1J6PA

Crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
407
structure length
407
Chain Sequence
HHMIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (TM0936) from Thermotoga maritima at 1.9 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords METAL-DEPENDENT HYDROLASE OF CYTOSINEDEMANIASE/CHLOROHYDROLA
total genus 132
structure length 407
sequence length 407
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1j6pA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6pA02
3CJPA 4R7WA 4L6DA 3D6NA 3GTHA 1PTAA 2OQLA 4XAFA 2E1WA 1E9ZB 1O12A 4BJHA 3GTIA 4HK5A 2PGRA 1RAKA 4WGXA 4GY1A 4XAGA 3BE7A 2ICSA 1PO9A 3E74A 2E25A 4H9ZA 4XD6A 4EPBC 3EWDA 3RYSA 4C6IA 1FWDC 1FWFC 2YB4A 4IGNA 3OQEA 4QRNA 3OJGA 4GYFA 1YIXA 2W9MA 3JZEA 4KQNA 3S2NA 2WM1A 4LALA 3RCMA 4IQJA 4KEUA 2VHLA 4ZSUA 3CAKA 2Q01A 4XAYA 4PE8A 2PUZA 4C6QA 1PB0A 4LAMA 3E0FA 3FDGA 1BF6A 4C6PA 2OGJA 4DZHA 4GBDA 1KRMA 2IMRA 3RN6A 4WHBA 4HK6A 2GWNA 5A6TC 3GRIA 4C6NA 2F6KA 3AUOA 3IGHX 4XD4A 2Q09A 5FSDC 1DPMA 2FFIA 2D2JA 1EZ2A 4GXWA 2Z24A 3A3XA 2HNHA 4B92A 4DO7A 1A5KC 1NDVA 3MSRA 4LCRA 4LH8A 3TNBA 1ZZMA 1ONWA 4GZ7A 3A3WA 4C6DA 3F2DA 4G7EA 4F0SA 2Z27A 4DIAA 4NG3A 4LAKA 2VC5A 1ONXA 4NI8A 4MUPA 3T81A 3S2MA 3SO7A 3GU9A 2DVTA 2QS8A 1FWIC 4F0LA 4QS5A 4IFKA 4H9TA 3PAOA 1VFLA 3MVIA 3OU8A 1ITQA 1EF2A 1FWAC 2WJFA 4RDZA 2BGNE 3IV8A 2GSEA 1M68A 2ZC1A 4DYKA 3G77A 4QTGA 1RK5A 3PBMA 2PLMA 2OODA 3UBPC 4JOMA 4H9XA 1J6OA 2ADAA 1E9YB 1EJXC 4KEZA 3LSBA 4C5YA 4OFCA 2PAJA 4I6VA 4AQLA 4LAOA 3QGKC 4HK7A 2Z00A 4XD5A 4GC3A 2Z2BA 1ITUA 1POKA 4RDWA 3GU2A 3A4JA 2GWGA 4ZSTA 2Y1HA 3E38A 3IRSA 4IFRA 3LNPA 4RDVA 4INFA 1HZYA 1YRRA 1EYWA 2Z28A 1JGMA 2EG7A 2HBVA 2XIOA 4V1XA 1YNYA 2O4QA 4LANA 1RJRA 3LY0A 3LGDA 1IE7C 3B0XA 3LS9A 1I0BA 2VUNA 1XRFA 1XRTA 3FEQA 3HTWA 1FWHC 1NDYA 1NDWA 3GTFA 4RE0A 4IF2A 4LCSA 2YXOA 5FSEC 3MJMA 1A5LC 2Z4GA 4IFKB 3TN3A 1J79A 1R9ZA 1R9YA 3GGMA 3N2CA 1FKWA 2Z2AA 3ITCA 4P5UA 5HMEA 2UBPC 4C6BA 3ORWA 3T1GA 1P6CA 4DLMA 4G7EB 4GOAA 2R1LA 3HM7A 4LEFA 1XWYA 1YBQB 1WXYA 1RJPA 1YBQA 2WJDA 4C6KA 5LXXA 2GOKA 4M51A 3GUWA 1EJUC 4RZBA 2P9BA 1FKXA 3E2VA 3LA4A 3UPMA 4B91A 2QPXA 4KIRA 3AU6A 4TQTA 4QS6A 2DVXA 1FWGC 1P1MA 3QY7A 4CNSA 3ICJA 1UIOA 3URAA 1I0DA 1EJTC 3MPGA 1NDZA 1NFGA 1KRCC 1GKPA 2I9UA 4J35A 4GY0A 4H9YA 2FVMA 4KEVA 1P6BA 1M7JA 3HPAA 2BB0A 2Z26A 4HA0A 4C65A 5AKQA 5G4HC 2DVUA 3GG7A 2D2GA 4GY7A 1UBPC 1ADDA 2I5GA 4C6LA 1M65A 2G3FA 3IARA 3K4WA 1QXLA 3S4TA 1GKQA 3O7UA 4R85A 3ID7A 3GIPA 3MDWA 1K6WA 3KM8A 4KESA 4XD3A 1V77A 2P53A 3OODA 4CQBA 2CZVA 4CQDA 3TN5A 2Z29A 4DI8A 3E0LA 4J2MA 1XGEA 4C5ZA 1PSCA 3MVTA 3R0DA 3OVGA 2Z25A 1K1DA 1YMYA 4IG2A 4H00A 4GX9A 2AMXA 4DI9A 3UR2A 2YB1A 3EGJA 2PGFA 4LCQA 4C6JA 4DNMA 3T8LA 2R1MA 4EPEC 3GTXA 1UIPA 2QVNA 4WVXA 3URQA 1V7AA 3IPWA 3OOQA 1RK6A 4J5NA 2D2HA 2FTWA 4QSFA 1R9XA 4QROA 3K5XA 1GKRA 3DC8A 2P50A 1FWJC 4PCPA 3URBA 1FWBC 2UZ9A 4RDYA 1A4LA 2OB3A 3IJ6A 4H9MA 4CNUA 2Z7GA 2QT3A 4CQCA 3O0FA 2YZ5A 4BKNA 4H9VA 2OOFA 4B90A 2EG6A 3UR5A 4C60A 2VR2A 4L9XA 4C6CA 4IH3A 4GX8A 2KAUC 4ICMA 4PBEA 4C6FA 3F2BA 1FWEC 3K2GA 3NEHA 1V79A 5E5CA 3PANA 3URNA 1RJQA 1W1IE 2HPMA 5HMDA 2GZXA 1J6PA 3QY8A 2R1KA 1QW7A 3F4DA 4G2DA 3F4CA 2FVKA 1KCXA 2HPIA 4B3ZA 1UMLA 1A5NC 4UBPC 3WMLA 4GK8A 3AU2A 3TN4A 5HMFA 4H01A 2FTYA 4EPKA 4Z42C 3UF9A 3F2CA 1EJWC 1S3TC 4CEUC 3CS2A 4IG2B 1V4YA 1FWCC 3WYZA 4UB9A 4IFOA 3GIQA 3E3HA 1RA5A 4C6MA 4C6OA 4EP8C 2AQOA 1K70A 2ANUA 4ERIA 1A4MA 1O5RA 3QGAC 2HQAA 3B0YA 3GU1A 2RAGA 1J5SA 3SFWA 3NURA 4XAZA 1RA0A 4E3TA 3PNZA 4AC7C 2A3LA 3LU2A 4H9UA 4KF1A 4ERGA 2AQVA 4KETA 3RHGA 2VM8A 3S2LA 1A5MC 4ERAA 3MDUA 3QY6A 3WZ0E 3B40A 3FDKA 1KRBC 4I6KA 1POJA 3S2JA 1KRAC 3MTWA 3PNUA 1WXZA 1EJRC 4EPDC 3EWCA 3V7PA 2R1PA 4C6EA 4HJWA 4BY3A 1EJVC 3C86A 4PBFA 2HBXA 4D8LA 1V51A 5CH9A 4F0RA 4CNTA 2EG8A 3MKVA 4DLFA 4DZIA 3TN6A 4V1YA 4KERA 3LSCA 3DCPA 3ISIX 4LFYA 2VC7A 3NQBA 4PCNA 3IACA 1A5OC 1EJSC 2O4MA 4IGMA 4YIWA 2WJEA 3LGGA 3DUGA 2R1NA 4CEXC 4R88A 4NP7A
chains in the Genus database with same CATH superfamily
2WMKA 1SR9A 1B31A 4XAFA 2E1WA 4ATLA 1KFLA 3E5PA 2J9XA 3AIRA 3KX6A 4LV4A 4MSSA 3FVDA 2P1FA 4YNGA 3IGSA 3EMCA 1QK2A 3EWDA 3GHUA 5KZMA 4AWTA 1VCGA 2TMDA 4UC5A 2YB4A 4WOQA 2QLYA 1W3JA 4HGXA 3PG9A 1DQXA 2CWNA 3BZGA 5KFTA 3FSUA 4ZOAA 4TX9A 4MHBA 3B0VC 2CBVA 3IIVA 1PB0A 3AAMA 3TYZA 3BJYA 3UPWA 1BG9A 3MQTA 4L6OA 4GBDA 1SW7A 4MJMA 3FEMA 3NZGA 1U33A 1GVEA 5D03A 3NPVA 3T2OA 1KW1A 4K2SA 3N4AA 2P10A 4I9TA 4IQLA 4WXZA 2Z24A 1F3XA 3B8UA 5M2FX 2JEGA 4B9ZA 4GA8A 1E1FA 2Z27A 5FCZA 4DIAA 1E1EA 4JFUA 1TCMA 3L4XA 4OGZA 1MI3A 2CFFA 1BYCA 3BL3A 1EOMA 4KRZA 1RY0A 1XISA 3WBAA 1YTEA 2MNRA 1KQZA 3U4FA 3VOIA 2PDLA 3E6EA 5TF0A 4UIOA 2XN1A 4W8BA 3QOMA 1ADOA 3DEQA 3C4UA 3KRZA 3LHWA 1HJVA 3P93A 2QXWA 4W8AA 2CLIA 3OSPA 1AH4A 4H9XA 5D9MA 1E4MM 3TTQA 1CBGA 5JU6A 1SMAA 3WMSA 1UJPA 4LX4A 2WMJA 3KWXA 4MY8A 2VEFA 1GZ1A 3PZ9A 1W2VA 4XD5A 3UCDA 1ZALA 1POKA 4UFJA 2B31A 1WDPA 2C7FA 1XYZA 1EWEA 3DFYA 2ZE3A 3QF0A 3CO4A 1MQRA 4NNBA 4PUMA 1EA9C 1JGMA 1BFNA 3U0HA 2PZ0A 3TR2A 4ZL1A 3TTYA 1OHLA 4QR6A 1DIDA 4O28A 3T5HA 3BLIA 1AK5A 2J8FA 3CTLA 3LY0A 4I7WA 5DELA 3VD3A 1VLWA 1C9DA 1TVPA 2BVYA 2WCAA 3IJQA 1BWKA 3P8IA 1GT8A 1H51A 2F6XA 4IIBA 3CQIA 1Q7QA 2XM1A 3HGJA 4AEEA 4QISA 1UUOA 1MNZA 1EO5A 3EDEA 2BG5A 3HQ1A 3UJ2A 4DWSC 4AY7A 1WAWA 3GUWA 1DWFM 3S42A 1GPFA 2WQDA 3LI0A 1OFOA 4UMCA 1TX0A 4ZO6A 2YSWA 3W71A 1NWSA 3T5LA 1S2AA 4Q8VA 3PFMA 2Y8VA 4CNSA 4MOZA 1WYIA 4XZNX 3FVMA 1V6VA 4JFWA 5IBXA 4K6AA 1CXFA 3OA3A 1XD0A 3NZPA 4DJEC 3H2FA 4JCLA 4JHZA 1TSIA 1M7JA 2PDBA 2DV0A 5KT3A 1EC7A 1FWTA 4GD0A 3IUIA 4B5XA 5GNYA 1P7TA 5A8GA 1K8YA 3GDMA 1OX4A 1IM4A 4YWSA 1E56A 1C7TA 3B9NA 3FNDA 3SCVA 1N8IA 2GSJA 4DJED 4JDBA 5HANA 2OJPA 2E09A 2ZTKA 1GKQA 1QWKA 4UQCA 4US5D 2R8GA 4KESA 3AMGA 4Q8QA 4UFKA 4M8UA 3KVLA 1CNVA 1XC6A 2XWEA 3R43A 2OPJA 5DLCA 3K4DA 5KZDA 1TR9A 4C5ZA 3UYIA 2XYLA 1VPYA 4FLQA 5A95A 3LG3A 1K1DA 1X1OA 3W2UA 4MZYA 3UR2A 1FXPA 2FLIA 3NQCA 3F4WA 5AECA 3BCJA 5JBDA 1F2JA 4DN1A 1PAMA 3DI0A 2GGJA 3DKJA 3PWAA 2WVVB 1M01A 1JZ3A 4MGGA 5ENLA 4PMZA 5EPDA 4QWCA 4D6JA 3MYPA 5T9CE 1J11A 3GIIA 3BOXA 2NQ5A 3EWUA 4J5NA 3MSDA 1J2WA 1DJZA 3THCA 2C91A 5A6AA 3KOXA 3FAWA 4PMDA 4F2BA 4JNZA 4RDYA 3TYAA 1E4IA 3D46A 3ZWSA 4ACZB 2YCIX 1TWSA 3N6QA 4D8AA 1E6NA 2QCFA 2DT2A 4HIBA 3N9RA 5SWUA 1XLCA 1NQ6A 3P84A 1US3A 4QG9A 4QDWA 2PU0A 5HK4A 2WZMA 1UROA 2VZOA 3NOYA 3FJLA 4PUUA 3IWPA 1W5MA 3LI1A 1KFCA 2HS6A 2Y5EA 4O3NA 1LBLA 3A12A 1IR1A 2PBOA 1SZRA 1YDOA 2QQ6A 3AMKA 4AVOA 1ZJIA 4UBPC 4GK8A 3OG2A 3IV3A 4JN8A 1YKWA 4GQQA 1DE5A 2NLYA 4JQ1A 4J27A 4H01A 3RBDA 2B7OA 5MF5A 4CEUC 2FMNA 1HP5A 3T8QA 1V4YA 3TCEA 3LHUA 5HPCA 4C6OA 3GXFA 7CGTA 3OLEA 2VGBA 1Y5XA 1HP4A 4PODA 2HE5A 4K38A 3VCRA 2BX7A 3GZAA 2RAGA 1E0TA 1V02A 4E3TA 2ESCA 2R91A 1SO5A 3GNPA 3CQ0A 3WZ0E 3E49A 1KRBC 3BJFA 4HHPA 1S1PA 3IJIA 4PBFA 3R2GA 1TE1A 5K9DA 2H3DA 3S9YA 2WB5A 3B8WA 1XIEA 1UKTA 2NX1A 3BQ1A 1F8IA 4S3BA 2PCQA 3LGGA 1H7OA 5JUVA 3VD9A 1V3JA 3QR1A 4AIOA 3O15A 4R88A 3EMQA 3ARYA 3D6NA 1MYRA 2Z0IA 1TUXA 4AY1A 3L2IA 3GSMA 5HBFA 1YQ2A 3RILA 4NXKA 2ICSA 1JUKA 4H9ZA 3BARA 4UMBA 4QITA 4W7WA 4HA4A 4GBUA 5LIKX 4PFMA 2R8WA 1FH7A 2HVNA 3P2VA 3S2NA 3ZZ1A 1JD9A 1RBLA 1UKPA 3V3WA 3AUJA 2NQ9A 1JIBA 1QK0A 4R7JA 1LT7A 1KLZA 3M0YA 2OYLA 4FXSA 2XWDA 4DZHA 3LBOA 5CZTA 4Z0SA 2PCEA 3RX2A 2YDQA 4K8EA 4XTIA 3EWYA 3CMGA 1BWLA 1Q13A 5TQLA 1GVSA 3T9PA 4E4FA 4MPKA 1I2RA 3W76A 2PTZA 2VA3A 2W7PA 4YLWA 4H2CA 4JTEA 3JZUA 1LORA 1UR2A 1KTCA 3ZJ6A 5D37A 4HZ8A 3TYBA 2OOGA 3O1NA 4IFKA 2D73A 4P8UA 5F2IA 1ITQA 3STPA 2AMGA 3UA3A 2GSEA 1E6ZA 5KZ6A 1O6IA 1JYXA 2GQAA 5KG7A 3DX5A 1LOQA 4S3GA 4REQA 3VZXA 5FJUA 5A69A 4KEZA 1XYMA 3IGXA 2Y7FA 5F7UA 2Y4SA 3VIHA 3ZFHA 1ITUA 1R8LA 5HULA 2EBNA 3WIJA 2CKSA 3AS2A 4F66A 4LAUA 3EWZA 1LQ2A 4M6VA 4KWOA 5K4XA 2H90A 4LEQA 4E2DA 1UKQA 3CV6A 3OHMB 2VQUA 3H24A 4KCTA 5EA9A 1UR3M 3OBKA 3N04A 3SUUA 4K36A 1XX1A 3PVFA 2ZZ6A 3ZM8A 3C0LA 1SO6A 1DWAM 1FWHC 3TFXA 4HHMA 3N1AA 1XD1A 2C14A 5DY3A 6XIMA 2CZFA 4LTSA 4HPXA 5C5JA 1GK8A 4X2PA 2WYSA 2UY3A 2IPFA 1OZQA 4EE9A 3H4GA 1RBOB 1WXYA 4YMZA 1ZU8A 2XM2A 3FJNA 2CLOA 3E12A 2XSBA 3MFIA 3V6HA 1EJUC 1UD2A 4RZBA 2B7NA 1MZHA 4JAWA 4JV0A 2MANA 1SJAA 4Y9OA 4PL1A 4TX8A 3IJLA 1KKRA 3IANA 3HG4A 3TW9A 5A2AA 4J9OA 3SBFA 1DHPA 4OV9A 3M46A 4FMVA 1EP2A 4HMNA 1YXCA 1NFGA 5DEZA 3BQ5A 3K4AA 3WFZA 2I5QA 7XIMA 1F9CA 3THUA 1GGOA 2HZGA 3ARSA 5DMYA 4BF5A 1YE6A 4G3IA 3UVAA 4A8IA 5KT6A 4O16A 2I9EA 2VZSA 2D2GA 1J10A 2DDXA 2QR6A 3L4VA 1M6JA 4U5IA 4B2DD 5DY2A 2FLPA 2QV4A 2VFEA 3VFCA 3ID7A 5JMUA 3L23A 3T05A 1W1YA 5AYIA 4D6FA 2CNCA 4JIIX 4ZO8A 1OFAA 4TO8A 3MO7A 3GBEA 3M0MA 3VGGA 5DX7A 3H21A 1G94A 2PWVA 1SMDA 2BQRA 4J2PA 3UZWA 1K02A 1OB0A 1Q6EA 1XIGA 2W3ZA 4U2YA 4AHQA 1TQJA 3PR4A 1EBHA 2R1MA 1XI3A 4J7RA 4NSBA 1TCDA 1V7AA 3D3FA 3WNPA 1BD0A 4RLIA 1IGSA 4DO5A 1VJIA 2DT3A 1AZ1A 3G0SA 3DC8A 1FWJC 2GPTA 3TQ1A 2ZQ0A 3MKCA 3TZFA 3JU2A 3PULA 2YX0A 1VFMA 3B06A 2INEA 4TX6A 4UQAA 1B54A 5HNNA 3RF9A 4CQAA 4S39A 3F4VA 1A5UA 6REQB 4G7FA 4C6CA 3TNOA 1HKMA 3W84A 1YW1A 4PBEA 1GOMA 4MWAB 1QCWA 3NEHA 2E40A 3ES7A 3TA9A 4AYGA 1F76A 4P2VA 1WV2A 3OHBA 1GZJA 4ZXLA 3QBUA 1EC9A 2WLZA 1ISYA 2FB3A 3QW3A 3K1GA 2FTYA 1EJ7L 3A9BA 5KFLA 3IIPA 2OWCA 2PWGA 2OKOA 3OHAA 4URIA 3F2CA 2GVYA 3REQB 3OEXA 1D3HA 1CCWB 1W56A 3USZA 1IT8A 1IQ8A 1PS9A 3GXPA 1OCQA 5HWNA 3VX1A 3E3HA 4Q33A 5CEWA 3RXZA 1UB3A 4B5NA 5EYWA 5DGBA 3OG3A 1EUNA 5IRPA 3W07A 1O5KA 1WOAA 3ZJ8A 1TJRA 3SY8A 1P7TB 1LDCA 4AVFA 1WZMA 3MDUA 3NL3A 1JJKA 3UXIA 1JDCA 4IMAA 4MWAC 4I9MA 3BSHA 1NQKA 1GEQA 1FCVA 1PTGA 4C6EA 4HJWA 2AKMA 5D33A 3EOEA 1V51A 3WL0A 4MY9A 1V8EA 2YXGA 2ZRVA 4QWBA 2CLLA 5G4WA 3VFLA 4AMAA 1Z42A 4IQDA 3TSMA 3WJSA 3SRDA 1OF6A 2R94A 2VZVA 2Y89A 3DECA 3WQOA 2H3BA 4ECZA 2Z1VA 3CEUA 1GTEA 3S2CA 1GTHA 5KG3A 3DUGA 5JXQA 3S1GA 4JR5A 3EX4A 4L6DA 2X1TA 1LP6A 3EDFA 4PTVA 3NXLA 3H7UA 1LUCA 4FOJA 3SCOA 5D8ZA 5GJNA 3S46A 4AZCB 1VS1A 4B4HA 1GVOA 1QPKA 4WGXA 1V6WA 1VH7A 4J9RA 2WKGA 3I4KA 3DDMA 5FOOA 4EPBC 3T5JA 3HPSA 3VKCA 1IIHA 1X6NA 2P76A 4QRNA 1ZPTA 3TQVA 5BU6A 2X40A 3NQ8A 1M7XA 2F6UA 1WKDA 2ZRYA 3QQ1A 3W7JA 1JQVA 4H6KA 3TW7A 1S5NA 3QFWA 1VFOA 3NTYA 1TG7A 4YR2A 5LA0A 4RNIA 2IS7A 3CO8A 4O10A 3RX4A 4QAWA 3G0XA 3RU6A 3M64A 1SQ7A 4DYEA 3OA5A 5EMKA 4ZQPA 3NQMA 3DGBA 3IGHX 4HQVA 3PY2A 3DG7A 3FA5A 3W7CA 3A4XA 2WTFA 1LRTA 3TSDA 3UR8A 3NOEA 4IXXA 3BAJA 1WAUA 4GIEA 3GDTA 3TNBA 3AXXA 3NDOA 1ONWA 4R53A 1VYSX 1ZSXA 1CTNA 4GC7A 3VCNA 4LF2A 1TTPA 3NSNA 4MNMA 1FHDA 2GUYA 5ECUA 3S2MA 3TQ0A 3T78A 3TV8A 2DVTA 5D2WA 2Y8KA 4UR9A 5IDZA 4PULA 1BHGA 5I24A 3H40A 5H8MA 3OU8A 1FWAC 1EPXA 3M6YA 4ZOEA 2AGTA 5KEZA 1RCOB 2VX6A 1OSEA 3CV2A 1W3NA 3G77A 1H11A 1TPWA 1BWVA 4XBSA 3VNYA 2YL8A 4J9NA 1S2WA 5TNVA 3WQ6A 4OQVA 2BR0A 5ABGA 4F4XA 2CHRA 5B7YA 1G5AA 2C71A 1L2UA 4FXFA 1XP3A 2QJJA 1GJWA 3G1RA 1XPYA 4H7ZA 3IRSA 4MZ8A 4H6RA 4NAFB 1PIFA 1G6CA 3VINA 3EZ4A 3R10A 1JDEA 2ZTJA 3N9SA 1IE7C 5DG7A 4IWWA 2GQ9A 3L4ZA 8TIMA 4RZ4A 3FEQA 2WXDM 1YHTA 2VUYA 5FSEC 2W9BB 2OWXA 1A5LC 1QU4A 4EBDA 4FX7A 3BJSA 5F4SA 3S0CA 4C1NA 1GPWA 1EP1A 2QDEA 3EPIA 2YBUA 1R5YA 2HRWA 3HM7A 2Y5SA 4NX0A 4C6KA 2VGGA 2GOUA 1V7YA 3ALGA 3POHA 1NWTA 3WLNA 4KCVA 3PUEA 3N3MA 3HN3A 4OWGA 4GJ1A 4P7LA 2I1OA 4QHRA 2J9ZA 3SI8A 2A5HA 4AWEA 1R3WA 1WPCA 4QDPA 1KRCC 3EKZA 1EHNA 1N2VA 5DQPA 5CAHA 1OGBA 1KXTA 1CLXA 1IYXA 3RPDA 4BF9A 2PWHA 3M0ZA 1FCBA 1NP2A 1ITCA 2DJLA 2FHBA 1I2NA 1GOWA 2QCHA 2NQJA 1FQ0A 4JIHA 1T94A 3ENLA 3H2MA 2ZXAA 3OYZA 1JNEA 2O0TA 4MB5A 5FL1A 3NDZA 1XKYA 1V6TA 1P0DA 1XIMA 4EYIB 3L4YA 3CHVA 3HGSA 1CLKA 4YTQA 2DIKA 2VFFA 1XGZA 3C2VA 1SSDA 5I3JA 4IG2A 4GUIA 5I78A 3HF3A 3CL6A 3U2ZA 3DFOA 2V82A 5TIMA 3GV5B 1XL9A 1T0OA 4J3VA 1TPEA 4PBGA 1R2RA 1UIPA 3QC0A 1BQGA 3DYMA 4PL2A 1S5TA 1O94A 2E3ZA 5A2BA 3AIVA 4YR3A 4LY8A 5AN7A 4A8NA 3FXGA 1GQLA 5EBAA 1GJUA 3WN6A 3FHQA 1GOQA 3UGRA 3R89A 3T2PA 3SY1A 3IAQA 3PZTA 3O05A 1KBLA 1W9UA 4Z1CA 4Y8FA 2CLKA 1A49A 3G1SA 4CD7A 4A3UA 2B7PA 2XJ7A 1VBJA 1W3LA 3LERA 3UXLA 3U3HA 4E2OA 1CGVA 4D6EA 2QJHA 3CIXA 1JAKA 5EY5A 3STCA 3KL0A 1HO4A 1X8FA 1OC7A 3GH5A 4A8LA 4GQBA 3TYEA 3PUOA 3O07A 3U7BA 2YFNA 5K9CA 2GJXA 1QWGA 2VFIA 4A3YA 4HU8A 3A4WA 5M3WA 1J0HA 3EEZA 3W88A 4JHMA 4GZIA 1TIMA 1G7VA 4ZTYA 1ZETA 4NYUA 2OLAA 1UWTA 4LS0A 5AHMA 5CJNA 4ICNA 2VZUA 1HJQA 4A05A 2QUUA 3V1HA 1OYBA 1GQNA 3KTCA 5KFIA 3B9OA 3N4EA 5EBUA 3EOSA 3BLLA 1XDJA 2J9YA 3PNZA 4D8ZA 1T8QA 1CXKA 3PW5A 1VIZA 1CXHA 3A9IA 2XTKA 2F61A 1UWRA 1TPDA 1XLAA 3WEMA 3MTWA 3SN1A 3BLKA 4PB5A 1N48A 3AXIA 3AHYA 4EOUA 1ML1A 5C2GA 3AWOA 4KWUA 3WG6A 4S3KA 3IEBA 4RPQA 3BQ0A 4MB1A 3GIMA 4AX6A 3DBNA 4DZIA 5C9XA 4XG1A 3LSCA 2XH2A 3ISIX 1I45A 2E8ZA 3MP4A 4H6QA 1AJ0A 2VC7A 1EJSC 4HNVA 4YIWA 1DP0A 4US6A 4LV9A 1PXGA 2BODX 3AFBA 4Z2JA 2VEGA 2VX5A 4FLSA 2OQLA 3WUGA 3MCNA 1E4NA 2J6TA 4NZ1A 1FRBA 1ZENA 4GY1A 5LA2A 3W25A 4AEFA 1R7OA 4GHRA 5I23A 4Y7EA 3UXKA 5E9XA 4CN1A 5CSRA 6ALDA 2ZZ3A 1G9HA 1JPHA 4NILA 1EC8A 1G69A 2IPWA 2E6DA 3VIGA 3VKJA 2WHLA 4R27A 1E6RA 3RIKA 5KFZA 2XGIA 1V08A 1SFLA 1B9ZA 1JZ7A 4AU0A 1XIJA 1FWWA 2QJIA 2J77A 2ONEA 4BEQA 1NOFA 3FDGA 1Q6CA 4DO6A 3WCZA 1QNRA 3MZNA 3RN6A 3ONCA 4BA0A 5HMSA 5C5YA 2VCAA 3THDA 3AUOA 4RNMA 4FR1A 3E0WA 3WDRA 4DUXA 2D2JA 2UVUA 1AMYA 5FF7A 3WQPA 5L9FA 2HNHA 4I8YA 4LU0A 1XKJA 8CGTA 3W1LA 2TPSA 1L8NA 3PZGA 3R58A 3A3WA 1YDVA 3PW4A 2RKXA 4P8XA 1W3IA 4QEEA 4PYSA 2DIEA 3WFLA 3AMDA 4NZCA 4KMQA 3W74A 4AIEA 2IPJA 1UHVA 1X6LA 4O11A 5A8OA 3BC9A 3G6MA 1EUAA 4F0LA 3ABRA 3N9KA 3WUFA 4UR7A 4A6GA 1VPQA 4R8UA 1N82A 3PAOA 1JR1A 1XLFA 2OVLA 3LRKA 5LNWA 1VJZA 1ZGDA 2XN0A 4NZJA 2L5HA 3W7PA 2JEJA 2JIWA 3CLMA 4MM1A 5AC8A 2YCJA 1XSJA 5GJPA 5B7ZA 2PAJA 3DHUA 1VAHA 3HMCA 3LM7A 4R5EA 5LIWX 3N2TA 1W54A 2CBJA 5HR6A 5LZLA 2Y70A 1DWIM 4G5DA 3RX3A 1ISWA 3BMXA 2NXIA 4S2CA 5A1AA 3QFEA 1Q6OA 4KW2A 5AYYA 1GCYA 3G1HA 1TJ1A 4ECXA 4HCDA 3T6CA 3S47A 2OZTA 4R9OA 2QCDA 1REQB 3EOUA 3UXDA 2E9LA 2WW5A 1LOLA 4V27A 4R33A 1E15A 3GAKA 1T8XA 5FKYA 3WQ5A 1GW1A 1WA3A 1XRFA 3L4WA 3VI2A 3W7HA 3HTWA 1W1TA 3IK4A 2R8KA 5I3HA 2IXUA 3ABSA 4GH3A 4YVXA 4HOXA 2GVGA 3MC5A 1HKVA 5I7GA 1B0IA 4ED7A 4PMXA 4AZ5A 1G7UA 4ECRA 2HE8A 4HMCA 1Q5MA 1BXCA 4WSHA 2JF6A 1XG4A 3G1YA 3CV7A 4I5RA 1JDFA 1J5TA 4TVCA 7TIMA 4TMCA 3BG9A 4Z2GA 1X8CA 3WJYA 4YVVA 4RNOA 3LDVA 3VGHA 1JDAA 1GHSA 2YLAA 1LLZA 4BQ5A 4OUIA 3BH4A 4DELA 1QJWA 2B81A 3M43A 2ZA2A 1EJTC 1XXXA 2VTFA 7REQB 2GGHA 1K1QA 3EA3A 1IF2A 4W5ZA 4O8AA 4HYVA 4MLJA 3O6AA 2PE4A 4ML4A 4IISA 4N7QA 1AUSL 5LGZA 3JUGA 3KRBA 2FLNA 5EMJA 1QXLA 5LNRA 3O7UA 4M24A 2HMCA 4E3VA 3R13A 1PYMA 3U7VA 3NPUA 3AQUA 1SZGA 4AWUA 3KWSA 5BRPA 3KS5A 1LZOA 1HQTA 3GTNA 4B9YA 3C2OA 1CT5A 5HDRA 1XLIA 4X9SA 3KBVA 1YDNA 2VC9A 4ILSA 3SUSA 1RH9A 1J12A 1SZNA 1ZFJA 5FJPA 4TUFA 5BXPA 5H91A 2WC4A 2QPUA 2C1HA 3KRSA 3URQA 2JEQA 1RV8A 3R5EA 3OOQA 2WOQA 5HJXA 4RNHA 5AFDA 5EFDA 3K5XA 1R47A 4FNPA 1OJXA 3MSYA 5BMWA 4XBJA 1TV2A 5U4NA 3G24A 4JTQA 3M4HA 1PX4A 2HNEA 1T6MA 3MCMA 4CQCA 4MKNA 1QOQA 3DG6A 4C7FA 1QUMA 4B90A 2QCLA 3BXWA 3UFYA 2A6NA 1WX0A 4HYKA 1JZ5A 4UNKA 2W9CB 3F2BA 1H0IA 2D3LA 5KFDA 4TV6A 2NLIA 4D1IA 1AW2A 4IPNB 4GXPA 1EDQA 3DXIA 4ZQRA 3VZZA 1W5NA 1XUZA 3AYVA 1R3SA 3TVAA 3BK0A 3INPA 3OGRA 3ZLFA 4AZ6A 4L1XA 3W7KA 5E0KA 3PVXA 3GC4A 1KLYA 4FBTA 4GC4A 2V3FA 1NWUA 3QR0A 4ROQA 4L65A 1FFQA 3PUGA 1S3TC 1E1CB 3LV6A 3WYZA 4FLOA 2TODA 2YYTA 2PEVA 3GIQA 4D1JA 2AAAA 3KTSA 5I06A 2F2KA 1L8PA 3W1QA 4Z17A 1SZEA 4ZODA 1H63A 2PLCA 4WF7A 1V6UA 4LUSA 4IIEA 3W70A 4H41A 2PDIA 5KITA 4D6CA 4FNSA 3GIKA 3PBWA 4AD2A 1MVYA 2A3EA 3STEA 3VIJA 2BVWA 2ZKMX 3LQGA 3CUJA 1FA2A 3C86A 1K6AA 4D8LA 4ECVA 3TK7A 2WBGA 4CNTA 3O2LA 4JZ5A 1I4NA 4IR9A 4DNHA 2RUSA 4Q32A 3W2LA 3VOHA 1MW2A 5EFFA 3A23A 1XF0A 2I7GA 1ME9A 4LGXA 4Q8WA 3BPWA 3RLVA 1ZLPA 4LVFA 4RUAA 2XGQA 3MHFA 2W61A 3EDJA 1VBRA 4BJHA 5D05A 5U7SA 4MAZA 4EYHB 2V0TA 1KM5A 1QNPA 3SADA 3GNOA 1I9CB 1YX1A 4I9AA 3E74A 2GSHA 2H9AB 2FMOA 2Y5JA 3PBGA 3W23A 2Y7EA 1VHNA 4W7UA 1TJ2A 2NX9A 5L1LA 1YIXA 2QGYA 4FB7A 1UP0A 2PTYA 1F6YA 2I14A 3H2AA 3K8LA 4HOZA 1XLGA 2E1DA 4DB7A 2ZZ1A 4LAMA 4IUOA 3BG5A 3E0FA 3GFZA 3A24A 3PZIA 4ECYA 3N3TA 3QVQA 1CW2A 1TRIA 3IRDA 1XLMA 2F6KA 4NXSA 1WBJA 3ITVA 4IGSA 1XG3A 4UOJA 4AMCA 2Y88A 3VMPA 1Q2SA 1W32A 4S3CA 3CGTA 4YQWA 4ZA0A 4GQRA 3FA4A 3LV5A 3LRLA 1FWSA 1OFDA 1JCTA 3ZVHA 1XH0A 2QDHA 4XO7A 2V4QA 1CECA 4V2XA 3C2YA 4MUPA 2KX9A 5K7JA 1RQBA 3USBA 2WWCA 3VE7A 2DPJA 1O5QA 1C9WA 1JUEA 4QS5A 1PJ9A 3PWIA 2CXGA 1C93A 4HPHA 3M0JA 1UWUA 3TMLA 4DJDC 1UZ4A 2OZ3A 4J9JA 1QW8A 4LNYA 1ZNNA 3P0WA 3V0TA 1RK5A 3L66A 3VIPA 3TJLA 2IPGA 2DJXA 4LS2A 3E02A 1JDDA 3N6JA 4O15A 4I6VA 4CD4A 4AQLA 3U8GA 4XWUA 1BVWA 3BLOA 4V15A 2VT0A 1VEMA 3T40A 1I1XA 3TQPA 4C1LA 4KRUA 4RDVA 2IKIA 4A2SA 3EXRA 5BYWA 3LMZA 1ZCOA 1MEWA 3R7MA 1QHOA 1TPH1 4KFNA 2DGAA 8XIAA 1V3MA 2PDCA 1DVJA 1T3NA 4LCSA 3BW3A 3TXZA 2Z4GA 3ALFA 1R9YA 5HMEA 1H4PA 3BWWA 3V6KA 3QQ0A 1P6CA 1XLKA 3SY5A 3I6RA 3U4AA 3CQKA 2O7QA 3AMLA 4AXNA 1IXPA 3CXOA 3VDGA 5A3HA 2ATLA 3QY7A 4OT7A 4UR8A 1OCBA 3O6DA 1T41A 5KFWA 1ZBKA 3MPGA 4K39A 1XHGA 2WZHA 2NUYA 1GKPA 1XSIA 4XBKA 3SECA 5A6MA 3RR1A 3CC1A 4ORIA 1F74A 1H62A 1D3GA 1H50A 4MWAA 3GG7A 3WQWA 1ZHAA 4JKKA 3W24A 4PTDA 4MZ1A 1N55A 4R85A 3MDWA 1E55A 2W91A 1QPNA 2Y85A 5LNSA 4HTYA 3UG3A 1LL6A 1XGEA 2VR4A 2CEQA 2X42A 4LBUA 3GZ3A 5C2CA 4L4MA 3OVGA 3KXQA 3EWXA 3I10A 2DSZA 2WNQA 4ACYA 3WH8A 5CC7A 4NU7A 2JE8A 4U4MA 1K03A 2INZA 3WJWA 1KFKA 2ZZ4A 3RU8X 2VFHA 3CL7A 4OOUA 1IT0A 4LC6A 3S5ZA 3KDNA 4Z1BA 2YCKX 1FCQA 4P7RA 4CN6A 4ZQMA 1EDGA 4JYDA 2G3JA 4NI3A 2IKHA 3KCJA 3TZNA 1I6NA 4JQAA 5TD4A 4O14A 1A4LA 2E9MA 3LHYA 1ECEA 4KBXA 4W9TA 3S8HA 4CNUA 1ZB5A 4XUGA 1EOKA 3LX9A 2CBIA 3P62A 6REQA 3BUVA 4Q22A 3I6TA 3C6CA 2A85A 3CHEA 4NQ1A 5I3GA 1U5JA 3KCLA 1W1IE 5C9UA 4LB3A 2VGIA 1UOZA 3LPPA 1HL2A 2YOCA 3CUGA 3WBEA 3VNLA 3SAZA 3VIMA 2X8RA 1B3WA 3WMLA 4CNPA 5I07A 2X16A 2ALZA 2QUVA 1MMFA 4AZCA 3TYDA 4YJ5A 3RMJA 4Q43A 4DO4A 4ED1A 3N11A 1ONRA 4RCXA 4U31A 2PWUA 1YYAA 3TJ4A 3PB0A 1TJ0A 1OWQA 1W8SA 4MG4A 4GVFA 5A8NA 5IFPA 3CAVA 1S0OA 1U1JA 2D1ZA 4PSPA 2OZ0A 3L68A 3PTDA 5KZEA 3GQYA 1T96A 4LBSA 3W7NA 4ED3A 1JPDX 3CL8A 1TV8A 5A2CA 2RDWA 4FS1A 2DZTA 4YCPA 4JYFA 3GNDA 3AXKA 1LLWA 4NIRA 2ZX5A 1K8XA 2Y8UA 4RUCA 5BU9A 2AQVA 4ZO9A 2VM8A 3S2LA 2WV8A 5H6HA 2IMWP 1W3KA 2VDIA 2WSRA 1TRDA 2XC9A 4PSRA 1X1NA 5FA5A 4J4KA 1PCKA 2X09A 3Q2DA 4BY3A 1IZJA 3V5CA 1LWJA 4J9KA 3PZUA 4M0XA 1B90A 2GVJA 5DXYA 1FHLA 5KFCA 2PTXA 3QKEA 1KBJA 1I60A 3WDJA 3VKBA 1OZMA 1A5SA 3E5BA 4NAEA 3S6OA 2G3MA 2BOEX 2GJNA 4PFHA 3WLIA 5C0QA 2IA6A 3LHZA 3RGTA 2XG9A 3SUTA 1QW9A 3GXNA 5AVHA 1EZWA 1RQEA 2VFGA 3STGA 5DG8A 2JIEA 3GTIA 2E28A 4E5TA 2RDIA 2REQA 3O6YX 4O13A 4M80A 1PZ2A 2E25A 1F4AA 3T08A 1EPVA 3W2MA 5AHNA 1E6PA 3M5YA 4JTDA 1OYAA 1T99A 3OJGA 4C1KA 1F3TA 3KW3A 3MMTA 2J7DA 3I3DA 1H7RA 4ZSUA 4LJ3A 1XSKA 2PUZA 2E5DA 2J7CA 3GIJA 1UD6A 4D6GA 5KFOA 2BY3A 3UJRA 1TUFA 5I5RA 2D0HA 4ICCX 5FEWA 2OZ8A 2HCVA 3A3XA 2WC3A 1IEIA 2DZWA 2C22A 4WSKA 1LROA 1REQA 3CEPA 4G6CA 4R34A 2VDGA 2RDXA 4JTTA 2J13A 3VX0A 2RDJA 1PEZA 1DKWA 3FGCB 3B8TA 2GGGA 3FIGA 3XIMA 3T55A 3T81A 2V9DA 3LXAA 1PWLA 3LBCA 1FWIC 4XZ9A 2PDJA 4M6UA 3G6XA 4H9TA 3W28A 5KFKA 3DENA 5CXPA 1K9FA 3VOFA 4N0RA 4J3SA 1BGAA 1V3HA 3VOCA 1LG1A 2HVMA 4KT2A 3P5YA 3OVQA 4IUGA 4O4VA 2OYKA 2WKLA 3QMRA 4LAOA 4AUBA 1NOUA 2C28A 3MUAA 2FGBA 3MS8A 6A3HA 4DL2A 3VYLA 3VNZA 3E0IA 1JXJA 4TTGA 1UZDA 2FLLA 4S3EA 4AWSA 1OM0A 3LGEA 1LL7A 2ZUWA 2WHJA 2Z6JA 3WK2A 3FOKA 1XCWA 3PFRA 2UVRA 4H8UA 2ZUTA 4IX0A 1YPIA 3FSTA 1J18A 1KFBA 4V1XA 2G97A 2IQDA 3MP3A 5BWAA 5DQHA 5KFVA 1X7FA 1WDWA 2O92A 4JTCA 3TCSA 1VRDA 4GNKB 3U9IA 2ZRXA 4ATDA 3BLDA 2HK0A 4IMGA 4LYPA 3TDFA 4LQ1A 1J79A 3GHRA 2P8BA 2WNZA 5AZ1A 1LG2A 1VEPA 4Y9PA 2AAMA 4GOAA 3Q45A 1SR0A 3CZ8A 3TTOA 5L1IA 1MW1A 1YBQB 2Z1XA 1OABA 2B0MA 2VX4A 3QZ8A 2C1IA 1F3EA 2P9BA 3GXTA 2ISFA 2BHZA 2CZ5A 2FYMA 2QPXA 2WHMA 2NWSA 5FEPA 3VU2A 2DVXA 1N8WA 2CKRA 3V5FA 3W83A 1QO5A 1DWGM 5FI8A 5FESA 4IL2A 4XZBA 3QV6A 4HD5A 3KOZA 2RHGA 5KG5A 4OECA 1W5QA 3S5YA 3AO0A 3O0KA 3LTSA 1CGTA 2XFWA 4H7CA 2DP3A 4LUJA 2G4FA 1S39A 1YNQA 3GKAA 4JY8A 2WKJA 4GY7A 2XUCA 1HX0A 2XIBA 1Q8JA 3RFAA 2J6SA 1PCWA 3S4TA 3RAQA 1KR1A 2ZWZA 3JRKA 4FXJA 2R8IA 4LRTA 3ARQA 4HKPA 3KM8A 4M29A 4CQBA 1ZS2A 1UOKA 4GCXA 1K8CA 3BCFA 4EKJA 4JTRA 1DTNA 1B57A 2DH3A 4HHLA 4QJ1A 3R0DA 5GJMA 4FBUA 3ARUA 4H00A 5E70A 2AMXA 3GVRA 4O1DA 3P8JA 4M6QA 4GVGA 4QXIA 3NDYA 3FYPA 3N25A 2PGFA 2GK1B 4I8DA 3RB6A 4PC8A 4Q7IA 4GNVA 3T8LA 2J6XA 2A1YA 3B8DA 4AHPA 4UTLA 3LCXA 3HB9A 3APTA 3H2EA 1QO2A 1QASA 4EXAA 2BY0A 4AY8A 5D8WA 1S38A 3ITTA 2D2HA 4QSFA 4J3TA 2ATSA 2GDVA 3OB8A 3QZEA 1XRVA 3TC7A 3WLOA 2OB3A 3UWYA 1KM0A 2PFHA 3KBWA 2IBKA 3WELA 5I3FA 1Z48A 1H1ZA 1WUEA 3H2NA 3VGDA 3SCSA 4MFDA 1DV7A 4C6FA 2XSXA 5I09A 5CZ0A 5HQEA 4GYKA 1OEPA 1JFHA 3PPCA 2F7FA 1VCVA 1DIEA 4TQRA 4UCFA 5E93A 2GZXA 4DAFA 4AD4A 3QRHA 2V81A 3KHJA 4H19A 2ZVIA 1SFSA 1KM1A 2R8HA 2DPEA 3CYJA 5BROA 3NO5A 3BG3A 5BMXA 2OX4A 4M82A 4RXGA 3IVTA 4AIBA 1P6WA 4EPKA 3ITLA 4E2VA 2J75A 3KHGA 1TELA 4M7TA 3NL2A 1FWCC 4WOZA 3M0IA 5IM51 1G0CA 3TP4A 2YLLA 2QUMA 5AHIA 4MWAE 2GK1A 1A4MA 4XUYA 4DBDA 4BWLC 3L21A 4KGLA 3HV9A 3OW1A 3G0UA 4C90A 1J5SA 1E9LA 1P5BA 3SFWA 4RJEA 1ZP4A 3UQNA 1RA0A 3NZ1A 3PBUA 4F2UA 2ZX6A 4MY1A 4IPLA 2P3EA 2DFAA 4GYJA 4DJFD 2QJGA 4I6KA 1BAGA 2FZDA 1FWRA 3YPIA 1O7AA 2W79A 3EWCA 1UA7A 3NVDA 5CC3A 2ZXBA 3WF2A 4RUBA 4TMBA 1ECQA 1HKWA 3QPEA 1TWDA 1NFPA 3SFKA 3A47A 3MKVA 1L6WA 3FY1A 1A5OC 3DFPA 1XIIA 1C8QA 1CEOA 1RQHA 4O19A 1NEYA 4ZQNA 3STFA 5J04A 4JN7A 2BFGA 5F4XA 4DWSA 4JNMA 1LWHA 2EQDA 1AQFA 1PTAA 3GTHA 4YP3A 5L9XA 2VGFA 5KT4A 1AQMA 4BS0A 5C54A 3GHSA 1AODA 2FVLA 1XBXA 3G3MA 4I3GA 4C6IA 1JZ4A 3TQKA 5I02A 3AJXA 3POCA 1PIIA 5EMYA 2AGOA 3ECQA 1EIBA 5HAOA 2W62A 5EWGA 2BVTA 3WO8A 1TV4A 3CHDA 1K7FA 3C52A 3CUXA 4Q8NA 4IHCA 1PHWA 2PDKA 3NPWA 1FCUA 3VMNA 3SRKA 4XIAA 1HN1A 4D6IA 1DPMA 1GVRA 2GLKA 3RRXA 1GORA 4Q4KA 1F6KA 4PR4A 4DO7A 4AZBA 5GNZA 4W88A 2XHYA 4XKYA 1J0KA 1DYSA 5DMNA 4ED0A 2CC0A 4WIWA 4UTWA 5K9XA 2ODOA 3L2MA 3G6YA 1LCOA 1XYAA 4NVTA 2Y63A 1KXVA 4D71A 4HNNA 4EF8A 3TOYA 3QSRA 3W75A 3L65A 2ZZ7A 3BJTA 2D0GA 2WO5A 4FIQA 1Q6GA 4W87A 2YYUA 1TE6A 3UBPC 5E09A 5KFJA 1W5OA 3G6LA 2Q71A 3H54A 3QGKC 1UWIA 5F2MA 4HK7A 3ES8A 3GK0A 1VFFA 3DKLA 3A4JA 1LYXA 4B5SA 3C8FA 3CAWA 3NQ6A 4A8RA 5F9LA 3NCOA 1WDQA 1HZYA 3GW0A 1R3VA 1TVLA 2YBTA 4LVDA 4WUIA 3COTA 4J9MA 3UXAA 5XIMA 3SEPA 2VUNA 1JRCA 3UETA 4DVOA 4N9BA 3PR5B 1NDWA 5DT7A 3SRFA 3R4IA 1WZKA 4IFKB 1OQFA 3H2OA 1QNOA 2Z7KA 4AZHA 1JI2A 1S9FA 4DZAA 1XWYA 3QPYA 3L4TA 3QYSA 1HO1A 1KNWA 3QV7A 3OGVA 3GXMA 4DWSD 4JGDA 1GOXA 4C7GA 3LA4A 1KO0A 4B5TA 2HXUA 4GYPA 3LLFA 3L2LA 1NFBA 4CQ9A 2V69A 4LYRA 3VDAA 2GJLA 3KOWA 1O60A 1JXLA 2V2DA 1I0DA 2BXYA 1QDSA 1OX6A 2XVLA 3L9CA 3KP0A 1IT7A 1XCXA 3VNKA 2P3ZA 3ZJ7A 3BAYA 4Y9MA 1H41A 5T8GA 2P0OA 4ALDA 3TA6A 2XVNA 3LCGA 2XH7A 1ADDA 3WMCA 2G3FA 2HK1A 4AD1A 4XD3A 3RCYA 4B2DA 2V2CA 1V0KA 3GV8B 2NX3A 3WLKX 1UKSA 2ATMA 3QGVA 1V3IA 4RNNA 1QNQA 1MEIA 5D2TA 3KBSA 4ECTA 5IOBA 1RVGA 4D6DA 4LCQA 4Q6XA 1MSSA 3B0UX 4J28A 4DWDA 4Y9NA 1H2JA 1KV8A 2J66A 3D0CA 4Q7BA 3LPOA 4DJDD 1RK6A 1JGIA 1KXQA 1W1B1 1BLIA 4HP5A 3VDCA 4F48A 1OY0A 3PZMA 1UP2A 1GZGA 4RW3A 3HBLA 3IJ6A 4BCEA 4NAFA 3H22A 3RAXA 4R9XA 4KCWA 1C3FA 3WMBA 2VJXA 3XISA 3R8GA 2OOFA 9XIMA 2O9OA 5HUOA 2VR2A 4KWVA 1TPC1 1GG1A 4GX8A 4M1RA 1PYFA 1JCYA 1SZFA 3KZSA 3B9AA 3CM4A 1DHKA 3KBJA 3FAXA 3IK2A 1W1ZA 3BQ2A 3NYDA 3WH6A 5E5CA 4HU3A 4D2JA 1J6PA 4ZB5A 5LYRA 3CNYA 2ZX9A 4ZXOA 1B4KA 4HCHA 3Q8SB 3F4CA 2V3EA 1J0IA 4AF0B 1OGSA 3HU7A 2PDUA 1IZKA 4Q45A 2J7FA 3AU2A 4YS1A 1YADA 1RZMA 2ZWYA 2Z1SA 2YDAA 4NYYA 1U1HA 3KVJA 1EJWC 1EO7A 2OEKA 1KV5A 4WK9A 1RA5A 2PDYA 1XGDA 1QR7A 3MV11 3C2EA 2PDFA 4MKSA 3AIUA 3UP8A 3ZSSA 3VPLA 4CD5A 3AS3A 3QLLA 4NJJA 5FJJA 4UTTA 1IGWA 2X2YA 2YCLA 4YCOA 4QLJA 5E0CA 2AQWA 3QY6A 3BCDA 2QCGA 1UH2A 2VURA 3WD3A 1POJA 1WDDA 1A50A 3MUCA 1LBFA 3ANYA 3V7PA 1S5WA 3EX2A 1SUXA 1DJXA 1CENA 4Q8EA 2Q6ZA 3S1WA 1MXDA 8A3HA 4XX6A 1MO0A 3T0BA 3DOPA 3IS4A 3Q8RB 4LBRA 3IJ8A 1UC5A 3ZWTA 4BQ3A 4NJIA 3EYPA 2J74A 4WEVX 4JCMA 4ECSA 4PCTA 3DN5A 4YR0A 3QH2A 3W27A 1R3YA 1R2TA 1JXKA 5FACA 4BF7A 1LOSA 4Z2IA 4Q4RA 2PGRA 2HS8A 3FGCA 3BGJA 4RV3A 1V0MA 3FCPA 1H1YA 4Q8MA 2POZA 1Q6LA 4JIEA 3OGSA 1DWHM 3UG5A 4E2BA 2QNEA 4DBSA 1Z7AA 2V5JA 3GG0A 4LALA 1VB9A 4EVZA 3CUFA 3ZMRA 3UWEA 3AOFA 1HT6A 3CLWA 3GYEA 1LF1A 2ASDA 5M03A 3ITGA 3PWGA 4OVXA 4Y8EA 2XCPA 3KCOA 4L1GA 3V35A 4M7SA 4UTFA 3UCCA 3BV4A 4C6NA 1GQKA 2HV5A 4OBSA 5I77A 1THFD 1HG3A 3GKFA 1LBMA 1CGXA 2UY2A 4IRCA 3OZMA 1NVMA 4FSAA 2BSLA 5KINA 2XINA 3NQ2A 3MT1A 3H23A 3CB3A 4LRSA 3WBXA 1M41A 1CXLA 3TWAA 4MAVA 2WBKA 3LPGA 3RNDA 1J93A 3OLDA 2A7PA 5C7VA 3NR0A 3SCRA 3W7DA 3IJ7A 4NNCA 2OKTA 3MHGA 3K8MA 1EX1A 2ASJA 4RDZA 1YLVA 3IV8A 1FDJA 2PURA 2TRSA 3TYCA 3WH7A 1XRSA 3MUZ1 4LAZA 4GUHA 2JGYA 1M7PA 2EKCA 5KT2A 4J3WA 1HKJA 1DJQA 4X3ZA 3UWZA 3WNLA 4TU1A 3TONA 4GC3A 2QMJA 1LQAA 3L0NA 2WMIB 3AIBA 3K8KA 1M7OA 2EPNA 4A3QA 3WLLA 1QMLA 3F1QA 3TMQA 3DYPA 1NARA 1XPGA 4CNNA 3WF4A 2Y1HA 1KB3A 3WQEA 3VO0A 3HURA 1PKYA 5CC6A 1IXQA 4INFA 3IAPA 4CD6A 5ABEA 3BLFA 1ZY9A 3PTMA 3F03K 5DG9A 3W53A 2OX1A 2V5BA 2C1GA 5REQA 2CLEA 3MWCA 4O54A 5HWJA 4HPNA 4P8VA 1OFPA 3EX3A 1TYGA 3QOKA 3N2CA 3ITCA 1JCJA 3I65A 4WSJA 3T1GA 2A3BA 2FHFA 3VNDA 1TPUA 4K37A 4LEFA 2QW5A 3FKRA 5LXXA 2GOKA 1UBSA 4UFHA 5DGAA 1PE1A 3Q8PB 1KFWA 1FKXA 1M3UA 1S5MA 3W4RA 3TWBA 3MU7A 1FVPA 5AYBA 4JTIA 3AIEA 2IQ0A 2Q8XA 4XB3A 4LF1A 1OC6A 3OPSA 2PDGA 3PSVA 2POTA 5AHEA 1OT1A 5PTDA 4GY0A 3SCQA 3UCQA 5F2LA 2PODA 2X1RA 2E8YA 3WQ8A 3HPAA 3BAWA 4PMRA 1WBHA 4J40A 4O3QA 4PMUA 4E0CA 3G2GA 2G95A 1XYFA 3V0UA 4CCDA 3CWOX 1FFRA 1LTDA 5CJMA 3QPZA 1K6WA 4DF0A 2YXXA 4XISA 1XYCA 4RX0A 4RZ5A 2HVOA 2ZUVA 1IIGA 1RCQA 3TLQA 4Z1AA 4QE5A 3MVTA 3T09A 4S3DA 1JVNA 4GVHA 2Y6ZA 5MHBA 4FLRA 3FHAA 4H2HA 4JTSA 1BEUA 3MCOA 1GVYA 5HWMA 3EPOA 8RUCA 4WDXA 5G1TA 4KEMA 1L2QA 1VPXA 4JTFA 1PDYA 4WVXA 2G50A 3WY1A 5CJ5A 1TPVA 2ZUNA 3W7LA 3M0HA 1F3WA 3IPWA 1WOBA 2CBUA 3GXDA 2NV1A 1KD0A 4GQ0A 1KC7A 1TPFA 1H7PA 3UNDA 3WLQA 3NYZA 4PRRA 1K9TA 4PCPA 1V3LA 3W6MA 4KPLA 2C16A 1SYTA 4GI4A 1VYRA 2DY3A 2Z7GA 3ABZA 4X61A 2XH0A 2PC4A 3W1TA 3M0LA 4PUNA 1E9IA 4RE4A 3TAOA 1XCFA 4Q4SA 1EGVA 3CPUA 4WZHA 2YPIA 5KFBA 2E9BA 1V79A 2FFCA 1RJQA 4ECUA 3CQHA 7ODCA 4MVAA 2Q8LA 3QY8A 1C90A 4EX4A 3VC5A 3OZYA 3ABQA 4LT9A 1AFSA 1K7EA 2E0PA 3G5EA 4ZBCA 1CGWA 4HTBA 3M47A 2YDSA 4N9EA 3NM1A 2UVWA 2WZTA 4LS1A 1QT1A 2DZBA 1NIUA 3CQJA 4FNUA 4QEHA 2BHYA 2X2GA 2BP1A 1WUFA 1IEQA 1SFTA 4IFOA 4YXGA 1JYNA 3Q8QB 2ANUA 4ERIA 3WDIA 4DEFA 4FO4A 3SZ8A 3BGGA 3F5KA 4IMCA 3DFTA 2ZIDA 4L64A 2EPLX 5CPQA 1EDTA 2TYSA 5H8PA 3NXFA 1O5XA 4XIMA 3FJ4A 3U5YA 3WKZA 4ERGA 3LLDA 1Q45A 4KETA 3L67A 3A22A 1F8MA 2E68A 2PDWA 1U5HA 3B40A 1TJPA 1Z8AA 1ADSA 4HCLA 4QM1A 8XIMA 1KM6A 1B3YA 1JUBA 2WJZA 2XIIA 2UY4A 4QNEA 5EMMA 5JBEA 2DQXA 3MMUA 2VA2A 5DXXA 2R82A 4ZMGA 5K3VA 1E6XM 4DJFC 1JL8A 3B9DA 5IBXC 4HVXA 2VD8A 4B5UA 4I7VA 2NW0A 1E0UA 1UD5A 5J5DA 3KOYA 4ZZ9A 3VKDA 5D38A 5BRQA 1DE6A 3ZVIA 1DJIA 3GNNA 1Y7VA 4WJEA 2C0HA 2EJ1A 2QJNA 4B15A 3H4BA 4GUFA 1R85A 1E9ZB 1OFRA 3WK0A 4HK5A 4JTUA 3T44A 1WDSA 4ZQCA 1WB0A 2WC7A 3APGA 3VZYA 4UTTC 3CPGA 3HQNA 3HG5A 4P7QA 3PZOA 3GXIA 4WKFA 4JD4A 3R8HA 3TOPA 4Z0JA 3JZEA 2EXOA 3RDKA 3FK4A 5XIAA 3W26A 4ZE5A 1UJQA 2Q01A 2YA2A 3GNXA 5CSUA 2ABAA 1XBYA 4IOTA 1Z89A 3VM7A 4AC1X 4F4ZA 2OGJA 5CPMA 4ZENA 5CLTA 5A6TC 1NF7A 4GVIA 3N2BA 3T07A 5A6LA 2W8LA 3KP1A 1KGWA 2WPGA 2VCBA 4KH2A 1W1A1 2CW6A 4DXXA 3SQLA 3M41A 3EPNA 3PP7A 3H26A 3UG8A 1PV8A 3LB0A 4NI8A 4EBEA 4OJYA 2E5CA 2DH2A 3SO7A 3GU9A 3GHTA 5A8MA 2QS8A 2VDHA 2PRHA 1A3XA 3MMDA 2CPUA 1S2UA 1ZTVA 4X22A 3WK1A 2J8TA 3DFHA 2NQHA 4GRSA 1RR2A 3LQLA 3VVGA 4AZGA 1E72M 2G8ZA 1J6OA 2ADAA 1E9YB 3EWWA 1YPXA 3NQ7A 3ABXA 3DAQA 4F4RA 4JL1A 1V6YA 2FPVA 3BANA 1SJBA 2CITA 2FPTA 2VOTA 3PPFA 1GW9A 1AD4A 2Z1BA 1XFCA 3B97A 4ZFCA 2ALDA 3E38A 4J3XA 3KE0A 3KL5A 3QHOA 2J47A 1BSIA 2HBVA 4HZ6A 7PTDA 3LUTA 1CYGA 1H60A 1K9EA 1VGAA 3OIHA 4W8LA 1KBBA 3HJEA 3GX9A 3L12A 1YXYA 1MQQA 4WD0A 1GHRA 3DH7A 2QCMA 5JIPA 4Y90A 5CGMA 3WL1A 1VR6A 4HYWA 2O9RA 2ZCGA 4JICA 5IHSA 3HFYA 4RK8A 1O95A 2OEMA 3GH4A 4DLMA 1K9DA 1XBZA 3NNTA 4YTUA 3W82A 2XISA 3ARPA 2GJPA 3B8SA 2XIQA 2CWXA 1A47A 1ALDA 5H8UA 1DL3A 3A21A 4ZOBA 3W73A 1PHQA 3MY9A 4KIRA 4FR6A 5LIUX 1QRQA 1JULA 4NJKA 1QVBA 1PKMA 1UQZA 1VBHA 3QV8A 5CPSA 3E2RA 1V03A 3TLLA 1UIOA 4QLLA 1SJCA 4Q44A 4EXBA 4DJFA 2BNJA 3W7GA 4K1GA 1NDZA 4GYPC 4YYFA 3NQDA 2QCDB 1ENUA 1ZBCA 2VEPA 2G96A 2BB0A 3W1PA 4C65A 1BSLA 1S5VA 2BWGA 4PMQA 5I3IA 3S6TA 3K46A 1QTWA 1UASA 3W6LA 1D7FA 2I5GA 3S1XA 2JQXA 1F5ZA 5D04C 2ZE0A 5AC6A 3QEZA 2XIJA 4S1FA 2XGPA 4AEOA 2DW7A 2P53A 1QPRA 2D22A 5KTLA 3MI6A 3ZVHB 3LK6A 3DFQA 3KLKA 1ME8A 2ISDA 2WSYA 4EXQA 4GX9A 4XZIA 4PZVA 1HIZA 3WH9A 3UWWA 4LYQA 4K3ZA 4L1WA 1IEVA 1TREA 1OCJA 1W0MA 3W9ZA 3GTXA 1HJSA 1O1ZA 2X0HA 4YU1A 3W01A 2J8GA 3QKZA 3N29A 1QAPA 1PL9A 4PH6A 1IEXA 1EB3A 3IIXA 2V68A 3GBDA 2V5LA 4P7NA 4PEEA 1E51A 2QMKA 3MUIA 4ZB2A 3SSZA 2NVAA 5ABFB 2O7SA 2P50A 4ZOCA 4BZYA 2CLPA 4E6MA 1S0NA 4DJDA 2RFGA 5TBOA 5BOOA 2FDMA 3W2KA 4MJ4A 4FZIA 4X9YA 3UR5A 2AGQA 4IH3A 3CUZA 4H7VA 5AOUA 2NV9A 4JXCA 5MKGA 1R86A 4ICMA 2PF0A 2WCGA 4M81A 3K2GA 3I3BA 5M5DA 1UZHA 3PANA 5HMDA 3CBWA 2QPSA 1UMYA 3AROA 1HXJA 3G1FA 1DOSA 2CLHA 4GNJA 4A3HA 1U83A 2NZLA 4H8VA 1ESWA 2XVPA 2ZUUA 3MI3A 4LWWA 1GVQA 5DCEA 1S2CA 2JFEX 1ZAHA 5KFRA 1UR1A 1G4SA 4LC8A 4BR1A 4IG2B 3KVKA 3P60A 4RXFA 4FK9A 2AQOA 3C2FA 4IIGA 2ZX7A 3B4UA 4HHHA 1M5WA 2PDPA 4O18A 3V1PA 4FF5A 3O06A 6CGTA 2A3LA 4H9UA 3I7SA 3UU0A 4CNOA 1R38A 3QZAA 4M3PA 3OTRA 5A8QA 3G18A 1WKEA 3M5XA 1KWGA 4DL4A 3LCIA 4MADA 4CKQA 1LRQA 3UA4A 3B4YA 3QTGA 4HMEA 6PTDA 4GI8A 2ZZ5A 1KGXA 3CZKA 3QN3A 3DZ1A 4BQ2A 4ES4A 2JGQA 4FPSA 3PG8A 1B3VA 5CBBA 4IT1A 4IRKA 3TC6A 4CGTA 3E9AA 3HJZA 4XQ6A 5KETA 5CPNA 2QV5A 1W9DM 5AYZA 4V1YA 1UUQA 5BRBA 3CWHA 3LENA 1Q3NA 2Z2UA 1MUWA 4PCNA 1R0MA 3R0UA 2FGLA 1MFUA 1RPKA 4O1FA 3W1MA 2XVKA 3GDKA 3R11A 3LTPA 1OD0A 3D5HA 3MSGA 1GEHA 3SN4A 1MW3A 3K1DA 1HFBA 4KIEA 4GCAA 1E4LA 3WLSA 5HATA 1D3CA 1QHZA 4XAGA 1EYEA 1F61A 3P82A 4IRDA 3FDSA 4DXVA 3AYSA 7A3HA 2DQWA 3ARRA 3C8NA 4CCCA 2V30A 3K30A 1UWAA 2WM1A 2VQTA 5KG2A 1X97A 5I0DA 5GPRA 1OCNA 5AB3A 4UFIA 5ECVA 4XAPA 1FP8A 2JKAA 4G1NA 3EOOA 3GDBA 2DEPA 1K1SA 4WY0B 3PK7A 2FQIA 3GB6A 4WHBA 4WDUA 3GLCA 3PJTA 4GGHA 2WCSA 2ZBTA 3UWUA 5FEXA 5AZ0A 3EB3A 4IIDA 1NDVA 1B3OA 3F2DA 1D8WA 3PJXA 4M6PA 3SRHA 1KA9F 3DG3A 4U28A 3VDHA 2V4RA 9XIAA 1R87A 2YKKA 5A6BD 4S38A 5E0FA 2HROA 5REQB 2QZRA 2PGWA 1E5NA 4PTNA 3FFSA 1VFLA 4F0HA 2W66A 2PDXA 4O12A 4U3AA 3V6JA 1NWRA 1F05A 1HGWA 3V16A 4HZ7A 4F0KA 3G22A 5DF0A 3CUIA 1SGJA 1RYSA 2OFJA 2XFFA 2CXEA 2W7OA 1RD6A 4Q8OA 2PP1A 2WWDA 5RUBA 2GWGA 4GABA 2J62A 2ZXDA 4WJXA 1U30A 3DESA 3KVMA 2BOGX 1EIXA 1EQPA 4GO8A 2EG7A 1B4EA 2XIOA 2O4QA 2GDQA 4Q4PA 4GMEA 3LGDA 4NF7A 5C7HA 3B0XA 3LS9A 3EEGA 5BXTA 1RVKA 3FJ6A 3W7EA 2C2DA 1NDYA 1ZBVA 3UZZA 3TH6A 4PB4A 1LQ0A 3APYA 2OWWA 4MJZA 1SJDA 5FJRA 1R3RA 1Q65A 1VFUA 3N6HA 1XLBA 1LUCB 5AYXA 3VDBA 2WMGA 2ZRZA 1M1BA 1YBQA 1A5AA 1CGUA 4DUOA 2CLMA 3CU2A 4CQ8A 3EA1A 4XVEA 5AVNA 4B91A 3FA3A 1JI1A 3BO9A 3QYQA 3UJFA 1V0NA 4QS6A 3RM4A 4Q7NA 5CLWA 1VHCA 4U33A 1K4GA 4J3UA 5FF4A 3F4NA 2FVMA 3ZYZA 2X7WA 2OH2A 4PUJA 3VC6A 3U5UA 1AL8A 3MW7A 2J24A 2ZOXA 3IUHA 3CYVA 3ME3A 3GW3A 3WH5A 1UH3A 4TVUA 4JTLA 9RUBA 4RR4A 3UG4A 1A0DA 1V77A 3OODA 5KFQA 1A0CA 4GZJA 2C6QA 4NASA 2D0FA 2IQTA 2EHHA 2QCCA 1VJSA 4JBRA 4O8RA 3C0SA 3K13A 4UFMA 2DORA 1AA1B 6TIMA 3PW0A 4N4PA 3HV8A 2ZRWA 2ISVA 3TEVA 4S2BA 4WR3A 5I2UA 5CSSA 1KWKA 2ZZ2A 1P0BA 4ECLA 5BZAA 4JS3A 1RD5A 4P61A 1D2KA 1XLLA 3NG3A 4AYSA 4H8HA 4HN8A 1R9XA 3PB2A 1W31A 3PF3A 2X1SA 3THAA 4UNLA 2JK2A 1EFZA 4GKLA 3W0KA 2XU2A 4GI9A 4BEUA 2D24A 1H7NA 1JEZA 3DU0A 3G1XA 4H9VA 2R14A 4C91A 4GUGA 2JKPA 4C60A 3H4WA 3TIMA 4Z1DA 1AJ2A 3ELFA 3WF3A 3QMTA 1OT2A 1GVIA 2ASLA 1HJXA 4E8DA 3GO2A 4D72A 4NJGA 3WQDA 2Z1WA 3AS1A 2OXNA 3PC0A 7ENLA 1QW7A 3F4DA 2CYGA 1XC4A 1S1RA 5DMMA 3BAKA 2ACQA 2ABBA 1VYPX 1UPMB 4ZVJA 1OADA 4JEQA 2VEIA 3GE7A 3CT7A 1U2YA 3TN4A 5HMFA 4L4LA 5I79A 1PZ1A 2TAAA 3M0KA 2WANA 3EWBX 2BQ3A 4AD5A 4W7VA 3WX7A 3S1VA 4X0NA 3CZJA 5JBFA 2BXVA 4UZSA 4UB9A 2GQ8A 2YL9A 1TA3B 2QHAA 4IPPA 1VCFA 5G5IA 4C6MA 3SIMA 3NGFA 4YWIA 3WQGA 4EACA 3SCUA 3GU1A 3UY8A 4EWJA 4UTIA 4JYEA 3N73A 3O16A 4QX4A 3AHTA 4PCFA 3WLJA 4D6HA 1MXGA 4NZFA 2WZEA 1MQPA 4IIHA 3OBEA 4U5KA 3F5JA 4I5UA 4LSBA 4PRWA 2X1IA 5FF3A 4L4OA 3Q65A 5EWEA 1UC4A 4NZ3A 1D9EA 3LCFA 3UZ5A 3KRUA 4MNJA 3NQVA 5E6ZA 1OBAA 3O3RA 4TR9A 1QI3A 3IJDA 4L5ZA 3DCPA 1TVNA 3RRAA 2J27A 1V6XA 2ZA1A 2A3CA 4AZ7A 3GFXA 2GGEA 2A6LA 4FP1A 3RITA 3R8RA 3PJWA 2R1NA 1AW5A 1CDGA 3IVSA 3LD5A 1IWPA 1MFVA 3DBPA 4AX7A 4JL2A 3MBDA 1RAKA 3NUKA 1RY8A 5DT5A 3FYOA 1Q6FA 3JR2A 2SFPA 4X60A 3S6DA 3N2OA 4XD6A 3VM5A 3SIZA 1CLVA 3RYSA 1R6WA 1FWFC 3H4XA 2FJUB 4JIQA 1VBUA 2W9AA 2G37A 2W9MA 5BW6A 4UFLA 1BYBA 5JH1A 2BTMA 2WSQA 3QSTA 3MYOA 5G1YA 2HEJA 3CAKA 4PE8A 4ZEPA 3UVIA 2EAWA 2PRMA 3HPFA 4LUSB 2VO5A 3T0CA 4B3LA 3UT0A 4C6PA 3U2OA 1KRMA 3B05A 2YCEA 3HQPA 4XSLA 3U6WA 2A0NA 1UP3A 1DQUA 3N15A 3TW6A 4ZTXA 4S23A 4HJFA 4F0MA 3BGAA 1YE4A 3KHRA 3BZJA 1KGUA 2ACRA 4QCEA 3FN9A 2VOMA 3NO1A 4UQDA 4E4PA 2J7BA 5L1KA 3QJAA 1HGYA 2XVGA 5CPTA 3KEHA 1VEOA 4A2RA 4FF7A 1KCKA 2BGQA 3CZLA 3EKLA 3BW4A 1I2PA 4U10A 2ZDSA 4WRHA 1NM9A 4HMDA 4MFEA 1TTIA 1A5CA 2PDMA 3RPTA 4O17A 3GG1A 2PLMA 2BZNA 2OODA 3VAVA 4UTWC 1UYQA 4HPGA 2EO7A 3ZLHA 1OFQA 2G41A 2ZX8A 3GG8A 5C9RA 3C5QA 4F4WA 1SU5A 1BXBA 3M7WA 1CX9A 3ANVA 2XPKA 3NQEA 4H1ZA 2QGHA 1RP8A 2AKZA 4RDWA 2UVVA 3BMWA 4YTRA 3G1AA 1YTKA 2DZXA 5G1MA 1DJHA 4KRTA 4MB3A 2OELA 5LSMA 4YL2A 1KCLA 4IFRA 1U1UA 1AZ2A 5KT7A 3E1F1 3OYXA 5G2WA 2G3IA 1UG6A 1H7WA 1RSCA 4QBXA 1H7XA 2QKFA 2YL5A 2AGKA 1RJRA 2VRQA 1TV5A 2VZTA 4MDOA 4Q8UA 1ME7A 4UTMA 1IXNA 1IEWA 1U5VA 1XICA 3HG3A 1QNVA 1TZ7A 3CTTA 1TMHA 4O3OA 1SM9A 3UZYA 4JKMA 3AICA 3A3HA 5BWFA 4QDMA 4LVAA 3UWVA 4R7OA 3N17A 2R1LA 5M1TA 3ARZA 2OLHA 5CGTA 3W00A 1J0YA 4O1BA 5CZJA 1LLOA 1WXJA 3P80A 4OZOA 3E2VA 2V3DA 4PMOA 1VD6A 4U3CA 4ZB0A 3W1RA 4IP7A 3JW7A 4MKVA 4O3SA 1H49A 4ZE4A 4GISA 1Q6DA 5AHFA 1I2OA 4NZ4A 1FHUA 2PD9A 2ZADA 1L9WA 2GUBA 4DUVA 3A13A 1TTQA 4QAIA 4J9LA 1JD7A 2D23A 2DSKA 4DXKA 3W87A 2ISWA 1P0KA 1KTBA 1VFSA 5KMYA 2R9RA 1P48A 3WF1A 1CGYA 1O68A 5D2XA 4PTXA 5ABTA 1M65A 3W02A 1ONEA 3AZSA 3G8RA 4GIRA 4UXDA 3BOFA 4GI6A 5IHRA 2F38A 2X0YA 4BWLA 3BAXA 1US0A 2W8KA 1UUMA 5C6MA 1QBBA 3LLXA 1OFEA 3A5VA 3F7JA 2Z25A 1GOKA 1ZL1A 2GDUA 2YB1A 5E6YA 3CH9A 1WNOA 1EX5A 5K4ZA 1LJYA 3A6OA 4JFSA 4O3PA 4FS9A 4NL1A 1P0NA 4NY2A 1R46A 3PN8A 3L4UA 4F79A 1AL7A 1T7LA 3OLIA 4E8GA 6TAAA 4A29A 1TB3A 2QF8A 3W1XA 2BV9A 3WJZA 1JG9A 4MYXA 3VK5A 1PTDA 3CT2A 1X96A 2PDQA 3URBA 4IJCA 2XGZA 3AIWA 4RZ6A 2BGSA 5EL1A 1XDLA 3CZEA 3AMCA 3PTKA 1VENA 2NVDA 4OBRA 3O0FA 3ITOA 4QWEA 3P5ZA 4N6EA 2YZ5A 3ZR4A 4DYJA 2V3GA 5C70A 4IMEA 4TTUA 2W27A 3N34A 1ZRQA 3I6EA 1H0GA 3Q4DA 3LCLA 5GVJA 5IXEA 4DBWA 1J2BA 2W6RA 4MMWA 3VIIA 5HNTA 1Q7MA 4PCSA 2P8CA 3TU9A 5FJTA 2XFYA 3QQWA 2O9TA 2PBGA 2J6VA 4G56A 4CN4A 3UWQA 2AU0A 3DGRA 3SCNA 2FDSA 2J7GA 2OYMA 5CBIA 3B3DA 3W7OA 3PTQA 5AC4A 3GQCA 4POCA 5KFYA 3TTSA 2CHOA 3REQA 2A7RA 1SSGA 3ANUA 1A5BA 1GQIA 3R79A 1LT8A 2EPOA 4JX5A 3W1AA 4JUZA 5CG0A 4HA3A 4CLMA 3LHVA 4JX6A 4O3RA 1OG6A 4TXEA 3RCNA 3BOLA 3ZO9A 2HJPA 4OV4A 2J7HA 1WZAA 3IIZA 1R3TA 2YCLB 4XK2A 3VIFA 4AW7A 2V5KA 1TZZA 3B04A 2ZYFA 3FDKA 3A64A 3GDLA 1HL9A 3MR2A 3SN0A 2R8JA 1EJRC 3UPBA 1W9PA 2WVSA 1LL4A 2ZDRA 1D7KA 4EK7A 2CHNA 3W2JA 4U7CA 2IKGA 3M07A 2NQZA 4Q4QA 1FH9A 1AVAA 2B7QA 1KXHA 4ECQA 1TV7A 3HG2A 1PBGA 4WGHA 5F4WA 3W29A 1JAEA 4ZQOA 4NAEB 3FKKA 4ED6A 1G4EA 1CXIA 2X30A 4H3DA 2BMBA 2WMFA 4CEXC 3RLUA 4R7WA 4NZ5A 4CCZA 5T9BG 3W1NA 3RUBL 1M53A 2BHUA 5G4EA 3LHTA 2REQB 1ZJHA 1H3GA 3NQFA 4K7VA 2NWRA 4PEKA 3LN3A 2Z6IA 3TR9A 4LW7A 1FWDC 3ERPA 2OR2A 3ARXA 1PIGA 1VLIA 1X6UA 2PP3A 4LOCA 3RM9A 4JTGA 1RCXB 4XKMA 1UD8A 3CASA 4ORMA 4UQEA 3NL6A 3VIOA 5DCBA 1M9HA 3G8EA 2QDGA 4PUDA 2GUUA 5JIWA 3GC2A 1Q2RA 3BSGA 2NXGA 5IFTA 3QHMA 4GZEA 3DHDA 1Y0EA 1HKKA 2XSAA 4JHOA 2IMRA 4ZO7A 4F9DA 5I3DA 3HZ3A 3GRIA 3WBYA 4KFOA 2Q09A 4AHOA 4DL5A 1OF8A 3VCCA 3LTYA 1K8ZA 1ZP3A 5KG0A 1EZ2A 2BDQA 3MSRA 1O66A 1FUYA 2C2EA 3AHZA 3C3UA 3KUMA 1TIWA 2CETA 4FEZA 4GC6A 2VC5A 3QZ6A 1UH4A 2VX7A 5CPOA 3M9OB 4KS0A 1BKHA 3OP2A 4JKLA 3AWNA 1BYAA 3D47A 3N14A 1NTHA 4L9YA 3W6YA 3GR4A 2A2IA 5CQ1A 5AC5A 1IXOA 1E0VA 4AG0A 1OIFA 1FY6A 3ZJKA 3DFNA 2BGNE 3TUUA 2DZVA 3N13A 2Y61A 4JOMA 1NF0A 4A3RA 2Q3OA 1VFHA 1J0ZA 2XZ7A 3E0VA 5F1UA 2VMFA 3KAOA 2PTWA 5LXEA 3FXYA 4HPJA 1FBAA 1FX6A 3ZT7A 5DRIA 5KG4A 4BQ4A 5JUMA 3GY1A 1F07A 2WHKA 3IVUA 2V5DA 2Z28A 1Q4WA 5D2VA 4WDTA 2W67A 4QE4A 1W3TA 5DRCA 5FF2A 4QE1A 7REQA 1OGGA 1ICSA 3W38A 3VGBA 2ZUMA 1KR0A 2H8XA 1XRTA 2NXHA 2FPYA 4B4FA 2W9BA 3NZQA 4O4WA 1H1NA 3NWRA 2PZNA 3GGMA 2C19A 2Z2AA 3HA1A 3WDPP 3VIKA 5G2HA 1J96A 2QVHA 3LRMA 4O1AA 3GAYA 4FOKA 4DM1A 4YYCA 4TQSA 1DEDA 4GIAA 1RJPA 5BOEA 2WJDA 4GLEA 4G1KA 3CMFA 2QJMA 2ZXQA 3A4AA 3PSWA 4ED8A 3VOGA 1FDYA 2Y7DA 2JALA 1UR4A 1EXPA 2WSPA 4IPJA 4H6EA 4QWDA 4TQTA 4UWMA 1Q7ZA 1FWGC 5FJIA 1PZ3A 3DFSA 4Z08A 4BI6A 3KHDA 3S5SA 1FHVA 2I9UA 3AIQA 4DQWA 4ONVA 4GQGA 1C29A 1BGGA 1DORA 5I6SA 1J4EA 1DJWA 1JZ6A 5AKQA 4TIMA 3BDKA 4N6FA 2YDRA 4US5A 5KFXA 3MJYA 4ZCWA 4UQBA 1E5JA 2PD5A 4ADUA 4C6LA 3IARA 3JS3A 4EF9A 3PUDA 4JIRA 2R24A 4AVNA 3SW6A 4JV2A 3GVQA 1JCMP 1IWAA 5DQGA 3EDDA 3S3GA 3HPZA 4DI8A 3CZGA 4DZ5A 4IZGA 1L6SA 2MUCA 4O0ZA 4RPPA 3VILA 5FEZA 2YA0A 3P67A 2O56A 2OMAA 2P5NA 3BAIA 5LNUA 1Q6RA 3MHUA 1QI0A 1UWQA 4FIRA 5C71A 3MUXA 5D09A 2C2RA 3PBYA 3OVRA 3M9MB 3P81A 3WEOA 3KS6A 4UTKA 1W9BM 4JFTA 4KWSA 1E3XA 2BY2A 3DYOA 1XR2A 4H9MA 4GPNA 1DIOA 3PM6A 3SGUA 3R94A 4CVUA 1A0EA 1B2YA 3OO2A 4MPQA 3EX6A 4L9XA 3FYYA 2C79A 3OIXA 2KAUC 2EPMX 4MJ2A 4AZIA 2VXNA 1W9VA 1UR8A 1WP6A 3R25A 4PTMA 3WQFA 1KM2A 4O0QA 1ISXA 1V0LA 1MDRA 3NSXA 4CUCA 3NM3A 5A6BA 4JQ3A 4HBKA 3WLRA 1RUSA 3N12A 1GG0A 1XW8A 3NGJA 3CUHA 1SPQA 4QJ3B 2E6YA 4K68A 4TV5A 4CU6A 2G4JA 1LRNA 3W7IA 1ICPA 3SCWA 2HDJA 1W37A 4GE8A 3ZXWA 3CPRA 1OINA 1FH8A 4R8UB 1L6YA 5EWFA 2QIIA 3S9IA 2WNWA 4EP8C 2A79A 1TWZA 4HSOA 5G2IA 4PB3A 3T7VA 3P14A 1ISVA 1C7SA 2UWFA 3SQMA 4YTSA 4IICA 5EB8A 3LNMA 4XAZA 5D9PA 4QNWA 3GDRA 2WPBA 3GFYA 3LU2A 1ITXA 1XQLA 3VUSA 5BOFA 3GWQA 2VRKA 5F2GA 2Y24A 3R6IA 4OKDA 3U2CA 3IUDA 1K77A 1KRAC 2PLKA 5D4YA 4O52A 2FZNA 5CGQA 3BSMA 2VVSA 4F0RA 2EG8A 2ZC8A 1J8VA 1V93A 4UOQA 3TN6A 2XN2A 1OD8A 3ITXA 1PZ0A 3NQBA 4JEJA 4Y9AA 1G4TA 2WJEA 4FNQA 1I2QA 2D2OA 3VTRA 3C61A 3CJPA 3P74A 4W4QA 2A7NA 3DHPA 1JZ8A 3GVWA 1S46A 3ZT5A 1EWDA 3TX9A 1AG1O 3UESA 1PO9A 5EDWA 4DAIA 1P0EA 4LNCA 1DTUA 1GYNA 3LOTA 4IGNA 3AYRA 1OK4A 5CAKA 4QW8A 5TAOA 1OIMA 4KQNA 1C8YA 2GJRA 5XINA 4KGJA 2VHLA 1P4CA 4DBUA 1GYMA 3RJXA 5HR7A 5A5WA 1EGZA 3AISA 1B1YA 4B16A 2E77A 3U48A 2C3ZA 4XD4A 5FSDC 3RAOA 3OZOA 3RLGA 2Y62A 3TJIA 4Z2LA 3P7YA 4IXHA 1TZ9A 1ZZMA 2C18A 4GZ7A 1PX8A 5KFFA 3W37A 5HNUA 2VI0A 4AFYA 4UUIA 1AMKA 4NG3A 4LAKA 5HXMA 3PPGA 1GONA 1ONXA 4B5VA 4AH7A 4NNAA 1QPOA 1ICQA 4WCJA 2NQLA 3HO8A 1P43A 1BXNA 3FLUA 2X0SA 3AALA 3VGFA 1HJWA 2WJFA 4IPIA 1M68A 4DYKA 1HUVA 2WNNA 3PPHA 3IN5A 2YL6A 1EJXC 3VABA 3T2QA 2OQHA 4S3AA 1O4UA 4PMJA 3ONBA 1ZAJA 1HVQA 2OEJA 1WKYA 3AYTA 3UR7A 3THQA 4Q3MA 2YR1A 1GVFA 1PKNA 2XH4A 1RALA 5E1QA 3SURA 3QHNA 3NVTA 1S2VA 3N4FA 1DJNA 4JQ4A 2E5BA 3LNPA 3RR4A 4DBEA 1PVNA 1IV8A 4PUKA 2XCAA 4NHVA 4NKCA 1UZ1A 1CXEA 1T5AA 3P6LA 1HL8A 1GJPA 3HGRA 4LB4A 3UD6A 4RW5A 1E70M 4UOZA 4RE0A 2OSWA 1Y65A 3T4CA 4IF2A 4PRTA 4PTWA 3MJMA 5KFPA 5DLFA 4IP5A 1CZ1A 1TQXA 3TN3A 4RU9A 5CC5A 1R9ZA 2FZ9A 4ADSA 3OBAA 1DXIA 3BW2A 3NSMA 2UBPC 5EKYA 4C1NB 2DSWA 1TWWA 2H8ZA 4HT3A 3WNMA 4G7EB 3BLEA 2PWDA 4M1BA 3A5FA 4Z2KA 1A80A 4M51A 2J79A 4V28A 2J6UA 2Q3RA 1ISZA 3CHFA 1EBGA 2WVUA 1QOXA 2PTDA 2GVEA 3EB4A 2ZICA 1BTCA 1UR0A 3W1UA 3ICJA 1Z9AA 5KFAA 2ISSA 3WNNA 3BLPX 3MKKA 5I03A 4LXFA 4J35A 4H9YA 1E6SM 4KEVA 1MEHA 3FW6A 3KTXA 1XJBA 4DF1A 2DSVA 3AC0A 2Z26A 4G9PA 4CU7A 1B3XA 3SGZA 1OX4B 3PAJA 5FL0A 1NJJA 2DVUA 1R7AA 5IDIA 3M5ZA 5HQMA 4LUYA 1UBPC 5DN1A 5ABHA 1RBAA 4UTHA 3M5VA 2VEKA 4DF2A 3LBMA 5HNRA 1T40A 1W3HA 4EEYA 2INFA 3EMZA 3GIPA 3F5LA 1XYBA 2PP0A 5DBUA 5CZKA 1XH1A 1SVDA 4MIMA 5FAGA 3UJEA 1GOIA 1BG4A 1L6FA 1XYLA 4ASTA 2RH9A 5B80A 1UW9A 2AL2A 3H7VA 5KFSA 3IIOA 2VP8A 4RL3A 4EPEC 2QVNA 1EEXA 3RB0A 1Z41A 2NVCA 5DANA 2QCNA 4QCFA 1TMQA 4FXRA 4M56A 2JKEA 1TX2A 3HGOA 1ODUA 1ZJBA 2J88A 2PI6A 5HA7A 3VMOA 1NAL1 1GNXA 4HNCA 4JFVA 1FWBC 1JYWA 1BTMA 2I5IA 4XVDA 4XSMA 3AJ7A 1WCGA 1DQWA 5LA1A 1H5YA 3EX1A 3AHXA 4BKNA 3QW4B 5FAJA 1AH3A 4GFSA 2ACUA 2W9CA 5LGXA 1ZAIA 2W4XA 1RXOB 2D69A 2VEMA 2ZVRA 1F73A 4XZMX 3SCTA 2G0WA 4FX8A 4UMAA 5HINA 4G2DA 5T91A 3ABOA 3WDQA 2BS9A 2W5FA 1A5NC 3QV9A 4QG8A 5CKSA 1S0MA 1Q63A 4J9SA 2EPKX 4U6PA 3UZJA 2ALRA 2CERA 2GYIA 2X05A 3V5OA 3HMJG 3JVAA 2YZRA 1TR1A 2GL5A 4AAJA 3QMSA 4L7ZA 4Q4MA 3KL3A 1NOWA 2QDDA 2F84A 5EMUA 2Y2WA 1K70A 1XIDA 3UW6A 1R3QA 1O5RA 3B0YA 4HSHA 1TPB1 3LMYA 4LVBA 4LY4A 4DL3A 1YDYA 1E3ZA 5F1VA 1UQYA 1BF2A 4JTKA 4AC7C 4GGBA 3RMEA 1TWIA 2NT1A 3NJ3A 1K7XA 3CK5A 2DZPA 2C8NA 1YTDA 2PPGA