1J6PA

Crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
407
structure length
407
Chain Sequence
HHMIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords METAL-DEPENDENT HYDROLASE OF CYTOSINEDEMANIASE/CHLOROHYDROLA
publication title Crystal structure of Metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (TM0936) from Thermotoga maritima at 1.9 A resolution
rcsb
source organism Thermotoga maritima
total genus 132
structure length 407
sequence length 407
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1j6pA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6pA02
3PAOA 1XRTA 4LCRA 3OJGA 1V77A 1POJA 2QPXA 1RJRA 3E2VA 4LALA 2Z24A 2R1KA 4MUPA 1FWHC 3TN3A 3FDKA 4L9XA 2D2JA 2HPMA 1UIPA 1PTAA 2AQVA 1K70A 4PBFA 1ONWA 2YZ5A 2GSEA 2OOFA 3RN6A 3NURA 3LNPA 4BY3A 4XAYA 4CQDA 3QGKC 4HA0A 2UZ9A 2R1LA 4C6PA 4CQCA 3S2NA 3K4WA 4IGMA 4CNTA 4G7EB 4CEXC 4RDYA 4CNUA 4KESA 3PANA 2PLMA 1FWBC 3CS2A 3IGHX 5E5CA 4C5ZA 1IE7C 3F4CA 4XD6A 4CNSA 3MVIA 4LANA 2EG6A 4E3TA 4INFA 4C6JA 2ANUA 3T1GA 3GTHA 4XD3A 2GWNA 3A4JA 1A4LA 2BB0A 4G2DA 4B90A 3LGGA 1EJVC 1NFGA 2QT3A 1R9YA 3MKVA 4PCPA 3E38A 2Z26A 1RA5A 4LCQA 3O7UA 2XIOA 5FSDC 2DVTA 4HK7A 1FWAC 1WXYA 1KRMA 3URBA 4KEUA 3UBPC 3E0FA 4LAKA 2VR2A 4YIWA 1BF6A 3UR5A 1NDYA 4PCNA 4GXWA 1R9XA 2Z2AA 4ZSTA 1YRRA 4AC7C 4LCSA 3S2MA 4NG3A 4C6DA 5HMEA 3MSRA 3GU2A 2FTYA 2O4QA 2O4MA 3T8LA 3AU2A 4GK8A 3HM7A 4C60A 4IFOA 3ICJA 2EG8A 3LSCA 3IACA 4G7EA 4KEVA 4DI9A 4GY7A 2FVKA 4RDVA 3GG7A 1FWDC 4RDZA 3E74A 4GYFA 4C6QA 4GX9A 3GU1A 1PO9A 1NDZA 2HPIA 2Q09A 3TN5A 4J5NA 3URAA 3OVGA 2RAGA 2Z28A 1V7AA 4DNMA 1E9YB 1YBQB 2WM1A 2Z4GA 4XAGA 1QXLA 3HPAA 1ITUA 3OQEA 4ERGA 2HBVA 4H9VA 2CZVA 2OGJA 4IQJA 2Y1HA 4C6IA 1A5NC 1S3TC 3G77A 4IGNA 3SO7A 4CQBA 4C6KA 2R1PA 4V1XA 2Z2BA 1A5OC 1RJPA 3GGMA 2R1NA 3KM8A 2ADAA 1V79A 3S4TA 4KQNA 3K5XA 3LSBA 4EPBC 2WJDA 2Z00A 4KETA 1UMLA 1PSCA 4HJWA 4IFKB 3A3WA 4C6CA 4GY0A 3PBMA 3PNUA 1ZZMA 2VUNA 3MVTA 4EPEC 4GY1A 3UR2A 2EG7A 1FWIC 3TN6A 3PNZA 2FTWA 4IF2A 4EPDC 3LGDA 4RE0A 1EZ2A 2OB3A 4JOMA 4Z42C 1DPMA 4H00A 3B40A 2WJEA 4CEUC 3DUGA 4WVXA 3ORWA 2PGFA 4DIAA 1EJWC 4F0SA 4NI8A 1UIOA 4KERA 3HTWA 4QS5A 1YBQA 3B0XA 4GZ7A 1RK6A 2FFIA 4C6MA 2DVXA 1K6WA 3ID7A 1JGMA 2VM8A 2HQAA 2GZXA 4GX8A 4M51A 3AUOA 1FWGC 1KRCC 3A3XA 2IMRA 3QY7A 1I0BA 3LA4A 3DC8A 3GTXA 1XRFA 1A4MA 4H9ZA 4C6NA 4ICMA 4C6LA 2D2GA 3F2CA 1WXZA 2FVMA 4L6DA 4QROA 4LFYA 1YNYA 3V7PA 4ERAA 4PE8A 3E0LA 2D2HA 3IPWA 4IFKA 1EJTC 2YB4A 5CH9A 1GKPA 2E1WA 3CJPA 4I6VA 4UBPC 2DVUA 1E9ZB 1FWJC 1NDVA 2PGRA 4H9MA 4B3ZA 2HNHA 3O0FA 3LY0A 2YB1A 4D8LA 2ZC1A 2A3LA 2OQLA 2ICSA 2P50A 4GBDA 5HMDA 3GTIA 1RK5A 3F4DA 1W1IE 3GIQA 5G4HC 2AMXA 3S2JA 1EJXC 4J2MA 1M68A 2GOKA 2PUZA 2W9MA 4C6EA 2WJFA 4AQLA 4TQTA 4QS6A 4XD5A 4HK5A 2I9UA 1KRAC 2VC5A 2E25A 4QTGA 4DYKA 3WMLA 2UBPC 4NP7A 4KEZA 4P5UA 4BJHA 1UBPC 1VFLA 4EP8C 4XD4A 4HK6A 4WGXA 3LS9A 4ERIA 1NDWA 3UPMA 3QY6A 4H01A 4XAFA 3SFWA 3FEQA 3IV8A 2Z25A 4LH8A 1RJQA 1RA0A 2P9BA 3MTWA 1V51A 4ZSUA 3OODA 1I0DA 2Z27A 1RAKA 1V4YA 1FWFC 3OU8A 3EGJA 4C6BA 4R85A 4H9TA 4GC3A 1A5KC 3GU9A 3IRSA 4QSFA 3RHGA 4H9YA 3ITCA 1XWYA 4J35A 1M65A 3RCMA 5A6TC 3NQBA 4V1YA 2HBXA 3UF9A 2GWGA 3GRIA 3IJ6A 3QY8A 1P1MA 3GTFA 4DZHA 2VC7A 3JZEA 3EWDA 1GKRA 3URNA 3C86A 2QS8A 1POKA 4F0RA 2BGNE 4OFCA 3T81A 1J79A 3MPGA 1O5RA 3F2DA 1FKXA 4IG2B 1PB0A 2P53A 3TNBA 3RYSA 3MDWA 4C6FA 1FKWA 3D6NA 4EPKA 2KAUC 1J6PA 4RDWA 3OOQA 3LU2A 3WZ0E 4RZBA 1J5SA 3S2LA 3NEHA 4DZIA 1QW7A 2Z7GA 1K1DA 1P6BA 1J6OA 4B91A 3TN4A 2YXOA 2PAJA 3F2BA 4IH3A 4XAZA 3N2CA 2AQOA 1EF2A 3IARA 1HZYA 2QVNA 1KCXA 1R9ZA 4R88A 2VHLA 1A5MC 3GIPA 4PBEA 4KIRA 2Z29A 3WYZA 1FWEC 2I5GA 4QRNA 4H9UA 1O12A 4H9XA 1EJSC 1XGEA 1GKQA 3CAKA 3E3HA 1EYWA 4C5YA 3AU6A 4LEFA 1M7JA 2G3FA 4GOAA 1A5LC 1EJUC 4IFRA 3B0YA 4DLFA 4LAOA 3URQA 1ADDA 4LAMA 5AKQA 4B92A 4DI8A 2OODA 1YIXA 3K2GA 1KRBC 3MJMA 1P6CA 3MDUA 4DLMA 1YMYA 4BKNA 3EWCA 4UB9A 3FDGA 5FSEC 4C65A 4IG2A 4KF1A 2Q01A 4DO7A 2F6KA 1EJRC 1ONXA 3DCPA 3ISIX 3GUWA 1FWCC 4R7WA 1ITQA 5LXXA 3R0DA 3QGAC 3BE7A 2R1MA 4C6OA 4WHBA 4F0LA 5HMFA 4I6KA
chains in the Genus database with same CATH superfamily
1XYMA 2RDWA 4AF0B 4U28A 3EA2A 3LTYA 2OX4A 1IHIA 3SGZA 2Q3OA 4AD3A 3AIVA 4RZ4A 3TW9A 3ITVA 4JCMA 3GNXA 1AH0A 4MM1A 4E4UA 2AQVA 3P0XA 1I45A 4GO9A 3MUAA 1OK6A 4GYPC 3ZS4A 3ITOA 4UXDA 2YL8A 1IV8A 3PZQA 1U30A 5G5IA 1QFEA 3DU0A 4HA1A 1OJXA 3ARTA 4LANA 3VGDA 1TV5A 3UJEA 1HW6A 4PODA 3TYDA 4V33A 3PWGA 3CQKA 3TJXA 3KVLA 2ZTKA 4JDBA 2QJGA 2IQ0A 2OYLA 2NT0A 1TB3A 1F3EA 1NFGA 2RGLA 4ZB0A 4D1IA 1UBSA 2HSAA 4ZCWA 5EBUA 4ZO9A 4O8RA 3R13A 1YPXA 1XCFA 4AF0A 2X30A 3O7UA 4FLSA 1XIDA 3H2CA 2C0AA 2BG5A 4FEZA 3BMXA 3N6JA 4MWAC 2C19A 4JV2A 5CSYA 2QUMA 4S2BA 1E6PA 4GPNA 4YIWA 2CLEA 2XN1A 6REQB 2YDRA 3MMTA 1VHNA 1EDQA 1T8QA 1V02A 1HVXA 2EG8A 2RUSA 3EKGA 2ISFA 1TE1A 4X2RA 1ZGDA 2PDYA 3G2GA 2Z1XA 4ZB5A 2FH6A 3M07A 3EX1A 2XH2A 2P3EA 4QE4A 1U5JA 2XFYA 5I3KA 2C6QA 2VX5A 3W7GA 5F2IA 3NO1A 4D6DA 1H61A 1XG3A 1US0A 3LI1A 1NFBA 1P7TB 4DJFD 2Y1HA 2CLPA 3PG9A 4F8XA 4WKFA 1V6VA 4CN4A 3HFYA 4EF9A 1W9BM 3P93A 4A3QA 1HT6A 1YE6A 3INPA 1W17A 1ZFJA 4RZ5A 1E43A 1C29A 3PBMA 4CLMA 6REQA 1AA1B 1UHVA 3PTKA 1CB2A 1LLOA 1DWIM 7PTDA 3GO2A 2WAGA 4O8AA 2PDFA 1XIBA 4QHRA 2ZZ4A 3DFHA 2IW0A 1V02E 1DJHA 2PDKA 3W00A 4DJDC 3NQFA 1LWJA 1Y8BA 2CBVA 3LBCA 3ZJKA 3DUGA 5H1WA 1B57A 4NI8A 5D30A 1UC5A 3PZGA 2OWCA 4ZE5A 1P7TA 2KX9A 3FVDA 3MV01 4IGSA 1UA3A 4KKXA 3RAQA 4BWLA 1ZCCA 2GQAA 5JUMA 1S2TA 4HMEA 2PGWA 3L4WA 3ARRA 3QPEA 4M29A 3M7SA 1IXNA 1WXZA 1N8IA 1K7XA 3V1HA 4DRSA 4KFNA 1HXJA 2XIQA 3FK4A 3H2OA 3N9SA 3RFAA 4D6FA 5D2VA 1VYSX 5CJNA 1K03A 5HK4A 3CJPA 4E38A 2UY2A 3QR0A 5D2YA 1I75A 1JI1A 3V0TA 1XINA 5GQBA 4AEFA 2E7FA 4F48A 2YB1A 2BXYA 4QWEA 4LNYA 1W91A 5HMDA 3L0KA 5AYZA 4FIQA 4L4OA 3NA8A 1WAWA 5EWGA 5KFTA 3EX4A 3UEQA 6A3HA 4UQDA 3PK7A 4JFWA 4HK5A 2VO5A 3B06A 1TV4A 3G6LA 4US5A 4DYKA 3C0LA 2Z0IA 1NF0A 2NZLA 3TH6A 4QE1A 1UBPC 5HOSA 5K2ZA 4XZNX 3WNMA 4J9OA 3WLNA 2WVSA 3QY6A 3RX3A 4FLRA 2XN2A 1R38A 2VX4A 1PZ3A 1R3YA 4L1GA 1DHKA 3A5VA 3EGJA 3BQ0A 4QEHA 3NQMA 3DHFA 4FB7A 1Z3NA 4QSFA 4L6OA 4JYEA 1E9LA 1B54A 2VRQA 4P7LA 1VIZA 1YE4A 1HJQA 3KL0A 1Q7ZA 1W3KA 2GWGA 3AXMA 1FQ0A 1TZ7A 3N3TA 5GVJA 4FBTA 4BA0A 2PP1A 1C7SA 4NXKA 1BYCA 4DY1A 1B4EA 1YXCA 3PW5A 2HMCA 1XX1A 1MQPA 3T0TA 5BYWA 4J7RA 4IP5A 8XIAA 3SADA 4UUIA 4K7VA 3ZIZA 1V8EA 1XYZA 2PRHA 3T2OA 1U2YA 3MDWA 1HL2A 4JTHA 4DL4A 3SQMA 1FKWA 1R3WA 5LIWX 3LHZA 3FSTA 1YPFA 4LYKA 1NF7A 1VGAA 3PTQA 1EUNA 2BY1A 3F2BA 5FJIA 2QXWA 1K1SA 4JKKA 1HZYA 2VA3A 1KCXA 1R9ZA 3UGRA 3GIPA 3GE7A 4ECTA 2I5GA 5XIAA 4QRNA 1FX6A 4H9UA 1KBBA 1EDGA 3WELA 4AHPA 1ZP3A 3THQA 1SO5A 4ADTA 5A8NA 5EDWA 3ITXA 1PKLA 2BQUA 3PZIA 5KFGA 5AOUA 1AW5A 1F8IA 9CGTA 3UWZA 4DBDA 2V3GA 3EDKA 3Q8RB 1TV2A 2NUXA 1G9HA 3F03K 4IHCA 1DJQA 2PF8A 1TMQA 3W74A 2PU0A 1O5KA 1R3TA 1CX9A 1CXEA 4QIUA 4ALDA 3WF3A 2R1MA 4O18A 1XDLA 2DZXA 3BVJA 1XRTA 4I5RA 3UZZA 1JUEA 3BWWA 3IAPA 3E2VA 2VR5A 5AHEA 2R1KA 3QV8A 3G1DA 4UZUA 1O5QA 3W7HA 2V3EA 2BGQA 1V5XA 4YPJA 1DJIA 5FJOA 1VJIA 3UETA 3K8LA 4ZR8A 2FLLA 5FEXA 1K70A 5FJRA 2DT2A 1S2UA 1GQJA 3NURA 3GW3A 4A29A 4A05A 3S3GA 1FCVA 1G4PA 4E6MA 3U57A 4CVUA 2ZVRA 1LL6A 4KESA 3R8GA 4MPQA 2PLMA 4EEYA 4GVGA 1Q4NX 1ADSA 1GJWA 3NL6A 5DCEA 2EG6A 2J88A 4OIFA 1PZ0A 4WIWA 3OSNA 1H49A 4H83A 2XIJA 1ALDA 2DEPA 1A4LA 3N29A 3T09A 3T2QA 1ME9A 1E6QM 1GVIA 1AW1A 3ARWA 4JTLA 1JCXA 2R6OA 3TTYA 1J96A 4XTIA 1JQVA 4QW8A 4LY8A 1RA5A 3GM8A 1Z42A 1ZBKA 4UMBA 3W3OA 1OEPA 5DY2A 1XRSA 4EVZA 4AWSA 4EANA 4Y2WA 3VAVA 1M41A 1W54A 3QV7A 4IFOA 2V5LA 4FHAA 5EU9A 3ITGA 4Q32A 4YWSA 4KEVA 1MNSA 3MU7A 1LZOA 3NO3A 3WH6A 1HJWA 4TU1A 1XW8A 3GYEA 4DO5A 4NASA 5KFCA 2X1TA 5D2WA 1PO9A 3TN5A 1P48A 3TW6A 2X7VA 1NWRA 2DQWA 4OUIA 1OFRA 1ITUA 3NG3A 4ZQNA 4XZLX 1GG1A 3I65A 3TC6A 3KTSA 4IGNA 4GQRA 5FD0A 2XG9A 1VJZA 2Y7DA 2OO6A 1V79A 3PW7A 3M47A 3UU0A 4WKAA 4NXSA 3VZZA 1JPHA 3N19B 1CXKA 3FYOA 4HNCA 2V30A 1TTPA 3L4UA 2P10A 3HPFA 3UG5A 3PNUA 3CMGA 4DM2A 5T9BG 2WC4A 4XKMA 4YHEA 3TSBA 5LNUA 1RVKA 3HV9A 2ZKMX 1WDWA 1SU5A 4TXEA 3LPGA 1VEMA 3W7PA 5EFFA 5KT2A 3D5HA 4NZCA 4Q44A 1RYRA 1GK8A 1S3HA 1EGMA 1ZJHA 3LNMA 4PEEA 4WF7A 4Q4SA 1B3YA 3SSJA 1UWRA 1UKTA 2EKCA 2XFWA 1GQLA 1KFBA 2X1IA 4M24A 2V8ZA 1IF2A 1EKOA 2E5CA 2V5KA 4DBSA 1AJ2A 4L64A 4JFVA 1HIZA 3SUSA 3QC3A 4JX6A 1TVLA 5K7JA 1ZTVA 1W3IA 3LENA 5C7HA 1L6YA 1IZKA 4MNKA 1K9DA 2IXUA 3GVRA 4HYKA 4AZIA 4XK2A 1S38A 4B3ZA 1FHVA 3LY0A 5C70A 2ZXDA 3OA3A 1NSJA 2P50A 3FA4A 2FQIA 2BXVA 1AQ0A 5A6SA 1AVAA 1VC4A 2JEPA 1Z9AA 2EGZA 3KP1A 4IZGA 4TIMA 2PUZA 3BW4A 4GCXA 5H8MA 1WP6A 1GOXA 4I7UA 4RNMA 2IKIA 5FF7A 3WQEA 4HVXA 4P61A 3VIMA 5G2HA 4HQVA 4IXXA 2XPKA 2YCLB 4R7OA 3ABSA 2PA6A 5PTDA 1UJQA 1VFSA 1CTNA 5KG2A 2E6FA 3IIXA 4XUYA 3CMJA 3WNPA 3OQ8A 1VFFA 5FL1A 2AKMA 3W9ZA 4QM1A 4NZ5A 4ICCX 1RJQA 3QZ6A 4PTNA 2QCHA 4AIEA 2QJNA 2DJXA 2CU0A 2DV0A 1Q2SA 1GW1A 1W9DM 2WBGA 3QZAA 1E6XM 2ZA3A 5JXQA 5HPCA 1A5KC 5DN1A 3R8RA 2J77A 5CZJA 4HPGA 5GNYA 3VOJA 1X7IA 3K13A 3QY8A 3GTFA 4LW7A 1BG4A 2H90A 3GBDA 3KDOA 2YDQA 4NRRA 1AD1A 2QS8A 1POKA 4F0RA 3JVAA 4WLCA 2DP3A 1VEOA 4M1BA 4LEQA 2A85A 2PRLA 1SZEA 2A5HA 4ECXA 2YCLA 3V1PA 4WJXA 3NFUA 4EPKA 1UKQA 5AYXA 2NUWA 2XWDA 1U1JA 2PCQA 3E0VA 4O1FA 4D2JA 2WCSA 3IRDA 1E1EA 1TVNA 3M44A 2WVUA 5CZTA 4PBEA 4OECA 1DJGA 3TSDA 2DPEA 4H9XA 1T0OA 1RP9A 4AD5A 1LOSA 3CYVA 4Z2JA 3M0ZA 2FZDA 4R9OA 4L4MA 2G3FA 3DFQA 1CXHA 3B0YA 3TJLA 4LAOA 3UG8A 3AHXA 2AKZA 4E4PA 5BRBA 2XM1A 1HKWA 1UJPA 3QR3A 5B80A 5D04C 3T7VA 4AZGA 2QV5A 4HU8A 5FESA 4HBKA 4O3PA 3NL5A 2QIWA 3VKAA 2WYSA 3BLLA 3CB8A 1UR1A 4U5IA 3WIJA 5A6KA 1YDVA 4PC8A 5BOOA 4J3WA 4UFKA 4HU0A 5C8BB 1EYEA 2QPSA 4AZ5A 4AHQA 4EYIB 5AVHA 4QR6A 3W22A 1OX4B 3NVDA 2E6DA 4AD1A 4FR6A 3HMCA 2HE5A 3GNDA 4YNGA 4IR1A 1XLBA 2ZICA 4PN2A 3RJXA 4CD7A 3NQ6A 2WNNA 3E5PA 3W7MA 1C93A 2FMNA 1JEZA 2P8BA 2TSYA 5LIYX 2YOCA 3G5EA 4JTQA 3ZJ8A 3IAQA 5M2FX 1VB9A 4KPLA 1W9UA 4JS3A 4IL2A 4URIA 1P0KA 4AYSA 2FLPA 3WBAA 4O3QA 3G6MA 2JFEX 2PP0A 5HJYA 5E5CA 1B5TA 3PZMA 4WEVX 1I2OA 1RQEA 5J04A 4DHGA 1WNOA 3WD4A 3RIKA 3I6EA 3WLOA 2WXDM 5HXMA 1DWAM 3DKLA 1QI3A 3LGGA 3KXQA 4J3XA 3BJFA 4RCXA 4ZGYA 4LUSB 1OX4A 3FFSA 2O0TA 4JCLA 1WO2A 3HGSA 3V0SA 4MYXA 2J6UA 1G5AA 4J9MA 2IPGA 3MWAA 1DORA 1OK4A 2PC4A 4PUEA 1Q5MA 3EB2A 1VS1A 1EEXA 4ILSA 3ZWSA 1OABA 4NAFB 1K9TA 2DH2A 5D8WA 1ME8A 4C6DA 3MSRA 4FNQA 1FCBA 4F4ZA 1O95A 2Z1BA 3FOKA 3WLPA 4AU0A 4GUJA 5L1KA 1JZ5A 3BO9A 4PCTA 3MR3A 1M7XA 3UWQA 3KHDA 3AYVA 4FLQA 1K77A 4XZBA 5CEWA 1QHOA 5LSMA 3O16A 1QXLA 3EPNA 2VNCA 3GXDA 4H9VA 5CCZA 1MUWA 3GFYA 3G77A 3MHUA 1M03A 2R1PA 4V1XA 1R5YA 4LUSA 3NM3A 5DQGA 3GILA 3H40A 3KHHA 1LRQA 2C79A 1XUZA 2CCRA 3TW7A 4RW3A 3QW4B 1F6PA 5M03A 2J79A 3KVMA 4MUZA 4R8UB 4LVGA 4JKLA 6ENLA 2B0MA 3QPYA 4HJWA 3VIFA 1Q8AA 1YNPA 1E0WA 4NAFA 3MCMA 3P74A 2CLOA 2NV2A 2PP3A 5D2XA 2WC7A 4NVTA 1J2BA 1Q4WA 1UWTA 1ZS2A 1DV7A 3OBEA 4US5D 4WDTA 5CPNA 4FBUA 4ZQCA 3BDKA 4ECWA 1RR2A 4J3ZA 4ZEPA 5I0DA 1GT8A 2ABBA 1XPGA 4F2UA 1KM0A 1UIOA 2P0IA 1QNSA 4QS5A 1UH2A 2QUUA 1KNWA 3CB3A 2FB3A 4LF2A 4GBUA 4AEEA 3N4FA 4PL1A 4K36A 2PLCA 1ZB5A 3LA4A 4HNLA 4KEMA 1A4MA 3U4AA 4AVOA 5KZ6A 4IPNB 1D8CA 4ZOCA 1UG6A 4ERAA 4R8UA 2VFDA 4EYHB 4B5NA 4I8YA 4WUIA 3R12A 5HUOA 3CQHA 4QP0A 3W71A 5AY7A 1N7KA 4O3NA 2PGRA 2QIIA 3MS8A 3DHDA 5LNWA 5I6SA 4D8LA 3NR0A 3EB3A 2ICSA 4IX2A 5IXEA 3PF3A 5CC6A 3GIQA 1PAMA 1IEVA 1D9EA 4DJED 2PF0A 2CNCA 2NX3A 5EA9A 1PIIA 4B4FA 2OT1A 1VBHA 9XIAA 5CPTA 2OJPA 5HDRA 3CGTA 4W84A 2D1ZA 3CL8A 4XWUA 1JPMA 4NL1A 4W93A 1XIHA 3GVWA 4WGXA 1GQKA 3DOPA 3UPMA 3SI9A 4GQQA 1R85A 4JL2A 2NV9A 3MV11 1RA0A 4QWDA 4IP4A 5C5JA 2VVNA 1NWTA 1RBAA 3MUZ1 2QZRA 2IUZA 3RUBL 1Q3NA 4DNHA 3VCRA 3TV8A 1EXPA 4NNBA 5A2BA 5F4SA 1VIWA 5KT5A 2CHNA 4IMGA 3GIIA 2JF6A 2HVMA 4EBCA 1FDZA 2V67A 3V6JA 5KFDA 2PWDA 2V2DA 1UWAA 3N15A 1SVDA 2PLKA 3HU7A 2VYOA 4JAWA 3C86A 4MHBA 3HURA 2DPJA 1LL4A 4HB7A 3PZOA 2ZX8A 4PSPA 2QDHA 2VCAA 4QAIA 5T14A 1PB0A 5LNRA 3BXWA 5FAJA 5HA7A 3ZLGA 1Z48A 3S6DA 3U8GA 3OB8A 5KFJA 5KFZA 1SFLA 3WLKX 2C14A 2NQ9A 3QMSA 3DFSA 2QVNA 2J7FA 1DYSA 3VXGA 2FHBA 4PBGA 3GQCA 1KM1A 1DXIA 5DG8A 2A4AA 4HN4A 1HL8A 3R10A 1BTMA 1RLDA 2ZX6A 3E3HA 7XIMA 4LEFA 3LERA 4WJEA 1A5LC 3G1AA 3CNYA 3TZNA 1KCLA 4O3SA 3VMNA 4DI8A 4O28A 2OODA 3LYEA 1H7WA 2OFJA 4BEQA 1P6CA 1A47A 4RPQA 1E40A 1JD9A 1NOUA 2Q01A 2VEPA 1L8NA 1QT1A 1UQZA 5D38A 4B4HA 1RUSA 5IDZA 4DXVA 3NXFA 1B9ZA 2VI0A 1TTJA 2WANA 4UFHA 5A6BD 4HT3A 5REQB 1PKNA 3WLIA 5D32A 3H12A 3OJGA 4RNFA 1FBAA 3PVXA 1IT0A 1XLEA 2PDGA 3GFXA 4KGLA 4OHQA 3WJZA 1TQJA 2D20A 3WDHA 1K9FA 3W4RA 3SN0A 1TZZA 4UQ9A 1F3TA 4LTSA 3EBVA 1UR2A 3M5XA 3ZOAA 1GW9A 1ITCA 3VOFA 5CZKA 3QQWA 1GPWA 3RB6A 4UZSA 4CNTA 4JTCA 3MP4A 1FY6A 3GXNA 3H2FA 1QI0A 3IGHX 1VFTA 1L6GA 3CL6A 1CGVA 3TEVA 2J7EA 1OF6A 2OLHA 1KQYA 3IK4A 1DIKA 3IIOA 1K9EA 2VWSA 2Q6ZA 3QJAA 2PWHA 4PB5A 4PCPA 3GD6A 3H55A 1XLMA 1CZ1A 3KZSA 2DIKA 1NP0A 5REQA 5U4NA 2CZFA 1HO1A 1TWSA 2YW4A 1VBRA 3N11A 3GXIA 3GHUA 1H09A 2WQDA 4I3GA 4RZ6A 1WE5A 4MNLA 4DQWA 4OGZA 5DLCA 5T91A 3ZMRA 1OCBA 3PPFA 3QLLA 2VR2A 3OHAA 4PB4A 1M5WA 2XU2A 4PCNA 4QE5A 3W7EA 2C13A 3W7NA 5CLWA 4L80A 3S2MA 2PPGA 5DO8A 3T8LA 3AU2A 2TRSA 1J12A 4O13A 1UH3A 5FKYA 4NYUA 3N4AA 4UNLA 4N6EA 3LLFA 3MANA 3QSTA 4GYFA 4DAIA 3JW7A 4EBEA 1H1ZA 3L2MA 4RE2A 4E8GA 2VDGA 4UFMA 2Z28A 3WFAA 2ZXBA 2Y6ZA 4M56A 1E9YB 2NSOA 5AHIA 2GQ9A 3MSYA 1WDDA 4POCA 5IFTA 3NOYA 1A5NC 2WV8A 1V6WA 2Z1WA 4C6KA 3E6EA 5JIWA 3TQPA 4IPPA 3WQPA 1VLWA 3QZ8A 1A5UA 3UPBA 1ISVA 3E0WA 5HQMA 3TZFA 3TYAA 2PCEA 2RH9A 4J27A 4W86A 3L65A 2YL9A 3KHRA 3TXVA 2Y4SA 3N34A 4HP5A 3VKKA 3PNZA 3PUDA 4DB7A 3DC0A 4K68A 2EPHA 3MT1A 2F6XA 4M0XA 3I10A 1S39A 2PDHA 4HNTA 4AXKA 2WJEA 1C8VA 3KFTA 4DIAA 4HPXA 4OQVA 3BLIA 3LCXA 3OW1A 3FAXA 4ROPA 1ZALA 3Q58A 2ZDSA 4M6VA 2QDEA 5IBXA 4Z1DA 1PYMA 5DMYA 1IQ8A 1E51A 2GGGA 1BFNA 2YLAA 4LUTB 2VCCA 1N82A 2OSYA 3GAYA 4PB3A 2DW6A 4GIRA 1F3XA 1TELA 1D2KA 4YQWA 3V7PA 3DX5A 5F1UA 1AK5A 3SRHA 5CAHA 1JR1A 1XRVA 4JQAA 3V5CA 3CWOX 2YXXA 1I8JA 1W5NA 3ARPA 3G1VA 3BGGA 4AZ7A 5CPSA 4AIBA 4H9MA 4IR9A 1LQ0A 3CO4A 1FHDA 3GFZA 4BWLC 1MXGA 3FDSA 2V3FA 2WW5A 4DYJA 1FWTA 4JBRA 5LYRA 3GZAA 4HHHA 3GY1A 2WJFA 3DBNA 3H4BA 4TOQA 3P8IA 2IBKA 4BF5A 4HZ8A 4MIMA 1DIDA 3EMCA 2Z7KA 4JR5A 1Y7VA 2I17A 3C3UA 1ML1A 3P0WA 4LUTA 4XV0A 4AHOA 2BWGA 3BUVA 3LBOA 4YR0A 2NXHA 3E49A 3B8IA 1ZHAA 4EXAA 2ZDRA 3AS2A 2OSXA 3AIEA 4IIGA 4LVAA 3PR4A 3ITCA 1LT7A 1TJ0A 1XWYA 4O11A 5AYIA 2E5DA 4C90A 4V1YA 2BVYA 3UF9A 5KFIA 4O54A 3WK2A 2R8HA 1X98A 4DZHA 1XSIA 3UYIA 1PTGA 4ECQA 5AYBA 1RYSA 4V28A 2WKLA 4XKYB 4C91A 2C7FA 3K8MA 3W2NA 4DBWA 5KT7A 2BODX 1SFJA 2VP8A 1E56A 4I5UA 4GI9A 2JIEA 2ZRZA 3H4XA 2Y5SA 3TSMA 3WZ0E 1J5SA 3CC1A 3C5QA 3SUTA 1DTNA 1JAEA 3RMEA 2CIPA 1G7VA 3W1XA 3TYEA 3WBYA 3CK5A 1Q6OA 3H4GA 3LCWA 3T44A 3A47A 3BLOA 2W8KA 4HU3A 2ACUA 1AJ0A 3KEHA 2CXEA 2QCLA 3WLSA 3UWWA 1CGXA 4EXQA 3H2NA 2E8YA 5IHRA 3S46A 4HCDA 1AQHA 1X39A 3PZUA 2G41A 4KFPA 3QXBA 4L1XA 1RBLA 4IMDA 4Z1YA 4ZQOA 3NGFA 5JH2A 5I79A 4KRTA 3G0SA 1TX2A 3NZGA 1A49A 1QK2A 3T5LA 4XKYA 1JYWA 4XTDA 4PMYA 2V6AA 4MTVA 3TP4A 4JIEA 1V6YA 4AY1A 2XN0A 3NM1A 3N9KA 3DCPA 3TCEA 1GOQA 5LXXA 5CZ0A 3LN3A 2BS9A 1OX5A 2ZIDA 1XIFA 3S83A 1YTDA 4CCCA 2G37A 4JTDA 1PJ9A 4C6OA 4WSHA 1B4KA 2O55A 2XISA 1RJRA 4DO4A 2YBUA 3WLRA 2ZADA 2OYKA 4JYFA 3LZ5A 3NQVA 1V3LA 2RDTA 1XC4A 3OLGA 2GVLA 3HPXA 3W84A 2EBNA 2QJJA 3DBPA 2QCNA 1F8MA 4WDUA 3H4WA 2VQTA 3EWXA 5AZ0A 1TJPA 3BZJA 5E09A 3RLGA 2XDFA 1YTKA 1OFQA 4EX4A 1FWBC 3CQ0A 2IKJA 4Q4PA 4Q7NA 2YXGA 4F0HA 2E77A 5BU9A 1E0TA 4CD4A 3QH2A 3G1FA 3QR1A 3QFEA 4Q8EA 3ZR4A 4XZMX 1OBAA 3AMLA 4JUZA 4G2DA 1EC8A 4BEUA 1EJ7L 4NJKA 2QT3A 5D2TA 1RPXA 2W3ZA 3HG3A 1KM6A 3E38A 3TCSA 3TTQA 3CV7A 3B8DA 1H51A 1Q85A 1J93A 3ZFHA 4F66A 2W0UA 3FVMA 4H6KA 1R3RA 1O6IA 1Z32X 3URBA 1KB3A 1KM4A 1B3ZA 3GR7A 3L2LA 4PL2A 2A7PA 1IT8A 4GXWA 4NJGA 1YRRA 4LCSA 3DAQA 4BK9A 3UVIA 3UQNA 1IZCA 3HM7A 2BSLA 3ICJA 4F4YA 1OSEA 3LCLA 3TMQA 4EE9A 5FCZA 3OA5A 1T96A 3R1ZA 2XH7A 2V5DA 1CXIA 2OZ0A 2P1FA 1KR0A 4O1DA 4IJRA 3VD9A 2PZNA 1TPVA 4A3RA 5KFVA 4AXNA 3GVVA 1F3WA 4ZOAA 3VFLA 4BQ4A 2PE4A 2ATSA 3TTOA 3O07A 5JU6A 3GGMA 1BYAA 3S4TA 1P4CA 1XLKA 2V2CA 4FA3A 3R79A 1V0LA 3C2YA 3M0YA 4RR4A 2EPMX 1RVGA 3GV8B 5F4WA 1LDCA 4F4WA 1G1YA 3ZT5A 4YR3A 4JTTA 1K3UA 4LV4A 4E0CA 8TIMA 1XLDA 1FWIC 1EEPA 1NY1A 2WNQA 4E8DA 3AZRA 3LGDA 4Q8TA 2XGZA 3WL0A 5CKSA 3EWWA 4L65A 3AXIA 2WCGA 1PCKA 3TLQA 3OHMB 2BVDA 5LGZA 1W5PA 4C6MA 2JBMA 3LG3A 4UNIA 3UXAA 1JGMA 3PJTA 3BZGA 2HQAA 5DELA 3T5JA 4JL1A 3QY7A 1XBXA 1QNQA 3POHA 1OGSA 2Z1SA 3P5YA 2VGIA 3BOFA 4LJ3A 3AIQA 4LY4A 1OCNA 3CWNA 4ICMA 3A21A 1DIEA 3NL3A 3TROA 3PZVA 1MEWA 3AALA 4W7UA 3EAUA 1GCYA 3AYSA 3K30A 4IICA 4LFYA 4PE8A 2QKFA 4YYCA 1MMFA 1ZP4A 3MO4A 4FX7A 4X9YA 4CVWA 3RJYA 1N55A 5KFOA 3MUXA 1FWJC 1K02A 1NDVA 1KFLA 4DUXA 1IM4A 4GMEA 4IXHA 2OQLA 3GTNA 1W3LA 3RILA 5H2ZA 2G3IA 3RPTA 1RK5A 4LYPA 2C71A 4N9BA 4EKJA 1M68A 2ZA1A 3KL3A 1G67A 2J47A 1O68A 4QS6A 4MB3A 3AOFA 2A0NA 2OWXA 2P76A 4D8AA 4ZXLA 1IWAA 3WLQA 3QLDA 4P5UA 3WH5A 3A4AA 5FI8A 3HF3A 5CJMA 1BGGA 3AIWA 1NDWA 1U5HA 2BP1A 2G5WA 1UUMA 3DERA 1FWFC 1V4YA 5CPOA 3TYBA 2A3HA 2PDQA 3ZZ1A 1WXJA 4ZQMA 3VGHA 3W2UA 3P80A 2J6XA 5DT7A 2VVSA 4UQCA 2VGFA 1V0KA 3WLTA 3UPWA 1V7YA 3PZPA 1E3ZA 4LRTA 2YCJA 2ASJA 1VBGA 2AGKA 4DWSD 5HQEA 4K8EA 4OZOA 2BGNE 3G0UA 1E0XA 4JTGA 4OT7A 5HAOA 2F61A 1T3NA 1AQFA 4BI6A 2FZNA 2Q71A 4Z0JA 2NQLA 3N6HA 3HQ1A 1LTDA 4GACA 2WSYA 5I7GA 1AG1O 4GQGA 4RZBA 1OYBA 3TQKA 3W6MA 3CBWA 5FJPA 3MKCA 3HMJG 3W7KA 5KFLA 1C91A 2HWGA 3GNNA 4BI5A 4XAZA 1H3GA 3T2PA 4NX0A 2AQOA 1IXOA 2J4GA 1TJ1A 1PV8A 1H62A 1BQCA 3MI2A 4ZO7A 5E9AA 3O06A 5A6JA 4XBKA 4NRSA 4E4FA 4TMCA 2DIEA 1ICPA 2WZIA 8CGTA 4GLEA 4ZOBA 3TYCA 3W28A 3WNLA 5EMYA 3H21A 4UTUA 2ZQ0A 1LP6A 3CUJA 1SO3A 4RNNA 2A7RA 1HJUA 3T05A 3HB9A 5L1LA 4EF8A 1GNXA 1R3SA 1GQIA 5DQHA 4LAMA 5CAKA 3GV5B 2ALZA 2QF7A 1ICQA 1ZAHA 5A8QA 3BG9A 1O5XA 3KTCA 1TE6A 4XQ6A 3W1PA 4UB9A 1JZ3A 4UWMA 4P8UA 3C8NA 3S2CA 3PR5B 3TYZA 3APYA 1A5AA 1AUSL 2J6VA 3GUWA 1R7AA 1CENA 1KM3A 1FWNA 1EDTA 1OIFA 2PDMA 3CO8A 4F0LA 4FO4A 3TAOA 3VZXA 3W25A 4JEQA 1KBLA 3UJRA 1FWHC 3AXKA 3TAKA 5FJUA 4ZZ9A 3O15A 2AAAA 1R2RA 2OKTA 4CQDA 1R46A 4JIPA 4PYSA 1EX5A 1FTXA 4IGMA 1SMDA 1KM5A 3OVRA 1XYCA 3M5YA 5CPMA 1FA2A 2J62A 4QFUA 2WNZA 4IP7A 1XQLA 5G1TA 3ARXA 2PD9A 4LGXA 1LCOA 4HJFA 2DSUA 2O7QA 2VC6A 3DFYA 5GJPA 4JFUA 4RPPA 5SWUA 2D0FA 3CZKA 1PIFA 2A7NA 3CQJA 1HNYA 1YLVA 4Z0SA 3T40A 4LCQA 3QOKA 4Q8NA 1RZMA 2YPIA 4GUGA 4GJIA 3PPCA 2DVTA 3NQEA 1BXBA 1PDZA 1KRMA 3H7VA 2YLLA 1NELA 5AC8A 1EH9A 4DJFA 1R86A 2R91A 3O3RA 2WPGA 2IQTA 3STEA 5TAOA 4ASTA 8XIMA 4J9JA 1U33A 3BSMA 3UT0A 2WSPA 1JXLA 1Z41A 1PYFA 3LSCA 4L61A 3GS6A 3S5YA 4JHMA 1N8WA 5D37A 2PDLA 3S6TA 1DEDA 1HKVA 3AS3A 2IXVA 4RDVA 1KTCA 1W1ZA 3IUIA 3ZR5A 1ODZA 4RDZA 1R8LA 1KXQA 2YGYA 2INZA 5C6MA 3LQGA 3OG2A 4WY0F 5B7ZA 4J5NA 2RAGA 4PR4A 4BHYA 2WM1A 1OY0A 2X0YA 1GUVA 3G24A 2WSRA 4JQ4A 5G4EA 1Q45A 3VE7A 4AIOA 3ELFA 2OGYA 4KGJA 4D6GA 1M53A 1S0NA 2EJAA 4TV5A 3ANUA 3U48A 2ZE0A 1E6SM 4BS0A 5FJTA 1IEIA 1YYAA 3I7RA 1XH0A 3MQTA 4TVCA 1QNOA 4KW2A 1QNPA 2W4XA 4EPBC 2H9AB 4QBXA 2Z00A 3E2RA 3QYSA 5HNUA 1XIMA 1S0OA 4GQBA 3A3WA 3W27A 1H7OA 4PRWA 3OLDA 4B3LA 1AD4A 3VNJA 3F4WA 1E72M 3R0KA 3SDOA 5M3WA 1XJBA 4EK7A 4FPSA 4TVDA 1X6UA 1T6MA 1KA9F 3FGCB 4CGTA 1VEPA 5DQIA 5FACA 5DMNA 4Q8PA 1UD6A 5IM51 4RXGA 2IPWA 2PU1A 5HNRA 2ZZ7A 1CI1A 4O15A 5LA2A 4JNMA 3UG3A 4C7FA 4Y9MA 4QG9A 2GZXA 1T94A 3AUOA 1SW3A 1EA9C 7A3HA 1X6LA 4KMQA 3ARVA 2I1OA 5CSRA 2W7PA 1IEQA 1K7FA 1TTIA 4WY0B 4N4QA 2X7WA 3HO8A 5IHSA 2H9AA 3THCA 3SN1A 2IQDA 1WZKA 1EJTC 1NARA 1H4PA 4YCOA 1Q7QA 2PDPA 2CFFA 5AZ1A 2Y7EA 2WVVB 2BVTA 2D24A 3O0FA 1ITXA 1J0KA 1EIXA 5C5YA 3WF1A 3W70A 4NNAA 4CN1A 3FGCA 3B04A 5H6HA 3F4DA 4RUBA 1PCWA 2CLIA 2W91A 2AU0A 1JG9A 2OWWA 4PSRA 3VGEA 1W37A 5I06A 4AMCA 4WQ6A 2DUAA 4KWUA 3QM3A 5A95A 2W9CB 1VQTA 4O4VA 1DXEA 3TVAA 2BASA 2F2KA 5HWNA 4UTJA 3NIYA 4EP8C 2ZE3A 3PBVA 3PWIA 3B0VC 1CBGA 1EO5A 1SZRA 1LWIA 4XBSA 5ABHA 2PC8A 4WY0A 1JXKA 2XINA 3QRHA 3L4TA 1GVEA 1DQXA 5CC5A 3HG4A 3UA3A 2VELA 4BZYA 3CZLA 3NCOA 3QQ0A 1XGZA 1Y5XA 2WVVA 4MAZA 4R33A 5DCBA 1W3TA 4DL5A 2QJHA 1NH6A 5KG5A 4FOUA 3J7HA 4W9TA 6XIMA 1OD8A 3KRBA 7ODCA 2D0GA 5F7UA 1V3MA 4QLJA 2PSNA 1WKYA 2YYUA 2VC7A 3JZEA 3KHJA 1E55A 4P7RA 4S38A 4A8RA 2QGYA 1ZBCA 3DXIA 3T81A 4TQRA 3MPGA 1LQ2A 3G3MA 4YJ5A 2C3ZA 3B9DA 1F9CA 3CH9A 1CNVA 3UNDA 2W9CA 4V15A 3VIHA 1MEHA 5FA5A 4LRSA 3M9NB 3WY1A 4M81A 3BMWA 4FS2A 3RB3A 1IZJA 2DT3A 3NEHA 2ZOXA 4WDWA 4IJBA 5I5RA 3VI2A 3ZSTA 5FAGA 1XKJA 1PKMA 3DKJA 8A3HA 2ZX9A 2VTFA 1I2QA 4LOCA 1J5TA 1TPUA 2QJIA 3AMGA 3P60A 3EOOA 4XSLA 2DY3A 1R87A 2Q8XA 2ZRUA 4GIAA 3AU6A 2J9YA 3ARQA 3U2OA 1FVPA 3B8VA 1W5MA 5GNZA 4UNKA 1SO6A 4YTSA 3URQA 3A22A 7TAAA 1HF6A 3KS5A 3SM0A 1QATA 1YIXA 3CZJA 1MYRA 1G69A 4DLMA 4ZENA 5HUPA 2WMHA 1A3XA 2F6KA 1H7PA 3DHPA 4PTDA 5F2MA 4LYRA 4LAZA 4W8BA 5DRCA 1YDOA 3N3MA 2WC3A 5F2LA 1XLAA 4L56A 1I2RA 2VFHA 3OZYA 5A8OA 4B5UA 2OOGA 3BQ6A 3TU9A 1SSGA 5DLGA 4XVDA 3L21A 3THUA 4JN7A 1E6NA 1OFAA 3PC0A 3QF0A 5KFAA 2CBJA 4YCPA 4RNIA 1BF2A 2HPMA 3ZJ7A 5KT4A 3L7RA 5D03A 2PWVA 3AIBA 4JQ2A 2D3LA 1BWLA 4LC6A 4QISA 3LNPA 4B5TA 3MO7A 4HA0A 1IEWA 4CQCA 2DPIA 1A5BA 3GR8A 3T0DA 3FA5A 1UUQA 2XSAA 4FP1A 1HP5A 3WQOA 3PZNA 3EX3A 3SCVA 1B3OA 3GB6A 4MPKA 5XIMA 2AQWA 3U5UA 2CBUA 5FF2A 2VZSA 4XX6A 3PTMA 1TJ2A 2RDXA 4NZFA 3PB2A 1X96A 5I07A 4QJ4B 3W01A 2E1DA 2FLNA 3K46A 4K6AA 1XIGA 3KRZA 1ZBWA 4JNZA 5FSDC 3NPUA 4LXFA 2R8KA 4JICA 1TUXA 2V5JA 3CTLA 3N2XA 1XH2A 4ED8A 4RKAA 2Z2AA 2VZVA 3GXTA 2QW5A 3NPWA 3SRFA 4GK8A 4GH3A 3CHDA 3GNOA 1GJUA 1HP4A 3Q94A 3FLUA 4GY7A 4X0NA 1UPMB 1X1NA 2OTDA 3GH7A 4FS9A 3V36A 4A6GA 3BOXA 4C6QA 4S3EA 1C8QA 3HJZA 1T99A 1TR1A 4HSNA 4WJ8A 2AAMA 1F76A 2VD9A 1M7PA 4H41A 2PLJA 3BQ2A 3DFTA 1IIHA 3P81A 3OVGA 3H7RA 2YW3A 3H26A 3KE0A 4DF0A 2YFOA 3QMTA 5KFYA 2IKHA 4HN8A 2W6RA 1J18A 3VDHA 4C6IA 2GSJA 3B03A 4PUKA 3RITA 3IJLA 2VZTA 2GUYA 4G8TA 4S2CA 3OHIA 2NQJA 1W1B1 5EFDA 1KD0A 1R0MA 3FV9A 2NUYA 3CUHA 2O9TA 2FIQA 3TDFA 2YA1A 5BNKA 4GIEA 2BVWA 2V38A 3KBJA 1H63A 3UWYA 1Q6DA 2NVAA 1ZZMA 2QHAA 2E6YA 4GY1A 1S5NA 1QPNA 3TN6A 3FEMA 2BGSA 3VNLA 1VENA 2ZRXA 3Q8SB 1DJXA 4EPDC 4MADA 2PDCA 4H00A 3B40A 2PDXA 3C0QA 4WVXA 3SY5A 3ORWA 4F0SA 1VZWA 1EA0A 4M6UA 3HTWA 3QW3A 4AD0A 3SCPA 4D6JA 4K2SA 4O0ZA 1S0MA 3W1LA 3ID7A 4TR9A 4GX8A 1JPIA 3HZ3A 3W6YA 5LA1A 3PPGA 1FWGC 3RO8A 3UWEA 3DFOA 4IUGA 4LWWA 1XRFA 1SJBA 1LQAA 3AC0A 2VX7A 2NT1A 3CZEA 4ZTYA 3SUVA 5ABEA 4ED7A 3M6DA 4PMZA 2D2GA 3GSMA 3PWAA 5H91A 4U7CA 2VEFA 3W7DA 3B9AA 3IUHA 2FFCA 5A3HA 2CLMA 3IPWA 3MCOA 1U83A 4IOTA 1O7AA 3VILA 4I6VA 3VDBA 1QBAA 3A64A 2XGBA 5IBXC 3BL3A 5J5DA 4FOJA 3BCFA 4BQ2A 4YXGA 3WSUA 1G94A 1AMKA 1UCWA 3BV7A 4MNJA 5BCAA 4IQDA 3NXLA 4GFIA 3S2JA 1AJZA 3M5ZA 4J2MA 4Q4MA 4CNOA 1GPFA 3TLLA 4TQTA 4KWSA 4X3ZA 1MI3A 5FEZA 1A0CA 2O92A 2X0SA 3LI0A 2NX1A 2YCKX 4RE4A 3XINA 1RD5A 4WDXA 3NL2A 4H01A 1EGZA 4UTMA 2WMIB 4KWWA 1V51A 3AHTA 1TR9A 2ZX5A 3V0UA 1I0DA 4R5EA 5BW6A 2RGMA 3OLEA 2JEJA 3LHVA 4GC3A 4PUJA 1DL3A 1CGTA 1TMLA 2PZ0A 1W32A 3DYPA 2A79A 2PI6A 1L0PA 2JKPA 2DSZA 3MP5A 1REQB 2ALDA 3CASA 1SPQA 2HBXA 3WLLA 4QDMA 4ZODA 4IIBA 1JF6A 3GKFA 3Q2DA 4HHPA 1TV8A 3LXAA 4UTLA 1RCOB 3AXXA 4ZTXA 4OFCA 1VPQA 1O5RA 4PUMA 4L4PA 2J9ZA 1ONEA 4I90A 1FKXA 1XL9A 2X09A 2GGJA 2DSKA 3TNBA 1R6WA 1QW8A 3W81A 3D6NA 2VZOA 1J6PA 1XV8A 3LU2A 2QAPA 3B9EA 3W83A 4OBTA 1VKFA 4NJJA 1S97A 3USZA 3W2JA 2IKGA 2WMIA 3WENA 2J6TA 1J2WA 4GNVA 3WUGA 2WMKA 4R88A 4A4AA 1KCKA 1QI4A 1IWPA 1VBJA 1WBHA 2FLIA 4JV0A 3VNMA 1KBJA 1EJSC 3NDOA 1NU5A 5TF0A 2C1GA 1XGEA 3IIPA 3CAQA 3PW0A 2E4TA 1REQA 3CTTA 1GVSA 4FAMA 1M7JA 1GYNA 4GOAA 3N2OA 4Y8EA 1ZU8A 5KFHA 1UKPA 4NYYA 3ARUA 1KKRA 4J9RA 3TNOA 3EXSA 2ZWZA 2JE8A 3WJSA 2PTXA 4ED3A 2D73A 3WQCA 4ATDA 3FDGA 1HTIA 3RR1A 4YP3A 2NLYA 1MFVA 1EJRC 2G4FA 1S2CA 3BLDA 3ISIX 3LOTA 1FWCC 4FI4A 3MKKA 4ADSA 3W1TA 5KFNA 2WZEA 2DZWA 4MGGA 3EOLA 4K38A 1KBIA 5C7VA 4LCRA 4O3RA 1ZNNA 1Z6KA 3NYZA 4PH6A 1RP8A 5E0CA 1TWZA 5D9OA 1HJSA 3N25A 5FOOA 5BXPA 3FDKA 3GHTA 1H41A 3KWXA 3AXHA 1EBGA 4PBFA 2OOFA 4YN5A 4BY3A 3QGKC 1A53A 5BXSA 4H4IA 3SR7A 5DF0A 2NSXA 1RQBA 3WBEA 2E6AA 1NM9A 1QASA 5A5WA 5D05A 3M0HA 3B8WA 3CS2A 5MHBA 2DUZA 4G56A 4AX7A 4RK8A 2ZXAA 3II1A 2VL4A 1YPIA 5H8UA 2FZ9A 2WNWA 2Z2UA 3I7SA 2ZFAA 2ANUA 3LTSA 4C7DA 3CPUA 5DCDA 3WJWA 4PRRA 4X61A 1TPB1 1FH9A 1E4MM 2HV5A 2CLFA 4FXFA 1EJVC 4OKDA 5IOBA 4G1KA 1EPVA 4P7NA 4DEFA 2NQZA 4RZRA 3VD7A 4OWGA 2XIOA 5KFPA 3TWBA 3LQLA 1E71M 1WXYA 1BVWA 5F1VA 4KEUA 1XHGA 3LCGA 3LRLA 1BG9A 1IGSA 4FXJA 3EDDA 1MXDA 1T8XA 1UWSA 3M0XA 4FALA 4AC7C 2OH2A 4N42A 2O4MA 3UJFA 3GC5A 5I3FA 3CEUA 3FN9A 1F4HA 3GQYA 2HS8A 5C9RA 4U2ZA 1ELSA 3GG7A 2WBKA 4NILA 4S3GA 3R25A 3UY7A 3W86A 4GX9A 5KG7A 1S5VA 3C56A 4P8VA 4NUWA 2Q09A 4IRDA 1JDFA 3QC0A 1F07A 2OELA 4DNMA 4GO8A 3STGA 5KINA 4H6RA 5K9DA 2YR1A 2QUNA 2XHYA 4GZJA 3U2ZA 1Q66A 3XIMA 1KWKA 3NGDA 5E93A 2CEQA 4HYVA 1EC7A 2PDJA 5D02A 4CQBA 4UTFA 1KV5A 1I6NA 1W1VA 5I3IA 4GI6A 1RJPA 3QKZA 5E6YA 4JTIA 5C2XA 4PFHA 3LXBA 5KETA 1OT1A 5RUBA 5DBTA 3LSBA 2J13A 3PJXA 1RY0A 4DBUA 3WX7A 3N18A 3TJIA 3EKZA 1XFBA 2DZUA 2LLEA 2H3BA 3E2QA 4U3AA 5KZDA 4DUOA 1MDRA 3G8RA 1EO7A 1TV7A 2VEGA 4H7ZA 4XZWA 2YFNA 3A3HA 3DGBA 1KFKA 1CT5A 3EEZA 2WO5A 3NQ8A 5GNXA 4HIBA 2DFAA 5D09A 3WQ8A 3BOLA 5GPRA 2PGFA 3GXMA 3RRAA 1YKWA 1Z89A 4EWND 1PKYA 4QCFA 4YU1A 4Q4KA 5A8PA 4DJEA 3CZGA 3VIIA 3RU8X 1K8CA 1TYGA 2OLAA 2ZYFA 3FNDA 1D7FA 2W9AA 4I9TA 5I2UA 3T0AA 2BXZA 4OOUA 1UMYA 3JS3A 5HINA 3U0HA 1XLJA 5LHFA 2CZ5A 2I56A 2DVUA 3AO0A 3DN5A 3UZWA 3CV1A 4D9PA 4HMNA 4NJHA 1XYAA 4XUGA 2V4QA 4ZFMA 3WD1A 5BZAA 1AQMA 4PMJA 4ED6A 3VCNA 4QNWA 3P5ZA 3FHQA 4P7OA 4UTIA 4XD5A 3S0CA 3TC7A 1AODA 4ZB2A 3O6DA 3AJXA 5TQLA 3W87A 4KEZA 2VX6A 4C7GA 4S3KA 1YXDA 5EMMA 2Y89A 3EMQA 3HG5A 4HK6A 1O1ZA 1BAGA 5E70A 4Y90A 1G4EA 3WEMA 2CYGA 3FEQA 2P9BA 3SFKA 4XG1A 3WLJA 3CLMA 2Z27A 3WG6A 4JX4A 3RX2A 1S5TA 5G4WA 3R2GA 3BJYA 2A3CA 4Q4QA 1YEYA 5C9XA 5BMXA 1M65A 4RL3A 4OJYA 5JBDA 1EQCA 2JKEA 3H7UA 5BWAA 5KG0A 2OX1A 1UKSA 1P1MA 1PUDA 1X6NA 4DL3A 5G1YA 3RDKA 2X0HA 2W66A 3Q8QB 2X8RA 3OYXA 1XLGA 2O9OA 4N4PA 2HK0A 1GKRA 1IR1A 2A3EA 8RUCA 1G0CA 3IV3A 3P2VA 2YDSA 2J74A 2J7HA 2XVGA 3BG5A 4H8NA 4M80A 1BXCA 3CHCA 4GISA 4E3VA 3GH5A 3OOQA 1C8XA 3HQNA 3APTA 4LX4A 4NY2A 5DXYA 3S5SA 3VIKA 1XYLA 5B7YA 3L0GA 4XISA 5CG0A 4L7ZA 2E28A 2B7PA 5DQPA 2R8JA 3W23A 2VHLA 3PUOA 5HANA 2X2YA 2PTDA 2ACRA 3M1ZA 5A6BA 1KR1A 4LQ1A 3VVGA 4JIHA 2XCPA 2W5FA 2HRWA 1IIGA 1UYQA 2CERA 3LRKA 4ES4A 4MMWA 3MBFA 3DFNA 4OBRA 1W8SA 1V6XA 2X1RA 3WQFA 4LUYA 4RV8A 3VD5A 1GYMA 1XD0A 2ZUTA 5I09A 3UCDA 3KZPA 2P5NA 4LU0A 4H7VA 2ONEA 4LBUA 3VUPA 3V4BA 5HMFA 4AB4A 3PFMA 1C92A 1QJWA 3WQWA 4J9NA 3QHNA 5DFAA 3SCNA 1QU4A 4WZHA 2F2HA 2FTPA 2Z24A 5A6LA 5CXPA 1NFPA 3OHBA 1EP2A 4LAUA 3ES8A 4CQ9A 1EBHA 4ENLA 2IA6A 4C1KA 3VUSA 4R34A 5LIKX 1K4HA 1WV2A 3C2OA 1TIWA 3A4WA 6TAAA 4PUWA 3YPIA 3FA3A 1W3HA 4AZCB 1A3WA 2BY0A 3K4WA 3GNRA 2VRJA 4CEXC 3OBKA 2CXGA 3LCFA 1TKKA 1ZQ5A 3UWVA 1NAL1 2WLZA 3PR2A 2CLKA 5C54A 2AL1A 5K9XA 2Y8KA 1PBGA 2EPLX 3H22A 2E67A 3KL5A 4QJ3B 1Y65A 4OE7A 4B90A 4JDYA 4YVXA 1QMLA 2RDIA 1QDSA 1TRIA 1W9PA 4PTWA 2DORA 3SQLA 3LMYA 1F05A 5JUVA 5EYWA 3WL1A 1S10A 2QDGA 1FOBA 1PZ2A 1FWAC 3W02A 3L4XA 4PTVA 4N7QA 3UBPC 3E2SA 3E0FA 4M19A 1OHLA 2HXTA 2FB2A 4LVDA 4JX5A 4MWAD 5LA0A 2OYMA 4JYDA 4NG3A 2O4QA 3C2EA 4AZCA 4B5SA 5I77A 3PJUA 3IACA 4MDOA 2V0TA 4DWDA 1PS9A 1BWKA 1LYXA 1QWGA 1CDGA 2W63A 4MKVA 2Y8VA 3ABOA 4WX2A 1Q6GA 2QYGA 1CW2A 1W3JA 1SGJA 4O16A 1QPKA 4DJFC 4X63A 1VFUA 2HBVA 4Z2HA 2QMJA 2OVLA 4Z08A 3UY8A 3WEOA 4JXCA 3IK2A 1MZRA 1PZ1A 2FDMA 2R1NA 3VCCA 4A3HA 3S5OA 2EPKX 1VYPX 3K5XA 3TQ1A 2FPVA 1M9HA 2VFGA 2ZUNA 4KETA 2GFTA 3FAWA 3AUJA 1MFUA 5KFMA 3HIJA 3IVUA 3LX9A 4B15A 4S3AA 2WZTA 3FCPA 1GVOA 1KFEA 2X40A 3AJ7A 5A8GA 1T41A 3L12A 3M7WA 2Y7FA 4RE0A 3W0KA 5BXRA 4TTGA 3GH4A 1RPKA 3BMVA 1L8PA 2BHZA 3P6LA 4DJDD 2VUYA 1QBBA 1KV8A 3DYOA 2WOQA 2GDUA 4GD0A 2V69A 2PDWA 2CHRA 4Q8VA 4GCAA 2TODA 1TWDA 4AISA 3P3BA 4J9PA 3VK5A 4JTUA 2QDDA 2UWFA 3AIRA 5EY5A 1TSIA 1VF8A 3KOWA 4JN8A 2W67A 1EP3A 1OG6A 1U22A 4QAWA 1XQKA 4IPJA 1Z69A 2FJKA 1UASA 4XAPA 2WCAA 3Q65A 1YNYA 2HVNA 3I6TA 2BHUA 5EB8A 3TIMA 3E0LA 4HHMA 1GKPA 1EUAA 5EKYA 2WHKA 3REQB 3P62A 2FHCA 5D9PA 2HNHA 1NEYA 3IANA 3MZ2A 1FCQA 3MP3A 4IMAA 4GBDA 3W24A 2VOTA 3UXIA 3RAXA 2P0OA 1MZHA 1EJXC 5KZMA 3RPDA 2GPTA 4HCHA 4YMZA 3SUWA 1AH3A 2YBTA 4REQB 3VNKA 3DENA 1HG3A 1WBJA 3M4HA 3K4DA 4YWIA 2XH0A 1QOPA 4PA8A 4X22A 3KOFA 1OGBA 3MTWA 2YL5A 5DLFA 4LPCA 1EXBA 2DGAA 3TXZA 3UR7A 4F40A 3GKAA 5I78A 3IJ7A 4H9TA 4S3BA 1ENUA 5K9CA 3RLHA 4P8XA 4KRUA 3UD6A 3GDBA 4ECVA 3REQA 1TREA 4ZOEA 1PL9A 4N0RA 4HTBA 5ECVA 1J0IA 3I4EA 4DN1A 3DDMA 2D23A 1KGUA 3QYQA 4A22A 2A21A 4YTTA 1QPQA 5JBFA 3W1QA 1J79A 3UYCA 4ML9A 4FNUA 4REQA 4PMOA 1RSCA 2E40A 2V5BA 4S3CA 3RR4A 3GHRA 2ON3A 2J75A 3B8SA 1QW9A 4UCGA 2PWEA 5KITA 4W7VA 3WBXA 3M9MB 3H2EA 4EIVA 3W38A 1M3UA 5ECUA 2GLKA 1UUOA 3I68A 4AWEA 3IIZA 4D6CA 2JK2A 2ZXQA 1ZJAA 4MY8A 3G1YA 1XF0A 3PZTA 1CECA 1EIBA 2Z29A 3QV6A 1V6TA 4Y9AA 1BKHA 3ZXWA 1XH1A 3CAWA 1B9BA 4WKHA 5I24A 4CCEA 2Y61A 3T55A 4Z17A 1S5WA 1EYWA 3BW2A 3H70A 3PPHA 4HNOA 5FL0A 3V3WA 3MUIA 9RUBA 3G6YA 2QCDB 3K2GA 3OGSA 1KRBC 4DZAA 2ZVIA 3CM4A 4UOZA 3SCWA 4GGHA 1UC4A 1P0BA 1UKOA 1V3KA 2UY4A 1M6JA 5AC4A 1OC7A 3PVFA 3WN6A 3HN3A 1DE5A 4UOJA 1UR0A 4CN6A 1AL8A 1KFJA 1KGWA 3W72A 2QR6A 2MUCA 1IR2A 3L0NA 3W85A 4YVPA 4CCZA 3Q37A 5KTLA 4NHVA 2UVVA 3IEBA 4AUBA 1SM9A 3WK0A 1J8VA 1ZJBA 2BTMA 4ECUA 1BQGA 3VX1A 2REQB 4FNSA 3RN6A 1WPCA 1VFMA 2UZ9A 4HPNA 3NZ1A 4J4KA 4LB3A 2Y88A 4L9YA 1THFD 4G7EB 4TVUA 2BNJA 2QCDA 3UZJA 5FEPA 1LWHA 3HQOA 4E3TA 1JCLA 1JULA 4R9XA 3UR8A 3PW2A 1YHTA 1EP1A 1EB3A 3VPLA 4U2YA 3GIYA 4MJMA 4DF1A 4NZJA 2ZZ2A 3GK0A 2J8FA 5LIXX 5DMMA 4ML4A 4M8UA 3WD3A 4A2SA 1RQHA 2BOFX 2GDVA 1L9WA 2ZC8A 1E73M 3T5HA 4M1RA 3NWRA 1IEXA 4AVFA 2G8ZA 4K3ZA 4O3OA 3U6WA 4MFEA 3B4UA 1SZGA 2C2RA 4PMUA 3IJ8A 1S5MA 1BF6A 3EWBX 4Q7BA 2REQA 2WSKA 3WQVA 2QQ6A 2QULA 4K1WA 1R9XA 4HNVA 4MDPA 5HMEA 2V68A 3KW3A 3EXTA 4ICNA 2A6NA 5EPDA 4G7EA 3I4KA 2TAAA 4FF5A 3LM7A 5KFFA 2FVLA 1OB0A 5JIPA 1WB0A 3L4ZA 2A6LA 2Y7GA 3WF2A 5CSUA 2HE8A 2VWTA 4P8WA 1JIHA 1HO4A 3QVQA 3PJWA 1NOWA 2CZEA 3NNTA 1TIMA 2NW0A 1HJVA 1SW0A 2C18A 2A3BA 3TA6A 4HNUA 2QCGA 4LBSA 3OQEA 4ERGA 3LV5A 3WK1A 1FP8A 3T08A 1OM0A 2ISDA 3SY8A 4ZQPA 3W76A 4RUCA 2QAFA 3BLEA 3DFPA 2VDHA 1E6RA 3HJEA 1BVNP 3B9NA 3L4YA 4A35A 3MCNA 5HR7A 2G96A 3QV9A 1US2A 4H8VA 3GDKA 3I3EA 3ZM8A 4CU8A 4AD2A 3OP2A 1K6AA 5LIUX 4Q4OA 5DMLA 1VR6A 2C8NA 3AS1A 1DP0A 2GGEA 4IMEA 1JQXA 1W1TA 2F8QA 3MI6A 1D7KA 4O10A 2NVCA 3WLMA 2C2DA 1H60A 3UCQA 1QHZA 3XISA 1QI2A 2B81A 2XM2A 4EACA 4GZ7A 3LMZA 1FXPA 1PWMA 4UTWA 2QUTA 1YNQA 4ZA0A 3TK7A 2XFRA 1CLVA 4AIUA 3GIKA 4JZ5A 1KRCC 4DWSB 1I0BA 4IRCA 3ZLHA 4U31A 3DC8A 4UQBA 3CV6A 3QGVA 1H1YA 3C8FA 3HPZA 3NQ2A 3CHFA 2W62A 1W5OA 1L6WA 3OTRA 4GNKB 4JFSA 2HISA 4MG4A 3WMCA 3W7JA 2E1WA 2DZPA 3LPPA 4UBPC 5BRQA 5BROA 1CIUA 2QCMA 3IWPA 3ARZA 3PS7A 5AFDA 4ZVJA 3UXDA 3R11A 3G6VA 3BGJA 3RAOA 5IDIA 1UZ1A 4ECYA 1Q6LA 3GTIA 4W4QA 5G4HC 3BV4A 3VKBA 5C2CA 2VEKA 3UP8A 3WDIA 4Q3MA 2VKZG 4LVFA 2TMDA 4Q6XA 5BMWA 3V6HA 3THDA 2I9UA 4FOKA 1HKKA 1KRAC 1N2VA 3CUGA 2DQXA 4CKQA 4DWSA 2J8TA 3BJSA 4B3KA 5LZLA 3TMLA 4LH8A 2EF9A 3E9AA 4K39A 2HK1A 3OODA 2IMWP 1BRLB 1OWQA 1OFPA 3OU8A 4C6BA 4QQUA 1DHPA 3COTA 4R85A 3U7BA 2ASLA 3W07A 1JPKA 2XGQA 2YA0A 3M9YA 3AQUA 3BAIA 1IXPA 3E02A 4MVAA 3SURA 4LVBA 2DT1A 3GIMA 3NPVA 3NUKA 2HXUA 1PDYA 2DIJA 3UZ5A 3G3DA 4MNMA 4IIHA 4RJEA 2VJXA 3ZJ6A 4LSBA 1DVJA 1OZMA 3MR5A 2CITA 3BCDA 1E15A 4GIYA 4B9YA 2OMAA 3VIOA 5EMUA 2DZSA 2OSWA 5EWEA 2J7BA 2DJLA 3NO5A 1LG2A 1JCJA 3TOPA 4K8HA 4F3HA 2ZUMA 2CWXA 2KAUC 2E5BA 3PBWA 1ZAJA 2GJNA 4AMAA 3GW0A 1BXNA 3IJDA 2VCBA 1QW7A 4CD5A 3G0XA 1K1DA 2OQYA 3C61A 4H3DA 2GJPA 3WJYA 1NQKA 3N2CA 4QITA 2PFHA 4H19A 3BCJA 1SYTA 3RGTA 1BRLA 4HYWA 4IIEA 1NP2A 4JPGA 3JU2A 1FWEC 5BOEA 4Z1CA 4A8LA 3GG1A 3W2LA 2J6SA 5DBUA 3UWUA 4C5YA 5M17A 4Z1AA 3KRUA 3AYTA 1EQPA 4DX3A 1E1CB 1MW1A 3EOSA 3Q67A 5CSSA 1NOFA 4W5ZA 5AKQA 5FEWA 1JZ2A 3N9RA 4JKMA 4DUWA 4C1LA 1AMYA 1X1ZA 4BI7A 3OGVA 1JCYA 2DW7A 3VM7A 2HEJA 3STFA 3PP7A 4I9MA 3T8QA 5KFWA 3DGRA 1QAPA 1YDNA 1OC5A 2G4JA 2XZ7A 2R82A 2EQDA 3FXYA 2ASHA 3RNDA 2AQ4A 5DANA 3R0DA 1SFSA 1XBVA 1XICA 2OT0A 3CIWA 2NVDA 3SUUA 3TQVA 3QGAC 4HKPA 1WAUA 3MR2A 4QDPA 4GABA 2XWEA 4HOXA 2C2EA 1V77A 3K4AA 4PUUA 3SJNA 4LALA 3LXCA 3W1NA 3H24A 4IUOA 1ADOA 4Q8MA 4J9KA 2YCEA 1RALA 4ECZA 3QHMA 1ONWA 3DG3A 3VOCA 3AROA 5HJLA 4QWBA 1GGOA 4OUEA 5D9MA 3VOHA 2ZUVA 4B5WA 2QPUA 3CUXA 4C6PA 7TIMA 3PHAA 4CD6A 4J9LA 1E1CA 4Q33A 3UZYA 3R8HA 4FLOA 3AIUA 3OYZA 1E3XA 1DXFA 5CC7A 1H50A 3ITLA 5DRIA 4XD6A 3BQ5A 3U5YA 1U1HA 4MB5A 4C6JA 4UOQA 2EAWA 3GTHA 1VFHA 3IUDA 2GWNA 4DYEA 4TMBA 2W61A 1OFOA 3O6CA 3KDNA 1MDLA 2W8LA 1R9YA 1EZWA 3NGJA 3HBLA 3M64A 4FXSA 5HMSA 3S5ZA 3VNYA 2ZZ5A 5CPLA 1N56A 3O6AA 1K7EA 4D8ZA 4CUCA 3LD5A 2V63A 3OZMA 4YTRA 5T8GA 5F2GA 1QOXA 4LT9A 3A5FA 2E68A 3H8AA 5E0FA 3WH7A 3AZTA 4UTTA 4QG6A 5DT5A 4I9AA 3R7MA 1UWQA 4OU1A 1S2VA 3GYCA 3WH8A 2E3ZA 1OIMA 1TA3B 2CLLA 5D9NA 3M5VA 2WM0A 1MO0A 2WMFA 4AH7A 4LF1A 5FF3A 4DEZA 3BSHA 4XAGA 1R3VA 4YVVA 2VR4A 5JH1A 2QUVA 1Q6QA 3RCYA 4PMNA 4S3JA 3WQGA 1GVRA 3A24A 3W7IA 1B31A 2PODA 3A13A 2CLHA 1ZL1A 5E0KA 1X8FA 4JD4A 1DWFM 5FF4A 4RUAA 1DIOA 2R24A 4IFKB 4JIRA 1VCFA 3VGGA 2QCCA 3M46A 3A9BA 5CBIA 3IN5A 3MZNA 4PUDA 1JNEA 2PD5A 4Q8OA 1UD3A 4MLRA 2WHMA 3WDJA 2J8GA 3HFTA 3QOMA 3E5BA 4Z42C 4V2XA 1TA3A 4D6EA 4WSKA 3RU6A 2UY5A 2WMGA 4KERA 1ZETA 1PE1A 3B0XA 2C0HA 2FFIA 5EBAA 2DUXA 1UZDA 4HA4A 4KFOA 4DXXA 3KVJA 2H8ZA 2VM8A 2X41A 4LS2A 3JRKA 1CXFA 4O1CA 2HDJA 4J3SA 2GL5A 1W2VA 5H8PA 2GJXB 1OGGA 1UWIA 2OKOA 4IFKA 2HTMA 3MSDA 1XD1A 3L67A 3M0IA 1R2SA 1AH4A 2WHLA 3BAXA 3OZOA 1FDYA 4J3UA 2PGEA 3KTXA 4AZBA 3M41A 3QN3A 4K8GA 3TYUA 5KEZA 3S9YA 4U10A 3JR2A 3PM6A 4G3IA 2EXOA 2OR2A 4DJEC 2IS7A 2D0HA 1EC9A 4F0MA 4GXPA 1BEUA 3CXOA 4UIOA 3ABQA 3G1HA 3DECA 2O56A 1XP3A 1ZPTA 3LCHA 4O4WA 4R7JA 4GGBA 4GUHA 1SZNA 2E0PA 1X38A 3UXKA 3ZLFA 3G1RA 3VDCA 2GK1B 5T26A 4QWAA 2VZUA 3CLWA 1JZ8A 3R4IA 2ZX7A 3NQDA 4W88A 3L68A 3V35A 3IV8A 1KWGA 2BFGA 1FWWA 2GJXA 4Y9OA 1EWEA 3B0PA 3H54A 3ABRA 1DJNA 1A80A 1OD0A 3KBNA 4E2DA 2POZA 3NQCA 4J35A 5KZEA 4RV3A 2ZRYA 3NQBA 1I60A 3N1AA 3O63A 3SCTA 1FH8A 3GDRA 2Y2WA 3KBWA 1TPEA 2YYTA 1GOKA 4U33A 3M0LA 3STPA 4TTUA 1F6KA 1JD7A 3O1NA 3CZ8A 2XSBA 2BDQA 1SR0A 2OPJA 3MWCA 4LC8A 1XPYA 2GK1A 1X7FA 5EWFA 3F1QA 1JUBA 4DZIA 1TPWA 1K1QA 2Y5EA 4O19A 1YADA 4HA3A 4XZIA 2FGZA 1EF2A 2UY3A 2EJ1A 1C90A 5HPOA 3QTGA 1PHQA 2WLYA 3CT7A 2V9WA 5C9ZA 5C55A 1AZ1A 4US6A 2V2HA 3APGA 1DE6A 1J9YA 4DELA 1GEQA 3VGFA 3W75A 5C2GA 3G18A 2BY3A 4F4RA 1EJUC 1W0MA 4DLFA 5C9UA 3FJ4A 1ADDA 1Y5VA 2J7DA 5A94A 2GSHA 3PBYA 3C52A 1R7OA 5A2AA 1JCTA 3MDUA 3BTNA 4ONVA 2UVWA 3CAVA 4I9JA 2VENA 3P67A 2JEQA 5TIMA 1LUCB 3FYYA 4MLJA 3KLLA 4E2BA 3WMBA 4Q8UA 1FFQA 4WHBA 3M9OB 4JQ1A 1I2NA 4KWOA 3LRMA 1BWVA 1TFVA 1L6SA 2XGIA 1POJA 2G95A 5CBBA 1DOSA 1I9CB 4L9XA 4QCEA 4LV9A 4P7QA 1W9XA 3KAOA 4MKNA 1JAKA 1E0UA 1JIBA 1JDCA 4AY8A 3ZVIA 1FUYA 1TVPA 4JV1A 3S2NA 5LXEA 4JFTA 3GDTA 4RDYA 4G1NA 4IMFA 3PANA 1H7RA 2BZNA 5HQLA 2JEGA 3JZUA 1JGIA 4AZHA 1G6CA 3M0JA 4ED1A 4INFA 1JZ6A 5DG7A 2E9LA 4W89A 1IGWA 4YYFA 1MVYA 3SCRA 2FH8A 1LUCA 3N2BA 4D71A 3GV7B 4KH2A 3M0KA 3F4NA 4NT0A 5CLTA 1QNRA 3MY9A 4I8DA 4RNJA 3H53A 3BLPX 1HUVA 4R3UA 4UTHA 2C91A 1KO0A 3NPXA 3PG8A 1C9DA 1RLCL 1UROA 2YL6A 4HK7A 4BF9A 5AVNA 3WDPP 3CQIA 3RMJA 3R0UA 3PUGA 4A2RA 4QDWA 4KRZA 3B0UX 4LAKA 1GOIA 1NJJA 2CETA 3BAYA 3MHFA 1VPXA 4RNHA 4M3PA 3CWHA 4YS1A 3NQ7A 3BQ1A 4HU4A 5G1MA 2GOUA 4AC1X 3G1XA 5KMYA 3WF0A 2CKRA 3NZRA 1F74A 2FVKA 5KG6A 1QPRA 5AC5A 2VFEA 3NZPA 2JGQA 2V82A 3EA3A 1J0JA 1JYNA 3CPRA 3LLDA 4ROQA 3USBA 2INFA 1XLIA 3S6OA 2ALRA 1D3HA 4CD8A 4K7YA 5DG9A 4PCSA 3Q4DA 2OEKA 3G22A 1KFCA 4O14A 2VEIA 3SO7A 3U9IA 3IIVA 2BR0A 4H1ZA 4U3CA 1BHGA 4XBJA 3OPSA 1EWDA 1RHCA 5CGTA 1TPFA 4Q22A 4JY9A 4RNOA 1JVNA 2WJDA 1DWHM 3ME3A 4MJ2A 3B3DA 2JEFA 1FHUA 3D3AA 4S23A 1ZRQA 3UR2A 1JJKA 4PMDA 2BQRA 2R8WA 3O2LA 1QVBA 3EZ4A 4JOMA 1G01A 1LRNA 1FFRA 1US3A 5A8MA 1XI3A 4ATWA 4F2TA 1W1YA 1J10A 1RXOB 4NZ1A 4GINA 1NVMA 3VMPA 3W1RA 2OZTA 1U5VA 3CMFA 2B7OA 4WXYA 1Q13A 3ZWTA 3ECQA 3BW3A 3M16A 1UP3A 3GTXA 2UVRA 1EL3A 3EWZA 4J2PA 4DL7A 3ES7A 4HOZA 2PWGA 1B2YA 3F2CA 2FVMA 4HZ6A 1T7LA 5BOFA 1W2PA 2QJMA 4Y9NA 4OOZA 1ZY9A 1MQRA 4KCTA 4HZMA 3IGSA 5LHEA 1GEHA 3VMOA 5AECA 3N12A 2BOGX 3UERA 3RM8A 4FNTA 2VXNA 3ZSSA 1T40A 2YX0A 3NOEA 1W56A 3WO8A 2SFPA 4GRSA 3VNZA 1JDDA 5KG3A 4UQAA 3U2EA 2JKAA 1QR7A 3K8KA 3L9CA 1TPH1 1JPDX 1RV8A 1ECQA 3DG7A 1XC6A 1FWSA 4R27A 2G97A 1GONA 4D72A 1E70M 2VC5A 2ZCGA 2AGPA 3W53A 3W29A 1SFTA 4GUFA 3IGXA 3OEXA 3S9ZA 1FCUA 1VFLA 3O9NA 3FKRA 5J5RA 2Q8ZA 1VFOA 4ERIA 3S9IA 4F2BA 1BLIA 3N4EA 4FF7A 1YDYA 2WQPA 4EWJA 1F6YA 4ZSUA 4A3YA 3ZVHB 2XUCA 1DWGM 4QG8A 1BTCA 4ED0A 3VKDA 3KS6A 3GU9A 2R8GA 3W1UA 3CUIA 1XIJA 4H9YA 1DJYA 1TX0A 1AZ2A 1JRCA 1TG7A 1XSKA 3GHSA 1Z8AA 3BC9A 1UOKA 3IJQA 3RCMA 3TJ4A 3WQ6A 3U4FA 4JTAA 3BAWA 3DESA 3GRIA 1R2TA 2QNEA 4MJ4A 4ZO6A 3I6RA 1XLHA 3E0IA 2QVHA 4H8UA 3URNA 3NJ3A 3FJNA 2EKGA 1C9WA 2HS6A 3RBEA 1XSJA 4HOWA 5ABFB 3VINA 2W9BB 2JEIA 4GXMA 3GXPA 5CQ1A 1TMHA 4GVHA 2RKXA 2P53A 4UFLA 5AN7A 2PRMA 5T9CE 4Z2KA 4WK9A 2CPUA 3MA8A 3KUMA 3P14A 2Y63A 4GC6A 2BX7A 4ZO8A 1PWLA 2XC9A 4B91A 1CGUA 1ICSA 1XYFA 3P61A 3NSMA 2QEZA 4H7CA 3WNNA 3BK0A 3NDZA 1QO2A 3ZVHA 3GC2A 1P0EA 3WYZA 1A50A 3RB4A 1BPLB 4XVEA 1OX6A 1XBZA 1KTNA 1GVFA 2B4GA 3SQSA 3CAKA 1VCGA 4UFJA 5LGXA 2BQ3A 1JDEA 3GC4A 2G3MA 3RXZA 2PEVA 3R94A 3B4YA 3W1AA 4RLIA 4B2DA 2XFFA 1S9FA 2W27A 1QHPA 4GKTA 1QCWA 5ABFA 2W9BA 1JYVA 3EWCA 3EOUA 1ESWA 3W37A 4FSAA 5A6MA 1WQ5A 2ISSA 4EXBA 3GG0A 4XIAA 3VO0A 3KOXA 4I6KA 1E4IA 1H1NA 3SECA 2EO7A 4L5ZA 6PTDA 3P82A 1WOBA 3TA9A 1KTBA 3TN3A 3WCZA 3CPGA 4JY8A 3QEZA 2D2JA 1VRDA 1PEZA 1OT2A 3C0SA 1H11A 5A2CA 2XVNA 2JIWA 4IT1A 2P8CA 2GSEA 4U4MA 3P8JA 4W8LA 1VD6A 2X05A 1OCQA 3W88A 3KCLA 1A5CA 3RM9A 2YKKA 3PW4A 5AHFA 4HZ7A 1P43A 5KT3A 1SUXA 1BVZA 3SIZA 3QMRA 2KZHA 1H5VA 1K8XA 4CNUA 4BF7A 1DTUA 4F50A 2VMFA 1LORA 5DX7A 3TKFA 1WKEA 1CGYA 3F4CA 4GH1A 3MVIA 4G6CA 3BANA 3T1GA 2WKJA 2EPOA 1KLYA 1W5QA 1KC7A 3IGUA 2WZHA 4UMAA 2BB0A 2ZZ3A 2VEMA 3L2IA 4GE8A 1L2UA 1HN1A 2I5IA 1FRBA 4X2PA 3EA1A 3ITYA 3IJIA 3ERPA 3QQ1A 2HJPA 1V3JA 3MKVA 3L5LA 3UW6A 4DPQA 4TX9A 1KKOA 3B05A 3EPOA 2ZUSA 2V4RA 4TX8A 1TUFA 2Z26A 4N6FA 3HG2A 2Y70A 3ZO9A 3UFYA 1SMAA 5L9XA 3GUGA 2I9EA 3NYDA 2D69A 4PMQA 4QLLA 3RO6A 1CGWA 4E5TA 2X1UA 3NZQA 2X1SA 1A0DA 4C60A 2BLEA 5I3GA 4N9CA 3N73A 3AWNA 2OCZA 1O4UA 2F38A 4UR9A 3TWAA 3E74A 3L5MA 2ODOA 2FZ8A 3M0VA 3BLFA 4QQ3A 3CT2A 1OC6A 1K4GA 4YTQA 1O94A 2WK2A 3TTSA 2HNEA 1KXVA 5I00A 4IL0A 4MY1A 5F9NA 1WOAA 3HPAA 2CZVA 1TWIA 2PBOA 1A5SA 1JCMP 1WKFA 4MZ1A 1LROA 3AI0A 2NQHA 2XIIA 3C3NA 5CG7A 5XINA 5TBOA 4GFSA 3V18A 1IT7A 3T9PA 4KQNA 2BBFA 1L6FA 1QOQA 1D8WA 4W7WA 3VU2A 5BRPA 1BD0A 1QRQA 6CGTA 3FS2A 2X2GA 4JIQA 1PSCA 1PPIA 1YQ2A 5HATA 2ZWYA 4GY0A 1CEOA 3C2VA 3U2CA 3W73A 2XVKA 4C1NB 1LG1A 3GXFA 3MVTA 3PUEA 3VC5A 3F5JA 3W6LA 4DL2A 3SCUA 4W8AA 4ORIA 4UCFA 4Y96A 4ORMA 5F9LA 4L9ZA 2OB3A 1MWOA 1SJCA 1UZHA 4DAFA 1DPMA 4F79A 5DGAA 4A8NA 3SCSA 3A23A 2PBGA 2P3ZA 4UFIA 4H2CA 2C1IA 1XBYA 3HA1A 4N9EA 1EF3A 4IJCA 1V08A 1V03A 2E09A 3S1UA 4IIDA 1DJZA 1PHWA 5M1TA 1UR4A 2ZRVA 1OFBA 1KXHA 1JCNA 3DI1A 2VURA 4M51A 1QO5A 4H04A 3WUFA 1JF5A 4H9ZA 1YW1A 4K37A 3NEVA 4KIEA 3CH0A 4MY9A 3H6OA 4QSHA 4R53A 2V9DA 1XIIA 3K1GA 3EDEA 3FXGA 1RCXB 2B7NA 5ABGA 4C1NA 3EOEA 2YDAA 1E9ZB 4AFYA 4UTWC 1MUCA 4MF4A 2ASDA 1XS2A 2NV1A 1ZAIA 1I2PA 3IVTA 5TD4A 1W1IE 1Q8JA 3VC6A 2W9MA 4C6EA 1EFZA 1MEIA 3DI0A 4EAMA 2V5CA 4AZ6A 1MW2A 2OXNA 2O9RA 3E96A 4YTUA 1G7UA 4NP7A 2R9RA 1YTEA 1JXJA 3WD0A 1OADA 1TRDA 4G5DA 4CCDA 5HJXA 1GZGA 2E8ZA 2GVYA 4QLKA 1P0DA 1DJWA 2CW6A 7CGTA 1PVNA 2GQ8A 1LBLA 4QEEA 3TQ0A 3WFZA 3K1DA 2VQUA 3UVAA 3KX6A 3SB0A 4N2YA 2HROA 2J7GA 2X16A 5KFRA 2BMBA 2WWDA 1H2JA 3B9OA 3C6CA 1KLZA 1GZJA 2WMJA 3IJ6A 2I14A 1E0VA 4DWSC 3GLCA 5IRPA 3MYPA 1GHSA 1WDSA 4FMVA 2H3DA 4UMCA 2PS2A 3WKZA 1HJXA 3RF9A 1E9IA 5K3VA 3S5NA 2Y8UA 1O66A 2XH4A 2OZ8A 2PMQA 1HGYA 1V93A 4C6FA 1QUMA 4AD4A 4E8CA 2XCAA 2XSXA 1LRTA 3ANVA 4HD5A 3H4DA 3O6YX 1P6BA 1BYDA 1JZ4A 4GVIA 2ACQA 3PZ9A 3N2MA 1NTHA 4IH3A 2C16A 4JHOA 4AY7A 3SJ3A 5KSWA 1ZLPA 1H7XA 2R94A 4O0QA 3WMSA 3DIPA 3FJLA 1Q7MA 3FHAA 3W2KA 3ITTA 4E2OA 3T78A 3SI8A 2WWCA 3ZT7A 3CYJA 4J28A 2PTYA 1GKQA 5KFXA 3TUUA 3LGEA 2YCIX 4JGDA 1B3XA 2RHGA 4GYJA 3BH4A 2VGGA 4AVNA 2Y0FA 5KG4A 1T5AA 3CV2A 3MJMA 3Q45A 1P0NA 5EMKA 7ENLA 4RX0A 1JL8A 4MWAB 1H7NA 4BKNA 4WOQA 4KT2A 3OSPA 1ONRA 4FIRA 1PXGA 3V16A 1ECEA 1F5ZA 4XSMA 2CHOA 5EMJA 1S1RA 1ITQA 3MFIA 4GYPA 1ISYA 2VT0A 4NX5A 4J40A 4UR7A 2JGYA 1S2WA 3VIPA 3N04A 5L9FA 2VGBA 2VC9A 3DH7A 2DZBA 2RJGA 3PAOA 4NJIA 5ENLA 3AHZA 2FGLA 4KWVA 5KFSA 3AWOA 2I5QA 2E9MA 5ABTA 1UD5A 4GG9A 3D46A 1UIPA 3LTPA 1GOOA 1Y5WA 4DPPA 1PTAA 3T5KA 1HL9A 2YZ5A 2VA2A 5HR6A 3DYMA 3VE9A 2RDJA 2B7QA 2ZTJA 2R1LA 3ABXA 2WHJA 2NLIA 2FZMA 4WR3A 3MFHA 5DY3A 4DM1A 3G1SA 3SZ8A 2PURA 3LHWA 1Z7AA 3SW6A 5CGMA 4MWAA 3VGBA 5AYYA 3TR2A 1A3HA 3S1VA 1KXTA