7A 1KM1A 3ZJKA 3UXAA 1DWJM 3L2MA 4ECRA 3UWZA 1F61A 3AS1A 4OBRA 2DPJA 2VEIA 1FP9A 3CH0A 4JIIX 4KW2A 2PURA 3LK6A 1MEWA 1EP3A 3JZEA 4MWAD 1K9FA 3JZUA 3WDRA 1IXQA 2R82A 2PF8A 2P8CA 5HANA 3M0LA 2ABBA 5DGBA 2QDEA 1U22A 4DZAA 3UVAA 4UTTA 4JFWA 3M16A 2J4GA 5HQEA 4OBSA 5KFDA 1PYFA 2WOQA 3KX6A 3A4AA 1HKWA 1HQTA 1UOZA 1MQPA 5A8MA 1QI5A 3L4XA 5EA9A 2GL5A 4AC1X 3TMQA 3G1FA 3VA8A 1O7AA 1ALDA 4Z1DA 4ZFMA 3OW1A 3KOXA 5KFPA 3U2ZA 5CPLA 2WMHA 5G2HA 3PPGA 4AIBA 2JF6A 3QY7A 4UQCA 2CCRA 4A8NA 4N42A 5MHBA 3TR9A 3E2SA 5EL1A 4W7WA 3PJTA 4V1XA 4RNMA 1JGIA 4LOCA 3DCPA 1V0KA 2EG6A 3KVJA 4CQCA 3VDCA 1X39A 5LXXA 2E9BA 1ONWA 3AIRA 2EKGA 1FRBA 3E49A 3UCQA 2Y8KA 3F4CA 4HU0A 4P7OA 4JN8A 4NXSA 1IXNA 2WMGA 3TYEA 4UZSA 5I3KA 5KG0A 1EGMA 5E70A 4BQ4A 2A7NA 4ZSUA 2W7OA 4NT0A 3NQBA 1XLJA 3L2IA 3TC6A 3EA2A 5I03A 4ZL1A 3P8IA 3VX0A 1BVNP 2J66A 1O94A 3LSCA 2F6KA 3SDOA 4N2YA 3VE7A 4IQEA 1ZLPA 5BU9A 1DJXA 2J7HA 2FVKA 1VCFA 2YB1A 4L56A 2NXIA 3Q45A 4CD5A 1HW6A 1ZP3A 1A5SA 2J77A 3QFWA 1O95A 2GJRA 4HU4A 1UKQA 5FEPA 3H53A 1GJWA 1XKYA 2YDRA 4XBSA 4MUPA 4PEKA 4UUIA 5A6SA 3NOYA 3EDEA 4GQ0A 1XDMA 2ONEA 2O4MA 1R9ZA 4C1LA 1XUZA 4TVDA 1DHPA 3BURA 4Q33A 1OC6A 2FGZA 4JEJA 1BYDA 2VVSA 4ZQNA 3LXBA 3THDA 2WJFA 3WMBA 3R25A 1A5OC 2VI0A 4LXFA 3MB9A 3W37A 4Q8UA 3WQPA 1M3UA 2Y7FA 3GDTA 1EKOA 4KWWA 4XBJA 3WEZA 1UD5A 5K4ZA 1A5BA 2EKCA 1LF1A 3C2OA 3S83A 1OB0A 4RNFA 3ZVIA 2UV8G 1UD2A 1QUMA 4D6FA 3N11A 4TQSA 3VZZA 3H23A 2RHGA 2HPMA 4F3HA 1UW9A 3U2EA 3VX1A 4OHQA 5D03A 1G1YA 4GY0A 4K7YA 1SO5A 2VFIA 3W85A 2JEJA 4JTAA 4FB7A 4CNSA 4PFMA 1GOQA 1U5VA 4ZGYA 5HNNA 2X41A 1JF5A 4B5UA 4XKMA 4JV2A 3LPFA 2RJHA 2V5DA 2BVTA 1EWDA 3ZWTA 4P2VA 1FHLA 3NPVA 3WCZA 4GIEA 4IL0A 4H3DA 5HOSA 1GVRA 4R9OA 4QJ5B 2A0NA 3J7HA 2DH2A 4I9JA 5EBAA 2WNZA 3CJPA 3T42A 1VFFA 1ITUA 3IAPA 2HK0A 3TTOA 4ERAA 3B9NA 4D8AA 4IGNA 2J75A 3G1VA 3IIZA 3ABQA 5FESA 2C2EA 4OBTA 2QCDA 6PTDA 5J04A 3DUGA 2OLHA 1VQTA 4WDUA 4NKCA 3MI2A 4DYJA 2ZDRA 2ZX7A 1XR2A 3QPEA 1CGVA 1GVOA 4PYSA 3QW3A 4WGHA 1JCTA 3IK4A 3A6OA 1PWLA 1RXOB 3TDFA 4KH2A 3QF0A 4L4PA 3UXLA 1MFUA 2PWDA 1K70A 5IOBA 1DIDA 2FJUB 1XPYA 3H24A 3PR5B 4JTFA 2E6AA 2KAUC 5L1JA 3W24A 3V6HA 3Q8QB 3VNJA 1QATA 3ZM8A 1HFBA 2XINA 3BLFA 3BGGA 3CM4A 3EWUA 4LY4A 4B2DD 3E6EA 3BAXA 3N1AA 3V36A 4ES4A 4ZOBA 3MI6A 1AQHA 4GH3A 2YZRA 3NTYA 1JYWA 3HFTA 3IJLA 3IGHX 1GHRA 3SCPA 2VRQA 1OCBA 3Q37A 3EDJA 2CXEA 1XLKA 1W3HA 3NURA 3RMEA 3SRDA 1IHIA 4RNNA 2X1SA 1PDZA 2GZXA 4O1CA 4GXPA 2POTA 3I68A 2JKPA 3EDKA 3W87A 3S1GA 4F4YA 2P76A 1DQXA 1OFPA 4UR8A 1D9EA 5JBEA 2ZRZA 1A0CA 4JTKA 3PPHA 4DJDC 4QG9A 1HGWA 4RE3A 2QCFA 3IUHA 4PODA 3NR0A 4IF2A 1E1FA 2OMAA 3BMXA 3N29A 1L2QA 1UZHA 1E73M 2G41A 1BF6A 2NVAA 3MANA 3U57A 1F4HA 1CI1A 2PDCA 3B4YA 4XTIA 4FSAA 4HOWA 3LRLA 2NZLA 1CZ1A 1T7LA 5DRIA 4LB4A 4P8VA 4PB4A 2I56A 1NDYA 4QR6A 3ITVA 2WZHA 3MUZ1 1H09A 1Z8AA 2YA2A 1F05A 2J6TA 3REQA 4EKJA 2OOFA 1BKSA 4KFOA 4RZBA 4GC6A 2Y7DA 3DC8A 4CQBA 3HJEA 5DMLA 4A8RA 3PWGA 3CWNA 2VVNA 3LTYA 4GQGA 3K2GA 4XV0A 1FX6A 4NIRA 4Z2JA 2OWWA 3WFZA 3IGUA 4NHVA 1E9ZB 3NQDA 4NF7A 2GK1A 1TV3A 3WBAA 3MVTA 1LORA 2PTXA 4Q8WA 2YFOA 2TAAA 4H9XA 1HO4A 4E0CA 2VP8A 1S2VA 4MZ1A 4A35A 1MUCA 5JU6A 1W2VA 2V3DA 3QQ1A 3UJRA 2R8GA 2QNEA 4GZEA 1B3XA 3EOSA 2XM2A 1PZ3A 3DFPA 1UMYA 3H4XA 2PGFA 1RQEA 1FDZA 1ZNNA 3AMKA 3T0BA 1HL2A 4GNVA 1UWQA 1QNVA 1KV5A 3BZJA 4E8GA 3T5LA 3B0YA 4MWAA 2Q6ZA 5H2ZA 4WQ6A 2PDKA 2JKEA 2P88A 2EQDA 1ZY9A 2ZC8A 7PTDA 1HF6A 5CEWA 1X97A 1G69A 5XINA 2WKJA 4K37A 5F9NA 2RGMA 1REQB 1MUWA 5BNKA 5AHFA 4AYGA 2OELA 4AD2A 3VMNA 1YW1A 5AOUA 1RCXB 1J18A 1A80A 2GJXA 4KCTA 2WJZA 6ALDA 3NM3A 1EJTC 2QPUA 3VUPA 1PJ9A 2VO5A 2YIHA 4XZLX 4JICA 4A8IA 3LV5A 4HP5A 2WNQA 3E96A 3O6DA 3W7PA 2GQAA 4DAIA 3ENLA 3CHFA 4PEEA 2DZSA 1AH0A 2VEFA 3WD2A 3M4HA 2UY5A 1K9EA 4HYVA 1YDYA 2V5LA 1JUEA 2WPGA 1PKLA 1MQQA 4JTSA 1M65A 4AZCA 4BS0A 5CC5A 1FHVA 1G4EA 1JUKA 1X1OA 3T1GA 3WJYA 4YYCA 1XYBA 2Z2UA 1DJWA 3KBMA 3QPZA 2J79A 5KT7A 2MUCA 3SR7A 2VKZG 4PUJA 2X2YA 3GV8B 4BEQA 3L2LA 5AHEA 3T08A 4JFSA 3V5CA 4WSKA 1VLWA 4Y9NA 1WZAA 5CPQA 4RE0A 2OQHA 1EXBA 3NQGA 4Q6XA 2J25A 5CPMA 3IJ9A 3TX9A 1AQ0A 2V2DA 4HHHA 1C29A 3EX1A 4DB7A 1ISXA 1IEVA 3TYCA 3O8AA 2WVSA 4UC5A 3GV7B 1M04A 2I7GA 4CNTA 3LCHA 1PWMA 1ECEA 2PWEA 5HR6A 2NUWA 2A3EA 4ZVJA 3VNZA 2Q3OA 1FCBA 4O15A 3LERA 1XBXA 1EPXA 1ZJIA 3GIKA 4CQ9A 3VAVA 3WX7A 3SRKA 4JCLA 4O11A 3W7IA 5TBOA 1BKHA 3HG2A 2ZWZA 1KTCA 5EMMA 1XD0A 2OX1A 3VIGA 1X1NA 2PWGA 5BXRA 3EZ4A 1Q6LA 4PE8A 3O16A 2OSXA 2DZUA 4WDTA 1GG1A 4EANA 4ECWA 3MDWA 4N0RA 3E12A 4E5TA 2J7FA 2HVNA 3NWRA 2ZVIA 3RB0A 4HPGA 1W1B1 3EWCA 2C19A 4D6CA 4P61A 1JAKA 1LWJA 1YDVA 2QUUA 2OXNA 2XSXA 4GLEA 4YQWA 3TN3A 3I65A 1GZGA 4AD4A 2IKIA 1GOKA 5CJMA 3LYEA 4PMXA 4MPKA 1M7XA 4DL5A 2CLLA 1VBGA 2W92A 4N6FA 2QYGA 4O1EA 4Q32A 1EH9A 1LQ2A 2XWEA 3UR8A 3GTNA 4TMBA 3VTRA 5JH1A 3F1QA 2VUYA 1W1ZA 2GGGA 3CMGA 2FZ8A 1FKXA 2OT1A 2E9MA 4GJIA 3W84A 3GB6A 3BGJA 2ZTJA 1FH8A 4GXMA 1AUSL 1L0PA 3AQUA 1CECA 1TIWA 1UYQA 1RSCA 3QKZA 4J1OA 3VGHA 1SPQA 3ME3A 2FPYA 2WJDA 4JQ2A 1UZDA 2F2HA 5T26A 4MB3A 1QO5A 4UOQA 1GWJA 3G2GA 4EE9A 2WQPA 3MSRA 4MSSA 4H7VA 5H8UA 1EJUC 5A8NA 1ADDA 3GNDA 1V77A 2XN1A 4CCDA 4EYHB 2J7DA 3DG3A 2EPKX 2YDSA 4WVXA 1DWIM 3IARA 5EKYA 2Y88A 4PRTA 1JFXA 3DHFA 3STFA 1OCQA 4WJEA 3GVVA 1WCGA 1UR8A 2NV2A 1FCQA 1UR1A 4EOUA 2XU2A 1EC8A 5CBBA 4E4UA 1R8LA 1C7TA 2ZRXA 4B2DA 2BXVA 5I5RA 1B3ZA 1MQRA 4JTEA 2REQA 4O8RA 2NXGA 4G3IA 1HP5A 3KUMA 3RB6A 2C28A 3W3OA 4JQ4A 3UESA 2OZ8A 4PMYA 3GX9A 1M9HA 5JBDA 4JDBA 3OZPA 4HK7A 2HSAA 1UBSA 1V02A 2FVLA 3PBYA 1XLDA 1F9CA 3FJNA 3W76A 2DSWA 2ATSA 4JGDA 1VAHA 3UQNA 2VUNA 3BVJA 4CCEA 3UA3A 2WSKA 1AODA 1F6YA 4J9JA 4S3JA 3VNKA 4JQAA 3L4UA 3W81A 1E71M 2DSVA 3KVKA 1Y5WA 3MJMA 4HT3A 1UR0A 2Z1KA 1D8WA 2DT2A 4C7FA 4QISA 3EDDA 3HBLA 3APTA 4YP3A 4WF7A 1CENA 1QI3A 4JTHA 2NV9A 4PFHA 1L9WA 2YR1A 4C7DA 4Z1YA 1LQ0A 3OP2A 3ORWA 3VK5A 4JX4A 4X0VA 2BDQA 2Q8LA 3DFSA 3W53A 2FZ9A 5F9LA 4X63A 4DYKA 1PIGA 4IGHA 3GSMA 2FZBA 3R0DA 4Q4MA 2G3JA 3BL3A 3IJ8A 2E68A 5FIPA 1C90A 1L6FA 1OGSA 3VYLA 1JPKA 2WBKA 1IIGA 1SFLA 1KM4A 4H83A 4HOXA 4QHRA 4DHGA 3A4JA 3EWBX 3PM6A 4L9ZA 2OZ0A 2YDQA 1RY8A 3OHMB 1V6WA 5DBTA 4H8HA 3LXAA 3AIUA 2QMJA 2EG7A 4UNLA 1IIHA 5HK4A 3WYZA 3I3EA 4RE2A 3T44A 3LHUA 5EB8A 3VDHA 1OIMA 4I6VA 4HOZA 3AYVA 4MY9A 1XYZA 3V18A 3NOEA 4XAZA 1PS9A 3N2OA 1NU5A 4DUVA 3KLKA 1KB3A 3LU2A 3VFCA 1I0DA 1EP2A 4M29A 4FI4A 4UFJA 3O7UA 9XIMA 1TVNA 3STGA 4Z17A 3MMTA 1XRTA 3QV7A 5EBUA 2XIMA 5D2TA 4MGGA 4RNHA 4O50A 1CBGA 3MZNA 1J93A 1P6CA 3BQ1A 2PRHA 4PTMA 1NARA 1BWLA 2E5BA 5CBJA 5IBXC 4GY7A 2D2JA 1LROA 2CW6A 2AGTA 3CBWA 3M0VA 5G1MA 5CZTA 4DI8A 3O9NA 4IXXA 3P5YA 2ZX6A 1RLCL 1FHUA 3TXZA 2BODX 3TOYA 1UB3A 1GOMA 5FKYA 2EO7A 2VNCA 3WK3A 1CTNA 2V8ZA 1R2SA 1LL4A 4JUZA 3NQVA 3NQFA 1UWRA 4PB3A 1FFQA 1G4SA 3IVUA 1GT8A 5IFTA 2X30A 3AJ7A 2ZA3A 1G0CA 3VD7A 3R5EA 4YTSA 4GUHA 4NAFA 1Q13A 1WXJA 3W7HA 1Q63A 1WV2A 3PUGA 4FHAA 2ISSA 4QLJA 1V0NA 4YYFA 1KXTA 3OGSA 2C1GA 1TWWA 4J3UA 1U5HA 1H61A 4ALDA 3W70A 4JIEA 1FWBC 3GO2A 4KGLA 4AIOA 3SCSA 2WVVA 4U2ZA 4W8AA 5CJNA 4IP4A 5EMKA 2KX9A 2PSNA 4GUJA 3S2LA 4B3KA 3OYXA 4KT2A 5AYIA 3SCTA 2WCGA 5KFCA 4Q7IA 1Q7ZA 2YB4A 4L7ZA 3MKKA 2UY2A 3QPYA 1TYGA 3S4TA 2VA2A 3RPTA 5D09A 4ECZA 3TYDA 3URQA 4XB3A 3EB4A 4CU7A 1VFUA 1XL9A 1PKMA 4HNNA 1YE6A 1L8PA 2XUCA 3BK0A 1PUDA 2CPUA 1WZMA 4W89A 4O57A 4FNQA 4Q45A 4NZ1A 2FTPA 3FCPA 4NZ5A 5LHFA 3GZ3A 1E4MM 1YBQA 1CXKA 4OECA 2NUYA 3TYBA 4I5RA 2AGOA 1R3RA 3GS6A 4PL1A 1VJSA 3W0KA 4GA8A 4Q8TA 2WCAA 3E0VA 3W7EA 4AD0A 3QH2A 2PBGA 1CYGA 5LIYX 3QR0A 2W9MA 1JCMP 1GVSA 3TSMA 3OYZA 4ED1A 2PPGA 1RJQA 2R1NA 1F4AA 1ZAIA 4ML9A 1XIEA 1TWSA 1RPXA 3BANA 1TMLA 5C6MA 1HIZA 5C2GA 1ZBVA 2C91A 3M5ZA 4TTUA 2JEQA 5EWGA 1I45A 1A5NC 4C6IA 4JIPA 5GNYA 1H1NA 4JR5A 1TPFA 4W87A 1R2TA 5TNVA 5JH2A 3SN4A 2PTZA 1WBJA 3BAWA 3A24A 2FVMA 3QGAC 2OEKA 4MMWA 2JIWA 4GCAA 1QHZA 1FQ0A 2HNHA 3AXKA 1M68A 2ZZ3A 4J3XA 4S2CA 1LP6A 2ZZ6A 3SM0A 3CLWA 3BMVA 4E4PA 3KRUA 2CLPA 2G95A 4UOJA 1SJBA 1M41A 5TF0A 4PTDA 2FHCA 1R9YA 2VC9A 3M0MA 3OSNA 1LOQA 5LNWA 1FXQA 1FWNA 1OY0A 5DN1A 2AKZA 2VA3A 1YNYA 1HJWA 3TJ4A 2A6LA 5IDZA 1UUQA 5U7SA 3BAYA 4IIEA 3N6QA 3GGMA 4OIFA 3KHRA 1B54A 3W83A 3TW9A 1OQFA 1K9DA 1V79A 1BVZA 5HA7A 3GRIA 3B4UA 1D8CA 2H8ZA 3SRFA 4AY1A 1AD1A 2FDMA 1S1PA 4NRRA 5JIPA 1T40A 1NOFA 2Z2AA 3KHJA 4AWSA 1Z6KA 3PSWA 5EMUA 3GFZA 4UTMA 2Z29A 5LYRA 3RDKA 2CNCA 3WFAA 3N4FA 4NZ3A 2J62A 1FFRA 3UERA 4MNMA 1ICQA 4MZ8A 3WQDA 1ZALA 5K4XA 4CGTA 3MHUA 1F3EA 4BF5A 5M03A 3TZFA 4NU7A 4GBUA 1X7IA 2BBFA 3ABSA 4Y2WA 4G7EA 3K8KA 4R8UA 3TA6A 2BZNA 1PEZA 3MW7A 4Q22A 2CLKA 3BUVA 1U1JA 2Z1SA 3BPWA 1OF6A 4QXIA 3PF3A 4RUAA 3I4KA 3MI3A 3AO0A 1E6XM 1DHKA 4TX6A 3R8RA 4GCXA 3ZOAA 1E0WA 3BCFA 3CYJA 3N2MA 4MADA 4FXSA 4JIHA 4DI9A 1Y65A 4KCWA 1JZ7A 3BW2A 4XAFA 1P7TB 4H41A 4H1ZA 3RILA 4J3WA 1XLMA 2Y2WA 3NPUA 3P67A 1S2CA 3TU9A 5A8QA 1L8NA 5C9WA 4KFNA 1V0MA 1Q6GA 3EMCA 2ZXQA 4AVFA 3LPGA 3BLKA 5KFIA 5DGAA 4RZRA 3IVTA 2PCQA 4H6QA 4AZ5A 3IJQA 2PU0A 2CHOA 3GH5A 1W5MA 4YR3A 2Z4GA 3F5KA 1UD8A 2WNWA 2DQWA 1E4IA 2GQ9A 2PI6A 1QMLA 5C5JA 1UUMA 1HVQA 3ZLGA 2BHZA 3TLLA 5D2XA 5HWJA 3HF3A 5B7YA 1EC7A 3BSGA 3RM8A 2E0PA 3M6DA 3ZR5A 1WBHA 3APGA 1VEOA 2C2DA 2J7EA 5D32A 3N14A 1A3WA 2W0UA 1JNEA 3UXKA 3WL1A 3MJYA 3LMYA 2QUMA 4DBWA 1EWEA 3CL7A 7XIMA 4EAYA 3CUJA 1CGXA 4EBEA 3GG8A 2R94A 5A2CA 3M43A 1OCNA 2NWRA 1I1XA 3IAQA 5LXEA 1EX1A 2R8KA 3H4DA 1VBRA 4J3SA 2I14A 3MV11 4REQB 5JUVA 4Q7NA 4F2UA 2YKKA 4C6JA 4UFMA 1R5YA 4RV8A 2QV5A 1U33A 4LUTA 2WKLA 4JTTA 3TMLA 2GQ3A 3TCSA 5FF4A 3SQMA 1S9FA 5DRCA 5I3GA 3HPAA 4LF2A 2HS8A 1GZ1A 1FWDC 4AZ6A 3RLHA 3HGJA 9RUBA 1H41A 4U3CA 3LM3A 1XYLA 1HJUA 2V68A 2G4JA 4GIRA 4HZ8A 2QAFA 3CT7A 3A5VA 3LI0A 4PGLA 1EZ2A 3U3HA 4GUIA 4FAMA 4YIWA 2WJEA 1Q2SA 3GVQA 1CB2A 2PLCA 5KFJA 4QSHA 3I3DA 4JFVA 3V35A 2DIJA 5FEWA 3RUBL 1RR2A 1OWQA 3CZEA 1RYRA 4CCCA 1VRDA 3RPDA 2CZDA 3P7YA 1MFVA 2V9WA 1MDLA 2C7FA 3GYEA 4FNRA 1B31A 1J6PA 1RD6A 5KG7A 1SZEA 1BAGA 1XYAA 4G2DA 3SY1A 1F6PA 2OLSA 1MUMA 1E3ZA 4RXGA 2UVUA 4XQ6A 3TH6A 5KFQA 3LTPA 2C6QA 1GW1A 3WD4A 3ZQ9A 4F0SA 3W29A 2DUZA 3IIXA 4BA0A 2NX9A 3MUY1 3W82A 4OU1A 2X0YA 2X42A 2INFA 3TWBA 4ACZB 2VFFA 4UR9A 4QG6A 3AOFA 1NJJA 3SZ8A 5C9RA 2VRKA 4M1BA 4N9DA 1Q6QA 3WH7A 2PP1A 1XIDA 4UWMA 1I2OA 2OYMA 1JUBA 3WF1A 2VR4A 4JQ3A 4QQ3A 1RP9A 3OZYA 1LBLA 1SQ7A 3UJEA 1OFRA 2FLNA 1B3YA 3BCJA 4RV3A 3F7JA 3GIYA 2HEJA 5BMWA 1DL3A 3T2QA 1NWUA 1S39A 1H2JA 2ZC1A 4LH8A 3O3RA 2D2HA 3LPPA 1P43A 3LY0A 3MMUA 3M1ZA 4CNOA 1UA7A 3TN6A 1HJXA 1RUSA 1E1EA 1GG0A 2E77A 3CV1A 5T91A 3I6TA 4JYFA 3SCOA 3LBCA 1NDWA 2ZXDA 3CUXA 4NZCA 3W2KA 4HPHA 4O52A 1EL3A 2BS9A 1CXFA 1UJQA 3D46A 1AK5A 4W8BA 4UQ9A 2IS7A 1HJSA 2XZ9A 3P82A 5KFXA 4Q4SA 2W4XA 4MKVA 4B9YA 4XK2A 4ONVA 2XSBA 4EEYA 4CNPA 1TX0A 3N3MA 1J5SA 3UPBA 4H7CA 2GUUA 1OCJA 3NXFA 1Z7AA 3DH7A 5FJUA 4ZB0A 4ZOAA 5HPCA 3INPA 2WW5A 2BOEX 3HGSA 3TC3A 3PANA 3TZNA 4EK7A 3UCCA 2V67A 4WZHA 4BKNA 3G0UA 3TJIA 3KBWA 1ODZA 1VFLA 3ERPA 4L6HA 4C7GA 2NQJA 1FCVA 3NEHA 2GUBA 1R6WA 1H60A 2VTFA 3UT0A 1X8FA 4DY1A 4FOUA 3AJXA 1JYNA 4RX0A 1OX4B 1EGZA 1V0LA 4Z1AA 2W9BA 2YFNA 2ZZ7A 4IH3A 4KIEA 1CGYA 2FB3A 4ZB5A 4FX7A 3BOLA 3K4WA 5TIMA 3QSTA 4O53A 4XZBA 1UROA 3M0KA 3UXDA 2G8ZA 1GJPA 4MZYA 4JCMA 1THFD 3I3BA 3KM8A 2P50A 4AYSA 5C2CA 7TAAA 3CO8A 5M3WA 5FL0A 2IA6A 1KRBC 1GNXA 2YCKX 5D9NA 3L65A 2VL4A 3CQ0A 4IMDA 5AECA 1W0MA 1JZ3A 1HX0A 1LBFA 3TOPA 2AAMA 4KESA 2FZMA 2OKTA 3E02A 1V7YA 2ZFAA 3NZRA 3GDLA 3C86A 2TSYA 2ASHA 3AXIA 3D0CA 4GKLA 1IF2A 3U2CA 2V5KA 4RR4A 3BOFA 6XIAA 3LG3A 1BTMA 5CSYA 2V30A 4YMZA 5CBIA 1W3NA 2HWGA 3PVXA 1BYCA 2QKFA 3N3TA 5T8GA 1ZJAA 3VU2A 3N9SA 2VX6A 2ZX8A 1P0KA 3V3WA 1XH2A 1OFEA 3MO7A 4ED2A 1S97A 2DUXA 4F2TA 3WQVA 4QDWA 1GOIA 5A69A 1WAUA 2GVGA 6TAAA 4NJIA 2OSWA 3AHVA 4Y9AA 1FWGC 2OYKA 1LG2A 3YPIA 3RM9A 3W7OA 3EWYA 1U83A 2XPKA 3QZEA 4YU1A 4QW9A 1JYVA 1PX3A 3BAKA 4IICA 3KHHA 2J27A 3FK4A 1VBUA 4Q4QA 3MTWA 1TVLA 3MVIA 1W54A 1FH9A 5F2MA 3PG8A 4BFAA 4O13A 4O12A 1TPH1 4JL2A 5K9DA 3KHLA 2RDIA 4W7VA 3VNDA 1RVKA 1AJZA 3H21A 1K3UA 1AD4A 5L1LA 1LOSA 4F9DA 1C9WA 3AS2A 2PGWA 2PDQA 2W66A 1E3XA 3FGCA 1E0TA 3C2YA 4J9PA 3HU7A 2XH7A 3VM7A 4F2BA 5J5RA 1UUOA 4W84A 2D1ZA 4MF4A 1YMYA 3B06A 4RKAA 2DT1A 3R8HA 4WK9A 1EYWA 2HS6A 4QP0A 1YNQA 1TCMA 5LKYA 5K9XA 3A5FA 2CZFA 4YS1A 2E6YA 3FVDA 3DG7A 1I8JA 1OFOA 1LUCA 1ISVA 2WSRA 2GLKA 2QGHA 3NYZA 1VYSX 2Z25A 4QEHA 1DVJA 2EBNA 2VGIA 3QV6A 4XUGA 4FXRA 3QJAA 3VCNA 3ECQA 3TFXA 4OQVA 1W31A 1HT6A 2OTDA 4QFUA 1TR9A 3PW0A 5TAOA 3WH9A 1J0HA 5CZJA 1HJVA 3WD0A 2RJGA 3PZPA 2C2RA 3C61A 3R43A 4DBEA 1QI4A 2HE5A 3EWXA 4RZ6A 3P80A 4LAKA 2XGQA 2DSZA 3WQ4A 2P1FA 1H4PA 3EMZA 3LM7A 4U5KA 3EXSA 4MPQA 1QVBA 1H0IA 1JRCA 1V5XA 3AICA 3GH4A 5GNXA 3RFAA 1W1YA 2J88A 2QLYA 2VEKA 1KD0A 3IJDA 3IJ7A 2B4GA 2QCDB 4NILA 3PPFA 5LIKX 4XD6A 1AJ0A 1KV8A 2ICSA 1OK6A 3EWDA 3D6NA 1HKMA 1V3JA 4BWLA 2G3FA 3NL2A 3WF4A 1JZ2A 1VCVA 4AX7A 4D6DA 3TA9A 1RZMA 4X60A 4AY8A 2ACSA 3SY5A 1V93A 5G1YA 4OUEA 4NZ4A 1XIMA 3QV9A 4M80A 1XLCA 3KP0A 3RAOA 3T8QA 4D6JA 1VYRA 1AW5A 2QCCA 2R8HA 4FALA 4RXFA 3QYQA 4TTGA 3TC7A 5LIUX 4E8CA 2X0HA 4P7QA 4UTHA 5LIXX 4F4WA 2IMWP 3L23A 3RJXA 3KW3A 1UWAA 1J2BA 3DGRA 4H6RA 3M07A 1VENA 3W38A 4JTCA 3DI0A 3HTWA 5AN7A 1MRQA 2WWCA 1S5MA 3JU2A 3UEQA 1GYNA 2Z7GA 3UU0A 4F9JA 3BLLA 4Q4PA 5KG6A 3O07A 4UXDA 3OGVA 2H6RA 1KA9F 1MO0A 1H62A 3MBDA 3KCLA 2NQZA 1TR1A 3MMWA 4FXJA 4YJ5A 4PC8A 1RY0A 2OX4A 1PZ1A 4JEQA 1OFBA 5KSWA 2ON3A 5T9BG 5KFOA 1WA3A 5IRPA 3QYSA 5DQHA 4FEZA 4O0ZA 1RH9A 4U5IA 5FA5A 4EVZA 4FNSA 5M2FX 3WK1A 5MF5A 4IP7A 3S3GA 3GR8A 5A95A 3GTIA 1SSDA 1PTDA 3V5OA 3CLMA 4A22A 4LVBA 2FPVA 4MJ4A 4JPGA 3D3AA 2YPIA 2VOTA 1SO3A 2PTYA 2EPHA 2NQLA 4K2SA 3QKEA 5BW6A 4C6QA 3WLRA 4LANA 1EXPA 3W7MA 6REQA 2FZNA 4LYQA 4GZIA 3SSJA 5KFRA 3GNPA 5JQ9A 3PB2A 4DO7A 5FACA 7REQA 3QOMA 4JX5A 3REQB 3T81A 1G4PA 2FDSA 4XSLA 1CNVA 3B03A 4M19A 2AQWA 3W7DA 3AIVA 3S0CA 5I78A 1UA3A 1YXDA 1W9XA 3TQPA 3LOTA 4GNKB 3CIVA 5C9XA 1V3KA 3EWWA 1VPXA 3FYYA 1CCWB 2INEA 3OBAA 3LNPA 3RMJA 4O3OA 1BRLA 4MAZA 1KFEA 2L5HA 1OF8A 4L5ZA 2GK1B 1S0OA 3W7RA 1OK4A 4YTRA 3CPRA 5EY5A 1WUEA 4JHZA 4CNNA 3RG6A 4LS0A 4LBSA 1OG0A 1TJ1A 3HGRA 1GQJA 5E0CA 4ED6A 3BG9A 4O3PA 3SGUA 1ODUA 3NNTA 2FB2A 5AC6A 4AD1A 3W7CA 1W3TA 2YW4A 4FBUA 1MSSA 1IT7A 4HHLA 5K9CA 4GZJA 3CNYA 4IJBA 4PTNA 3ATZA 2NQ9A 1UQZA 4MWAB 2XJ7A 1XV8A 4V27A 1C3FA 1HXJA 4LALA 2J47A 4U31A 1NY1A 1ZS2A 3CPUA 3EX6A 4A3RA 4FNUA 3GDKA 4E2BA 4JL1A 4NSBA 5KETA 2YZ5A 1PBGA 4WXZA 2F61A 2OCZA 4I6KA 1VFMA 3MFIA 4H00A 2WLYA 5HJLA 2WSQA 4L80A 3GWQA 1KRAC 2GJXB 2EHHA 3W1UA 1RK6A 2A4AA 4Q43A 3FSUA 3B9EA 4RUCA 2YL9A 3S46A 3EOLA 1XIJA 1XICA 1XC4A 2WV8A 2W8LA 2TMDA 4F0MA 3ANUA 2VDIA 2OZTA 2Y5JA 3LA4A 3G8RA 1XD1A 5JXQA 4QDPA 3VD9A 5A2BA 2FGLA 2Z00A 2PRLA 4XKYA 4AZCB 1R3QA 3M5XA 1YNPA 4EWND 1KFWA 3AYRA 4DN1A 3L21A 1TRIA 4NASA 3MU7A 1RPKA 1W9UA 1NFBA 1FVPA 2DPEA 4M56A 1R46A 1HGYA 2WNNA 3LLFA 3H70A 2BB0A 4HHMA 4F48A 5D30A 1F3TA 4JYDA 2V38A 3V0TA 1QPNA 3MQTA 2O56A 3C2RA 2I57A 5AYBA 2QVNA 3BLEA 3WJSA 4DM2A 3CO4A 5I00A 3KFTA 3CAWA 5M5DA 2GVYA 1XIHA 5LGXA 1W6TA 4MY1A 1LOLA 4WY0F 3O63A 3WL0A 4GO9A 3RB3A 3N13A 4ZTXA 1DTUA 1QPRA 1Y8BA 4KBXA 1N8FA 1E43A 3M0YA 1QOXA 2R91A 3PTQA 1XLEA 4AZIA 2CLHA 3EXRA 1DTNA 3C2VA 4TQTA 3WUEA 3U48A 1UWTA 2D22A 2VCBA 4LRTA 2C1IA 1XXXA 2V4RA 2QGYA 4ASTA 2CBIA 2ADAA 1R30A 2O9OA 3GM8A 4DEZA 1BYAA 3NAVA 3UYIA 1TPDA 5BRQA 3S5SA 2OO0A 4GMEA 3WZ0E 1WP6A 4IPJA 4Y9PA 3PBGA 2DY3A 1Q7MA 2VGFA 1K8YA 4C6PA 3P8JA 1OM0A 2ZUSA 5ENLA 1XBZA 4ZQOA 1J4EA 4AWUA 5CXPA 1DP0A 4D2JA 4OUIA 3M64A 4GWEA 2EEXA 3NVTA 1AMKA 4J3VA 4QWEA 1XIFA 1SO6A 1V08A 3WDHA 2VFGA 4KGJA 4R5EA 4LJ3A 3VZXA 3NJ3A 2XVLA 4R7WA 2WBGA 3PFRA 5A6TC 3QQWA 3LCLA 2GWNA 1PIFA 5CPOA 4KF1A 1E6PA 3OLGA 5KFLA 4I7VA 2PE4A 1LCOA 3GIJA 1EEXA 3KS5A 3OZMA 4BF7A 3WLNA 5BRBA 4E3VA 3ZIZA 2ASDA 3GZAA 4V28A 1EO5A 3GUGA 2ISDA 4XISA 4I5XA 3HMJG 3LS9A 1TIMA 3WLIA 3NFUA 4PZVA 4GQQA 2J9XA 4ECYA 1JPDX 2JALA 1XBVA 1PX4A 1KLYA 2F8QA 3PZVA 1F3XA 3R89A 1KXQA 1C7SA 1DWAM 2QUNA 3LGGA 2ISWA 3ISIX 2NQ5A 4GACA 3P2VA 3PN8A 1B90A 1M7PA 4C1NA 3A3WA 4PUUA 5KG2A 3P93A 3PPCA 4IMAA 1JIBA 3CZGA 3WEOA 4O18A 4K8EA 2AGQA 1I2NA 3CK5A 3OLDA 1H7PA 1OD0A 1H5VA 3GD6A 1RJRA 4EYIB 3OG2A 4FP1A 3KS6A 4GY1A 1JD9A 2J6UA 1PDYA 4FXFA 2VD9A 4YTUA 3DEQA 1O4UA 1XC6A 2WMKA 3CWOX 3G6MA 3E5PA 3M5YA 1CB7B 1ZAJA 2XCPA 1ZQ5A 1QFEA 3PWAA 4S1FA 2G3NA 1UKOA 3GV5B 1Q4NX 2DZXA 3OGRA 1QW7A 3W7LA 3CQKA 4S3CA 2REQB 5GJPA 4CD7A 1ME7A 3B8UA 1GQIA 4S39A 4LAZA 1DJHA 3UG3A 1PZ2A 3GXFA 4P5UA 2NXHA 3VKCA 4D6HA 3CMFA 3RX2A 3EA3A 3MSGA 5AHIA 4MJMA 3RPMA 4QS5A 4PUDA 4NI3A 3RXZA 1T3NA 1M5WA 2O92A 5AB3A 5F2GA 1JPIA 1KQYA 3UA4A 4YVPA 3A12A 4UMAA 1RD5A 3KTCA 1S46A 5JVLA 4MOZA 3AIEA 4C5ZA 4GH1A 4LYKA 1NDZA 1B0IA 1VP5A 1ZFJA 2W5FA 3BXWA 5EMLA 3ARRA 4NAEA 1HVXA 3N2TA 3I7QA 3Q58A 4MAVA 1D3HA 4QROA 4M6QA 2WZIA 4J2PA 2O55A 2NW0A 2YXGA 2DH3A 3DN5A 3MCOA 1UC5A 4A2RA 1IGWA 1XCWA 2QQ6A 1W3LA 4FNPA 2PDLA 3RYSA 3T4CA 3QC0A 3A9IA 1GPWA 1KFCA 5KFUA 4LRSA 1CXIA 4X61A 1Q66A 4O16A 3N73A 4KFPA 4EPBC 4WY0A 4EWJA 3V0UA 1H50A 2Q09A 3QXBA 2J6VA 4HYWA 2X7WA 2C18A 3U5UA 4AIEA 2X1IA 4CN6A 2OYLA 4IMCA 1SZGA 4LU0A 2F6XA 4LYRA 3HURA 2WC4A 2A3HA 1KTNA 3UJFA 5I7GA 4BI7A 2G50A 4M8UA 3CZKA 4DXKA 1OEPA 5FL1A 1V3IA 3PBWA 1UD6A 2I9EA 1GVYA 1S5TA 4GVFA 4GX8A 3H6OA 3T2OA 1H49A 4ML4A 4GI8A 4PMQA 4Q8PA 3WNLA 4PBEA 4YNGA 3PW7A 1S2TA 1KCZA 4LAOA 3TYAA 1KBKA 1GJUA 3W6MA 2W9CA 1PCWA 3S2NA 5DMYA 4A2SA 2HXTA 2OOGA 3G1HA 4LUYA 2BHYA 4AD5A 4W86A 3BICA 4HGXA 3IUDA 4HMEA 2QR6A 1DKWA 3LX9A 4FR1A 3GBDA 4WR3A 3SGGA 4AIUA 5FJTA 3WN6A 5D2VA 5H8MA 3W1PA 3GVWA 2ZRWA 3WK0A 1WOBA 3V0SA 1MVYA 2GGHA 3ZXWA 1J5TA 4LV4A 2XIOA 4QS6A 3NDZA 3VKBA 1YTDA 1GEQA 5DLGA 4XZNX 2V82A 3FNDA 2DSKA 3S1VA 4AEFA 4ZR8A 1GEHA 2GPTA 4O1AA 4Q8MA 1M03A 3GTHA 5AVNA 4O1FA 1FWFC 3R7MA 3DERA 4URIA 1DJNA 1J01A 4DF2A 1QPKA 3BSHA 3RLUA 3VIHA 4CD4A 2Y8VA 1W9BM 4JBRA 4ZXLA 2OT0A 5KITA 3VDGA 3IK2A 5D2WA 4J40A 4NAFB 1JCYA 4LX4A 2YL6A 4UNKA 4E2DA 4NVTA 5BOEA 3QR3A 1S38A 4CU6A 2VHLA 3CL8A 3QV8A 5DMMA 1EF2A 1XIBA 3BH4A 1ZPTA 3KCJA 3IS4A 1TTIA 3JW7A 4GNJA 2PDBA 1DIKA 3W1QA 2QUVA 1V03A 4EBCA 1F8IA 3RBEA 3VKDA 1ZJBA 2WVVB 3M41A 4R34A 3B8IA 1POJA 1KR1A 3PBVA 4TVUA 3K4DA 2R1LA 4M5PA 4A4AA 3UWUA 4H8VA 2QT3A 2MNRA 1WB0A 2A3AA 4ENLA 1U2YA 2Q02A 3CMJA 3WF2A 3KXQA 4B3ZA 3TR2A 1B9BA 2CZ5A 1H63A 3N2XA 3UY7A 1V51A 4DUXA 2HV5A 1RHCA 3UBPC 3R79A 3CYVA 3UWVA 5CPSA 1T99A 2VWSA 3DI1A 2WC3A 3AAMA 2FHFA 3IRSA 1PB0A 4ROQA 1YBQB 3CHDA 5CGQA 2PF0A 1I6NA 4KQNA 3V6JA 1Q6OA 1VBJA 2VX4A 1KLZA 4RL3A 1BD0A 3MCMA 3ARVA 5BWFA 2VZSA 4D6IA 4XD3A 4OT7A 3OVGA 1U5JA 3F4VA 2R9RA 1WZLA 2PWHA 3QR1A 3IACA 4AY7A 5HBFA 3EKGA 4IFKA 4Q8OA 4P8XA 2FIQA 3W7JA 2WMIA 4PCFA 3OHBA 2VX7A 3CIWA 1WE5A 4K1WA 3NGFA 2PRMA 5AHMA 4F4XA 1SR9A 1LLOA 1Q8JA 2VC6A 4WJXA 1F07A 3HA1A 2Y4SA 4MB5A 4PL2A 4NXKA 2BXYA 2XGBA 2IW0A 3S2MA 1FDYA 1N8WA 1QXLA 3MUXA 4B91A 4QJ1A 2R1MA 3FW6A 2EG8A 1AH4A 5CSSA 2J24A 3R8GA 1H7XA 3VILA 2FJKA 3SUUA 3B0XA 4IISA 3SURA 4V33A 4IM4A 4DEFA 1ELSA 1UP3A 4UFIA 1VB9A 5D04C 4JQ1A 4HMCA 3PVFA 1RALA 4NNBA 2TRSA 1QI0A 3SUTA 3ZWSA 3O1NA 2HE8A 3PZ9A 3E2QA 1WNOA 4UOZA 3T78A 4U33A 2OQYA 3EAUA 4B5XA 4LBRA 1OX5A 5FCZA 5ABEA 4LS1A 2BVDA 2YCIX 1C92A 2RKXA 4UNIA 4AZHA 3THUA 3GY1A 5KFTA 4MHBA 3MUIA 1PCKA 4M1RA 5E9XA 2IMRA 3IN5A 1NP2A 4J4KA 3Q94A 4F40A 3QRHA 1QNPA 2OVLA 2CETA 5KFGA 3RCNA 4DWSD 3QM3A 1OC5A 1HTIA 1N7KA 3WLPA 4O19A 3K4AA 3WQ5A 1E0UA 3PP7A 3W2LA 4W9TA 2C3ZA 4I90A 1OZMA 1V6VA 4G7EB 1K1SA 4R8UB 3WJXA 5XIAA 1QO2A 3R4IA 4IWWA 2P0IA 3PWIA 5CJ5A 3SN1A 3SW6A 4H2CA 4H7ZA 4E4FA 4YXGA 4WLCA 2PBOA 5BXSA 1A0EA 1PE1A 4KCVA 1N48A 1Z41A 2IKJA 1KQZA 1JQXA 5BZAA 1N55A 4LCRA 1CXLA 2UVWA 3AMDA 1I2QA 4HK5A 3VMOA 3HM7A 2QAPA 2HISA 1XM3A 5FAJA 2D3LA 3H2NA 2OR2A 3LCGA 1LZOA 4NI8A 3NO1A 1PYMA 3VGBA 3UPMA 4NJKA 3KOYA 4IQDA 5A6BD 3HB9A 4RJEA 3VVGA 4Y9MA 4LGXA 1WX0A 1VIWA 1Q4WA 4AB4A 3LENA 4A29A 1IR1A 2BOGX 2WANA 5C55A 5A1AA 4ZBCA 2GGIA 3T0AA 1ZHAA 4INFA 4K39A 2ZUTA 1OG6A 1XSKA 4PSPA 3GXMA 2B81A 4L61A 3WD1A 1E40A 4E2OA 4XIAA 2V4QA 3VD4A 1POKA 1VPYA 1X6NA 2QF7A 3KBVA 4G6CA 1CLKA 4GG9A 2UZ9A 2JGQA 3KZSA 4JN7A 4XAGA 1ICPA 3QHMA 2GSJA 5F1VA 2XG9A 1H5YA 4RCXA 1VD6A 1FY6A 4AW7A 1TJ0A 2CBJA 3FKKA 3T8LA 5D37A 1FWJC 3VZYA 4CD8A 4S23A 1UG6A 1R3YA 1EOMA 3WNOA 4IJRA 1VLIA 3VOIA 3B8SA 3AXMA 5CC3A 4IGSA 2QXWA 3ITCA 8XIMA 2NVCA 4ZOCA 1IEQA 1HO1A 5KT3A 2I16A 4UB9A 1T8QA 4UTTC 3HN3A 2HTMA 2W91A 1TSIA 1SVDA 3I6RA 4XO6A 3N9RA 2CEQA 2BOFX 1XIIA 1XX1A 3G8EA 3EKLA 1W8GA 4HNVA 3LEPA 3LHVA 1WKDA 5FSDC 1PAMA 3GG7A 4LUTB 1F2JA 1R2RA 3RU8X 2XWDA 3LN3A 3CT2A 4US5D 3VGEA 4IX2A 4MIMA 4U2YA 3KVMA 2ASLA 3GQYA 5KFBA 3H2CA 3F4WA 1NOUA 1K4HA 5DXYA 1X96A 3GHSA 3KLLA 1B4EA 3O6YX 1LM1A 3E2VA 1JX4A 2ZKMX 4LUIA 2G5WA 2C16A 2Y8UA 4JTIA 2GVLA 4NLGA 3K8MA 3EEZA 4DPQA 3OA5A 1GKQA 5KFSA 3G6VA 2X16A 2CYGA 2DFAA 3EWZA 2H9AB 4NY2A 3UZYA 3PNZA 3CV7A 2HVMA 3IPWA 1RK5A 4RNOA 1HKKA 2GSHA 1EBHA 4JFTA 1EA0A 4AMAA 1Q5MA 2EXOA 5F7UA 3WNPA 3GK0A 4LUJA 5HXMA 5CCZA 2GGJA 2XDFA 3P60A 1V4YA 4Z0SA 3W4RA 3P3BA 3EDFA 3M9YA 3TTYA 5D05A 5BOFA 5C8BB 3WDPP 2RAGA 4I9MA 2FGBA 3GVRA 5KFWA 3NCOA 3E9AA 3L0KA 1P0BA 2NQHA 2QIWA 5F4SA 2WSYA 1BSIA 4IPLA 1EHNA 1K7XA 2VEMA 1PZ0A 4TXEA 1W5NA 4A3QA 3S9ZA 3UXIA 3H2FA 1UP2A 4L4MA 4HA3A 3W71A 3NO5A 3EA1A 1ONXA 3KDOA 4GVIA 1I0BA 2BP1A 3H4GA 2V5CA 1QOPA 5FJPA 5I3FA 2BY3A 1BSLA 3G3DA 5D8ZA 5A8PA 5DQPA 8CGTA 3VIOA 4DAFA 3CZJA 1VHCA 4GYJA 5JMUA 3MR3A 1IR2A 2CBVA 1IZKA 3KWSA 2RDTA 3VOJA 1OYCA 1GVIA 2D69A 3AMCA 2KZHA 4HA1A 1PTAA 3B3DA 4K8HA 4O1DA 2HBVA 1J0ZA 3GAKA 1J10A 3UP8A 4RDYA 1AZ2A 4LSBA 4LFYA 5F4XA 3SBFA 1TUFA 1W3JA 3CHCA 3O6AA 5XIMA 1YHTA 3BLIA 2Q71A 1TV7A 2R8JA 3EPNA 4WKAA 3W2JA 4JNYA 3UPWA 3WQFA 1KNWA 1KGXA 5L9XA 2F6UA 1HL8A 3ZVHA 4GGHA 1VIZA 1YPIA 5AC5A 4XD5A 1WDWA 3VIKA 5H91A 3ARTA 4CQAA 4MG4A 2Y5EA 1TPUA 4J35A 1PKNA 2DEPA 2HMCA 1ISWA 4ZQPA 4IOTA 1TJ2A 3MO4A 1A50A 3TQKA 4DZHA 3FXYA 2IPWA 4GO8A 5AZ0A 1XI3A 2OSYA 2C79A 5E09A 2VC7A 3AROA 2G4FA 3H2MA 2W9BB 3DECA 2OWXA 3TV8A 3B9AA 2CC0A 1YX1A 3VIPA 1YE4A 2HK1A 4DJED 4RNJA 2FTYA 1ZGDA 1WKEA 1WO2A 3F5LA 4Q4KA 2AU0A 1JAEA 1SMAA 5ABFB 1E6RA 2ESCA 2XH4A 1TELA 4Z0JA 4HNUA 5C54A 2IPJA 3UZ5A 4W7UA 1XS2A 3T6CA 3CUZA 4UQBA 7ENLA 1AMYA 3BMWA 5IHSA 3UNDA 3C8NA 1H7NA 1I9CB 2BQ3A 4A3UA 1CT5A 1UD4A 4WIWA 4L1WA 1DIEA 4ADTA 2I5QA 1QDSA 5KT6A 4QSFA 2YCLA 1PVNA 3DU0A 5DX7A 5I24A 4MJZA 2ZUWA 3NZGA 4O1BA 3LLXA 2V5JA 3W1TA 1XFBA 4DJFD 3TTQA 3CH9A 1ONEA 1Z32X