1J6PA

Crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
407
structure length
407
Chain Sequence
b'HHMIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METAL-DEPENDENT HYDROLASE OF CYTOSINEDEMANIASE/CHLOROHYDROLA
publication title Crystal structure of Metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (TM0936) from Thermotoga maritima at 1.9 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 132
structure length 407
sequence length 407
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1j6pA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6pA02
3T1GA 4J5NA 2Z28A 1V79A 3NQBA 4RE0A 2R1NA 1I0DA 2Y1HA 4HA0A 4LAMA 3T81A 2I5GA 4MUPA 1UBPC 4YIWA 2Z7GA 3IACA 2IMRA 2Q09A 4JOMA 4C6PA 1M68A 3K2GA 1FWIC 1PO9A 2FVMA 1YMYA 4I6VA 1XWYA 1QW7A 3N2CA 3F2CA 4DLMA 1RK6A 3HPAA 3B0YA 1FWGC 2YB4A 2R1LA 1A5KC 4B92A 3RN6A 1RJRA 2I9UA 3DC8A 4ICMA 2R1KA 3TN6A 1A5NC 3GTHA 2FTWA 1WXYA 2AMXA 4DIAA 3ID7A 5FSEC 3IPWA 4C6OA 3FEQA 2HBVA 3UR2A 3NURA 4LCSA 3CS2A 4CQDA 2YXOA 4BKNA 4EPDC 3IV8A 2HNHA 3LSBA 1YBQB 1PSCA 4G7EB 1QXLA 4GY0A 3IGHX 1EJVC 2OQLA 4C65A 3CAKA 3MDWA 1R9XA 3PNZA 5HMDA 1I0BA 3WYZA 2VC5A 4DLFA 3O7UA 4CEUC 2VUNA 3EGJA 4EP8C 2VHLA 4C6DA 4H00A 3HTWA 3SFWA 4WHBA 3LU2A 3URAA 3RCMA 1K70A 3OJGA 4WGXA 4NG3A 2UZ9A 1EZ2A 4H01A 1XGEA 1HZYA 4C6MA 3GG7A 4HJWA 3DCPA 4B90A 5FSDC 1FWEC 4R7WA 4H9MA 3PAOA 4QS6A 5AKQA 4LH8A 3GUWA 4G2DA 4EPBC 2OGJA 4EPEC 3GGMA 3MKVA 1R9ZA 4H9TA 4LALA 4XD5A 3OOQA 4DI9A 2E25A 4CQBA 3UR5A 4ERIA 3ORWA 3MVIA 4C6QA 4HK6A 1EJUC 3URQA 2R1PA 3F2DA 2FTYA 4HK7A 3LSCA 4I6KA 4INFA 1GKQA 4GY1A 2A3LA 1JGMA 3GU2A 4C6BA 3MPGA 4J35A 4QRNA 4LCQA 4R88A 4RZBA 1J6PA 1E9YB 3IARA 1EJXC 1EJTC 4KF1A 4IGMA 1GKRA 2VR2A 4IG2A 1EJRC 3KM8A 4PE8A 3FDKA 3AUOA 4RDYA 4DI8A 2OB3A 3GIPA 2RAGA 3UPMA 1A4MA 1M7JA 3S2LA 2OODA 1J79A 4NP7A 3OVGA 4C6JA 4CNSA 4DO7A 3ISIX 4XAGA 2OOFA 2PUZA 4L6DA 2D2GA 1FWCC 4C6KA 1ADDA 4IFKB 4KEUA 1UIOA 1V77A 4F0RA 4UBPC 2Q01A 4GOAA 3QGAC 4IFRA 3PNUA 1XRFA 3E2VA 4H9XA 2Z00A 2GWNA 2AQVA 2Z26A 2DVUA 3G77A 2BB0A 1YBQA 2ADAA 1M65A 2EG8A 1S3TC 1P6BA 1A5MC 2XIOA 3AU2A 4GZ7A 3AU6A 3OODA 3CJPA 1POKA 1K1DA 4LAOA 3GRIA 4BJHA 4HK5A 4XAFA 3HM7A 2Z27A 1FWFC 4PCNA 3F4CA 4XD4A 4ERAA 4GC3A 4H9ZA 4UB9A 3QGKC 1ITQA 4PCPA 1UIPA 4IGNA 2VC7A 4NI8A 4KERA 3V7PA 1V51A 1KRMA 2WM1A 3B0XA 2QT3A 3FDGA 4D8LA 3S2NA 3LY0A 3MTWA 2HPIA 3PBMA 3WZ0E 4C6IA 4KQNA 4R85A 4GX9A 3R0DA 4GX8A 3UF9A 4GK8A 4RDZA 4RDWA 4XD6A 4B91A 4Z42C 4PBFA 4QTGA 3MSRA 2HQAA 2FFIA 4GY7A 3MDUA 4CNTA 3C86A 4ZSUA 3E38A 2G3FA 2WJDA 2ANUA 4QSFA 2HBXA 3E74A 3LS9A 1EF2A 3A3XA 3E3HA 3OU8A 4IH3A 4PBEA 1NDWA 1EYWA 1YNYA 1V4YA 4LEFA 4XAYA 1A4LA 1FKXA 1KRCC 3URNA 4XD3A 2WJFA 4GXWA 2KAUC 4C60A 3ITCA 1YIXA 3QY8A 2Z4GA 5A6TC 1POJA 3BE7A 4CNUA 3OQEA 4ZSTA 2ICSA 4DNMA 1IE7C 1NDZA 3PANA 4IFKA 3T8LA 4C6EA 3MVTA 4GBDA 1PB0A 1ONXA 3S2MA 4H9VA 4IFOA 4M51A 2WJEA 3B40A 2Z2AA 4IF2A 5HMFA 1ITUA 4KESA 3GTIA 2GWGA 3WMLA 2Z2BA 4V1YA 4E3TA 4DZHA 1EJSC 4LCRA 3QY6A 1NDVA 2Z25A 3GTXA 4DZIA 4EPKA 4DYKA 4C5YA 2P50A 2PGFA 1RA0A 1RJQA 1RK5A 5HMEA 4V1XA 3RHGA 4CQCA 1V7AA 2UBPC 3E0LA 2PGRA 3GU9A 1FWDC 4G7EA 1E9ZB 1ONWA 3JZEA 3DUGA 2R1MA 3MJMA 4H9UA 1NFGA 2ZC1A 3S2JA 4IG2B 4WVXA 2O4MA 1R9YA 3GIQA 1FWJC 4RDVA 4F0LA 2FVKA 3EWCA 1KRBC 2F6KA 1J6OA 4C6CA 2GZXA 2DVTA 1EJWC 4ERGA 2D2JA 2P9BA 3E0FA 4AC7C 3LGGA 4F0SA 1RA5A 3GU1A 3LNPA 5LXXA 4GYFA 2QPXA 2QS8A 1P1MA 3A4JA 2YZ5A 2GOKA 4QROA 1ZZMA 3O0FA 4QS5A 2P53A 4KEZA 4OFCA 4LANA 1KCXA 2GSEA 3URBA 3IJ6A 3IRSA 4P5UA 4L9XA 3TN5A 4B3ZA 3F2BA 4XAZA 1BF6A 1P6CA 1WXZA 3TN3A 3D6NA 3F4DA 5E5CA 1UMLA 2DVXA 4KIRA 1FKWA 5G4HC 1O12A 2HPMA 1YRRA 2Z29A 4CEXC 3SO7A 3LA4A 4C6FA 2YB1A 4LAKA 4C6NA 1XRTA 4C5ZA 3QY7A 2O4QA 3LGDA 3TN4A 2E1WA 3K4WA 4H9YA 3EWDA 3ICJA 2PAJA 4IQJA 4TQTA 2W9MA 1RAKA 1RJPA 4KEVA 4C6LA 1FWAC 5CH9A 3RYSA 3K5XA 1NDYA 1PTAA 4BY3A 1J5SA 2QVNA 1DPMA 2BGNE 1FWHC 4LFYA 2PLMA 1O5RA 1A5OC 2AQOA 3UBPC 1VFLA 2Z24A 3TNBA 2D2HA 1GKPA 2EG6A 2VM8A 3S4TA 1FWBC 1KRAC 1K6WA 1W1IE 3A3WA 2CZVA 4J2MA 3NEHA 1A5LC 4AQLA 2EG7A 4KETA 3GTFA
chains in the Genus database with same CATH superfamily
4ECSA 1CLKA 3PHAA 3LYEA 4O3PA 1ZENA 3KBJA 4GH1A 3T07A 1QOPA 2JEFA 5SWUA 4QWCA 4PMVA 4H2HA 4LB4A 4TVCA 3BC9A 5JBDA 3G8RA 4B5UA 1PO9A 4NJHA 2VKZG 4KEMA 4W84A 4F40A 2ZUUA 2QZRA 3PS7A 3UPWA 5I0DA 3VE7A 4IWWA 2XH0A 3N4AA 1WKYA 4U2YA 2E5DA 1UP0A 5DFAA 1ZBKA 2AMXA 3T40A 5M03A 2A6NA 1EHNA 1MEHA 3UVIA 1KXVA 3LCLA 4F9JA 4ZQNA 1DJNA 5KG5A 5LHFA 2DPIA 4BKNA 3FJLA 4FLQA 4PFHA 3UCCA 3U7VA 4DL6A 1GPWA 3H24A 3CT7A 1QPOA 2EBNA 3DH7A 2PBOA 3IGHX 4FNUA 1WUFA 2WB5A 3UA4A 4CU6A 3D47A 3EGJA 4LC6A 1LDCA 5D33A 1VEOA 1OSEA 1NOWA 4O0QA 1US2A 1VBJA 1XGEA 4C6MA 3FK4A 4WIWA 3S46A 1H60A 4IMAA 1CI1A 2BVDA 5FSDC 2GVJA 2HE8A 2PDLA 3QTGA 4H9MA 3FKRA 1Q2SA 1J96A 4QS6A 4JN7A 4RNFA 1J8VA 4S39A 5FOOA 1DJQA 5FCZA 2C2RA 4NX0A 1NWSA 2NQZA 4NT0A 3S1WA 3AYTA 4G3IA 2Y0FA 4O11A 3L66A 4J9QA 5DELA 1YDYA 3OZMA 2P3EA 3QOKA 3EPMA 1Z3NA 3WL0A 3BLFA 3FSTA 1TJ0A 4JNYA 4O53A 4NNBA 3WD2A 4LTSA 1GQNA 4E2BA 1CB7B 4HT3A 3MPGA 4IISA 1E43A 1EJXC 1S2TA 2VTFA 2YL8A 3CZ8A 3NPUA 4IGSA 4Z2LA 4YPJA 3FDKA 1CT5A 2ZUVA 1EUNA 4GI9A 5ABFB 1QUMA 4XTIA 5C70A 1F8MA 1A4MA 2DZPA 4XIMA 1OK6A 4AY7A 3FW6A 4DL4A 1WE5A 2OOFA 2PLCA 4HMDA 5EMUA 1UWAA 1XIEA 3MP5A 1SMAA 1YXCA 4IMGA 4XG1A 3P62A 1UP2A 3NO1A 3QPYA 1ZCCA 4MJMA 3P81A 1SVDA 5DMNA 4DBSA 3QV6A 3V35A 4A6GA 3TTSA 5JIPA 3QBUA 4MM1A 3PZTA 5ABEA 3KBVA 1TTQA 3CM4A 3H4BA 2YGYA 3MWCA 1HUVA 4B5WA 5ABTA 3EDEA 1O94A 5DT5A 3TV8A 1EDTA 3NFUA 1JCLA 2WSPA 4Q33A 1DWJM 2ZKMX 1VJSA 3O06A 1EC7A 1F2JA 2PP1A 4QQUA 3OO2A 1H7RA 2ZA3A 1DOSA 4FS9A 5C9XA 1PKMA 3P3BA 5L6UA 1O66A 1VBGA 3W25A 1JI2A 4Z42C 1E73M 3M0HA 4QTGA 1B9ZA 4PYSA 3LHVA 4PUWA 4H8VA 4O10A 4CNTA 4N9EA 2PFHA 1JCNA 1U1JA 3SQMA 4E8DA 1WNOA 1CLXA 2HBXA 1EF2A 1J11A 1ZJHA 5LGXA 3GNDA 3TIMA 1L6SA 2EQDA 4ES4A 1KGXA 4KKXA 4LVDA 5AECA 4K36A 5A6TC 5DG7A 1TPUA 4IX2A 4JTHA 4O4VA 1E4NA 1S46A 5C7VA 1X6NA 5FL0A 1AQMA 3PANA 3OGSA 4JFVA 2ZRYA 3MVTA 3T4CA 2IPWA 1DIKA 3SCSA 2P10A 4XUGA 3PSVA 2WJEA 3H54A 1ZJAA 1XLAA 2QCGA 2D3LA 3PUOA 2TYSA 1Z6KA 1F7BA 3NQDA 4IIDA 3UFYA 3VKKA 1MXSA 3N2BA 4MPKA 3LCHA 1FH7A 4EBEA 1RJQA 1CDGA 5HMEA 3AMGA 3W26A 4HP5A 5A5WA 3T2PA 3DUGA 4UR8A 5D9OA 2O4MA 2ASJA 3GIQA 4HOXA 3I3BA 3AXHA 5JIWA 3TLQA 3TYAA 4YTTA 2D2JA 3CV2A 2G37A 4ATWA 2GPTA 4Q43A 2F6XA 4RNNA 3QVQA 2CNCA 3WD1A 4QROA 5A8PA 1TTJA 2G3NA 1FX6A 3B9EA 4D72A 3BG9A 5LXEA 5A6BD 2P76A 2QGHA 4UNLA 4BWLC 2E6YA 2JE8A 4K1GA 4DAIA 4AZGA 4JTJA 1K6AA 3CPGA 1P43A 1D2KA 3EOLA 2ISDA 3THAA 2BY0A 1GW1A 1XRTA 2F7FA 4J1OA 4UMAA 1DE5A 2C14A 3B0VC 1W8SA 3WELA 3LXAA 3K4WA 3B9OA 4GLEA 2VEMA 2PAJA 2FPVA 5U7SA 2FLPA 3NQVA 3QYSA 3K30A 3OLEA 1FOBA 3UWZA 2XU2A 4RNHA 2XIIA 2W9AA 2HS6A 5A69A 3N2MA 1EWEA 2J13A 2A3BA 3H4WA 4ROPA 4YCPA 2WTFA 1N2VA 3JS3A 1T8QA 2PLJA 1ZAIA 3LZ5A 1VFLA 2D2HA 3WQEA 3ZZ1A 2GQAA 3S1GA 4W87A 2AQWA 3N9SA 1S10A 2J6TA 1C93A 1DIOA 1F8IA 3H2MA 1ZBCA 2TSYA 1OX4A 3VDHA 3GG0A 5EA9A 3SQLA 4ED7A 3ZJ7A 2RDUA 4Z0SA 2R1NA 1GJPA 3PJWA 2OEJA 2ZZ5A 1DWFM 2Y1HA 4HA0A 1M7PA 1TJRA 3CYVA 4JTGA 4K37A 2Z7GA 4PBGA 1QU4A 2J9XA 3TNOA 2BG5A 2D0HA 4UTWC 2Q09A 2WKGA 3W7GA 3W37A 1XIDA 1YMYA 2CEQA 5IM51 3WJWA 4J9JA 5DQGA 1QW7A 3N2CA 5CLTA 3HMCA 4HZ6A 4YYCA 3HOJA 1DE6A 1UQYA 4NZJA 4KRUA 2FQIA 3MR6A 3I7QA 1K4HA 2QW5A 3GTHA 3PWIA 1SU5A 1EF3A 3WNLA 4JN8A 3NURA 1DL3A 3EA2A 3PR2A 3FY1A 1EFZA 1YKWA 2VFIA 3M4HA 2H9AB 2BV9A 4IHCA 1LWHA 4PRRA 1MQPA 2YLLA 4N2YA 3SIZA 3N4EA 3MDWA 3S9IA 3LHYA 4MIMA 4IT1A 2OZTA 1KFJA 4AU0A 1OT1A 3WNOA 3EXSA 3OGRA 1S2VA 2RHGA 3T08A 5KZDA 3VDAA 1TR9A 1KTCA 4NASA 1KFKA 3NGJA 4JBRA 2TMDA 2VDIA 3GXFA 4QG9A 5KT2A 1YXYA 3AIUA 2P3ZA 4TVDA 2ZZ4A 4M82A 3MZ2A 4WEVX 4EPBC 1XCXA 4ZQPA 5LA1A 1XLGA 4ICCX 1DJHA 4ZGYA 3T5KA 5AYXA 3BH4A 5GNYA 2OSWA 5C0QA 3LNMA 3HPSA 3BW2A 1WAWA 4MWAC 1CXIA 4GC4A 1BGGA 4M6QA 4IIHA 5D05A 1QPQA 4RXFA 4GJJA 1JX4A 5C55A 2PC8A 4TX6A 5FJOA 3NCOA 2ZRWA 1KM3A 1V6YA 4ZTYA 1Q4NX 3W7RA 2J74A 4M1RA 4RNIA 2INEA 1J79A 3TQPA 4MWAD 4DO7A 3TJLA 3LERA 1AUSL 4L6DA 2PCEA 2R8WA 2DIJA 1S5MA 4S2BA 1ISXA 3T55A 4JIPA 3WLJA 3CLWA 4FS1A 4YP3A 4LW7A 1VBHA 2WJZA 4H9XA 2ONEA 3UZYA 2Z26A 1B3YA 3FLUA 4ED0A 3G77A 4DXKA 3VM7A 2Z1BA 1VLWA 4J3SA 1F9CA 3ME3A 2PDBA 3F5LA 3UGVA 5HUOA 1P6BA 1B57A 3PW5A 1E71M 3AS0A 3FGCB 4AD3A 1K1DA 1G7UA 2VEKA 1Q6CA 5LIYX 3OVPA 5AHFA 1FWFC 3AIRA 5IHSA 3R10A 5I3JA 2FJKA 3L2IA 1XQLA 4GC3A 4JY8A 3WIJA 3GKAA 1JDCA 3QGKC 1T96A 4NUWA 4RUCA 1KKOA 2RGLA 2ON3A 4PMZA 1ZUAX 4D6FA 3BJFA 2W9CA 4QX4A 3BLKA 1E3ZA 4XQ6A 4YR0A 3NQ6A 2D22A 1MFUA 3W1QA 5KFRA 3RX2A 1W1TA 1OFEA 4LQ1A 4PTVA 2BVYA 2FFIA 5C5JA 3HQNA 5KG6A 4A8IA 3E38A 1I6NA 2OFJA 4PGLA 2VC9A 1TPWA 1NDWA 1EX1A 3HJEA 4P8VA 5EL1A 2X2YA 2EPNA 4REQB 2DT3A 3RFAA 3WDQA 1AMKA 2KAUC 1H7OA 1XM3A 1XKYA 3EX6A 1XBVA 3NL5A 4RV3A 2JKPA 4ECZA 2DV0A 1JF5A 3I4KA 4UXDA 3TZFA 3U5UA 5DCEA 5HWNA 4HPXA 1DQXA 5EKYA 3AHZA 3SI9A 3T42A 3OBKA 3QC3A 4YU1A 1XDJA 3DYOA 3IIVA 1LCOA 3TONA 2WMKA 3A13A 2V81A 3VI2A 1JXLA 2JEJA 2I1OA 2G0WA 3H2OA 4AZ6A 3WEOA 3SSJA 1R30A 4L5ZA 4Z2KA 4UNKA 1UROA 2ZUSA 4J3ZA 4LUTB 1FWDC 4F8XA 1ONWA 4P2VA 1TV8A 3S2JA 4XAPA 4L1WA 1U1UA 3W1TA 3OGVA 1J6OA 3RU8X 4YYFA 5D09A 4AC7C 4FNQA 4N9CA 1IXQA 4HMNA 1UD3A 2E40A 5LXXA 4JKLA 1C3FA 1SR0A 2I16A 3A4JA 3ARWA 4F4YA 5C9RA 3GFZA 1Q85A 4FXFA 1TG7A 3VCRA 2GSEA 1K1QA 4AHQA 1TJ2A 2WNQA 1SO6A 3WBYA 1FBAA 1JG9A 1FCQA 1MZHA 2WO5A 1UMLA 4FNPA 3QHOA 4Q44A 2HISA 3AS2A 1QHOA 1IXNA 4UQBA 5I06A 2BZNA 4HU8A 2ZX6A 4J9PA 5DBTA 2YL9A 4LAKA 4C5ZA 2WNWA 3TN4A 4MYAA 5E0KA 1Y5XA 3BCFA 4M0XA 3PTMA 3UR8A 1ZJIA 2GJXB 3RLHA 3QJAA 2X30A 4CCZA 3ANUA 1EA9C 4CCEA 5HA7A 1UZ4A 3PZQA 3VA8A 2W6RA 1ICPA 4PFMA 3VIOA 4UWMA 3M6DA 1A5OC 2ZZ3A 3ZFHA 3PZUA 2VM8A 3UWVA 1FWBC 5BWAA 5JH1A 2J7CA 4IR1A 2X05A 3ES8A 4FB7A 1SGJA 3NEHA 1DVJA 1ZLPA 3O1NA 3UYIA 3VINA 3D3AA 5DRIA 4U10A 3DFSA 2R6OA 5EMMA 1V79A 3NQBA 1R3VA 2G3MA 2ZXAA 1I1XA 2DZBA 3VIHA 1WZAA 3IUDA 3NQCA 3W1LA 1XW8A 4YTUA 2IMRA 3ZLHA 2PPGA 2DUZA 1JCMP 3SRDA 3UD6A 2PLKA 1SJAA 2VZOA 4V27A 1XC4A 3E5BA 1TV5A 2VA3A 3B0YA 3GXNA 4Q22A 3FVDA 1XF0A 4JS3A 1WP6A 3WLOA 4YTRA 4TQSA 1IEXA 5A2CA 5DRCA 3EWZA 2IPFA 3I10A 4JTLA 2VFGA 3MMTA 3I6RA 4U5IA 2AKZA 1GWJA 3WK0A 1EL3A 1LT8A 4ZB5A 1GUVA 2XGPA 2AGPA 2CYGA 3BLPX 3WH9A 3AS1A 3PR4A 2E6AA 3CPRA 1IEVA 1OX6A 2V5CA 4AD5A 2CBJA 2X0SA 3A6OA 4RUAA 4DPPA 1UJPA 2HVNA 3TU9A 1GVIA 3E6EA 4IMEA 1KV8A 4DM2A 3LU2A 3URAA 4M6UA 3RCMA 5H8PA 2X40A 3MCNA 2IXUA 1XLCA 2WAGA 3DBNA 1W6TA 2EPLX 3CAVA 3TSBA 1K9DA 3MWAA 1BHGA 2XCPA 2XN1A 3R8GA 4JTRA 3GGMA 1XIMA 3U7BA 3FFSA 1P0BA 1Q6OA 4HK6A 5C6MA 1OGSA 1GOKA 1N8WA 3BOXA 4J3TA 1Q6DA 4L4LA 5JUVA 1I75A 4LSBA 5A95A 8XIMA 5HR6A 3QMSA 2HJPA 1FRBA 2UVRA 3L0NA 1CX9A 4HU3A 4EXAA 1PX3A 2VX5A 1J6PA 1TVNA 4IGMA 4M7TA 4ML9A 4ECYA 4J2PA 2FB3A 3BQ2A 3P82A 3W2LA 5AC8A 4N6FA 1GEQA 1VYPX 2PUZA 1MQQA 1FWCC 4Z0JA 5CQ1A 2GVYA 2ALDA 3LCWA 3W1XA 2Y8UA 3VUSA 1OC6A 4DUOA 4FO4A 4QWAA 2AQVA 1JUEA 4ZTXA 4W5UA 2JGYA 4Q8FA 2BNJA 4WSKA 4RZRA 2PWFA 1O6IA 4HYVA 1T7LA 3SCOA 5JMUA 5CSRA 3AU2A 3NPXA 3L21A 3CJPA 3DFOA 4LAOA 4JIEA 3GRIA 3VOJA 4B4HA 4M29A 2XH4A 1RYRA 4D8AA 2BFGA 3A23A 3C3NA 4DXVA 2Z7KA 2PE4A 1TMQA 5KT3A 3E1F1 4ERAA 3PZPA 3VD9A 4H9ZA 3VIKA 4AEEA 5A6BA 4GVGA 4ECQA 4AX7A 3W86A 2W3ZA 3M0JA 3MTWA 3PBMA 3HJZA 3TYDA 1LBMA 3KVMA 5AHIA 4AW7A 1MNZA 1WDPA 1VEPA 3VNKA 1GVFA 1HJUA 2HTMA 4O54A 4NAEB 3R8HA 4PB3A 2OWCA 3L0GA 3TC7A 1O1ZA 1ZNNA 2GGGA 1NWRA 3APGA 4BZYA 3LS9A 2YSWA 4L1GA 3EXTA 1B3OA 1TFVA 1X1NA 2XUCA 3N25A 3HMJG 3C2RA 3CO4A 4HPNA 2WXDM 4RU9A 2PWDA 3K4DA 3C52A 5FJIA 4AEFA 1EXBA 3GAYA 5IBXA 2HCVA 2HVMA 4RR4A 1QHZA 3AROA 1WKDA 4RNOA 1QRQA 2VZTA 5FF4A 5KFJA 5AN7A 3MSDA 4F4WA 3AZSA 4RCXA 2XVGA 3PR5B 4HZ7A 3L2MA 1LLOA 1XGZA 4O1BA 3SQSA 3W2NA 1KW1A 2YCLB 1EEPA 2UY5A 3THCA 4UMCA 4FNSA 4EPKA 4QJ1A 2C22A 4C5YA 4OGZA 1BYBA 2O56A 2CLMA 1LL4A 4HMEA 4J9RA 1RA0A 3S8HA 1OFRA 1T5AA 1RK5A 3RHGA 4CQ8A 2RJGA 3W88A 4A35A 3GUGA 1H1YA 2PGRA 2QJNA 4S2CA 1JZ4A 3MJMA 3N15A 3Q8PB 3KE0A 2DDXA 3TP4A 1NWUA 1K4GA 4N9BA 1HKVA 3A9IA 5KZMA 4PR4A 1EJWC 2W9BB 1BYCA 1JL8A 1TMHA 3HG4A 5CG7A 3EX3A 2X0YA 3BV4A 1AJ0A 1HT6A 4LAZA 3AIVA 3TJIA 4ADTA 2C2DA 3WD3A 5BOFA 5I3FA 1ZZMA 5LYRA 2VGGA 2BSLA 4ZOBA 2VMFA 4I3GA 1H2JA 2QCEA 1XS2A 5BXPA 7CGTA 2ZE3A 1M6JA 4L9XA 3KAOA 1RH9A 2QULA 3O8AA 4PTNA 3F1QA 4YS1A 2CFFA 3KOXA 2ZX5A 5CPOA 1R5YA 2VURA 3DXIA 2HPMA 4D6IA 5CBIA 3WF1A 1QR7A 1TE6A 4ILSA 1UZ1A 1BWVA 1JAEA 2DQWA 2HXUA 4HTYA 3ZJ8A 3OB8A 5CJ5A 4E2OA 1HKMA 4ZO7A 2PRLA 3EZ4A 5CZKA 3A21A 3LRMA 1TQJA 4OTKA 1OGGA 4D8ZA 4DNHA 3DZ1A 5I23A 4H19A 3W2KA 1F6KA 3U2OA 1TQXA 5D2YA 1V3IA 3QEZA 4POCA 1YHTA 4AZ7A 3S4TA 5LA0A 4PMRA 3A3WA 1QNRA 2C91A 3CUXA 4I8DA 4ZFCA 2J77A 2BS9A 4ZMGA 2QCDB 4AQLA 1CECA 4Q7IA 1FFQA 3FHAA 4Z2JA 1KFWA 2PMQA 1CXLA 4ZE4A 4BI7A 2ASHA 3AI0A 2DZAA 3CAWA 3UERA 2ZRVA 1E4LA 4W85A 4ZB0A 3RPDA 3EDFA 1EB3A 4MNKA 2HSAA 3NZGA 1NU5A 3NQ7A 2VELA 4B5NA 4NJKA 4GFIA 5BRBA 3NQ2A 1UUQA 1ISWA 2NX1A 4GYPA 1P6WA 1RJRA 4LT9A 1JYWA 4QE1A 3TSDA 1U33A 4QQ3A 4I5UA 2VEFA 4IL2A 2NQ5A 3UR2A 3A3HA 8A3HA 3ATYA 4HA3A 3E2QA 1AZ2A 5AY7A 3B05A 3F5JA 3LSBA 1D9EA 3LD5A 4ICNA 1O1HA 1JD7A 3U0HA 2XFYA 1EJVC 5TAOA 2YBTA 3PFRA 3PNZA 4GISA 3WEZA 4JFSA 3KHGA 1ODUA 4K2SA 1BF2A 2PB1A 1MW2A 4ZO9A 4WHBA 4EXBA 2ATSA 4LV4A 4IQLA 1K70A 3OJGA 4DBUA 4L6OA 4ADSA 4IUOA 4YCOA 3UVAA 3M7WA 5E93A 2Y7GA 4IPNB 4HYWA 4TOQA 4PMUA 3IV3A 2NWSA 3DERA 3R1ZA 1LROA 4GNJA 4KPLA 4DI9A 3QZ6A 3UR5A 7ODCA 4ECVA 1EIXA 1MEIA 3PZIA 1JYXA 3G18A 2VNCA 3LHWA 3SY5A 4MUZA 3LSCA 3KOFA 2V8ZA 1GKQA 2FZNA 3L5MA 3GU2A 1QJWA 1XIIA 3GC2A 1B31A 2EPKX 5DGAA 3VK5A 2CLLA 3CK5A 1Z9AA 1X6UA 1XIJA 4UFHA 1MRQA 3FYYA 3KXQA 3IK2A 4ZVJA 1TZ9A 3HG3A 4AWSA 4B9ZA 4DUWA 3AALA 1Q6LA 1XFCA 1E6XM 3CHDA 4KEUA 3GIJA 3O9NA 1C8QA 2P1FA 3P6LA 3W24A 4GOAA 4PTMA 3NYDA 3OYXA 4B5VA 5G1YA 2WBGA 1TZZA 1QWGA 3JUGA 1PHQA 3Q4DA 5EDWA 3FKKA 4E0CA 3CWHA 5G2HA 2ADAA 3CHEA 3WBAA 4US5D 3SUSA 1A5SA 2QMJA 1S3TC 2W27A 4GI8A 2XIOA 3OODA 5BXRA 1PX8A 3HGRA 2XFRA 4FR1A 3NVDA 2UVWA 1REQA 2W66A 5KFAA 2SFPA 1VCGA 4QNWA 1ZJBA 4JCLA 4UB9A 2JGQA 4LOCA 2ZZ6A 4OHQA 1TTPA 1UD5A 3R6IA 4FPSA 1UR0A 2ZXQA 4IGNA 5KETA 1LT7A 1TV7A 1KGWA 2HV5A 2Y24A 3BG5A 2QT3A 3H12A 1RCXB 2BXYA 4ZA0A 3P0WA 1Y8BA 2VZUA 4IP7A 2NVCA 4IQEA 4QHRA 3W70A 3S5ZA 4XD6A 3N19B 3VGDA 5BU9A 1ZHAA 3T8QA 1ISYA 1AG1O 3W71A 1E5JA 3TYEA 1IR1A 5HNUA 4RW3A 4A3HA 1XBXA 3UG4A 2RH9A 1XSIA 3NNTA 1RY0A 3OU8A 3AWOA 4E38A 2POTA 3BWWA 4AZ5A 3SZ8A 5F4XA 5C2GA 3SY1A 1K8ZA 4BQ3A 1OG0A 3URNA 2WJFA 4N42A 2IPGA 5BYWA 3IIZA 4C60A 2H8XA 1RLDA 5C5YA 2GOUA 3MYPA 2OU4A 2DSKA 1ICSA 2RKXA 1SSGA 3MP3A 3QR1A 5KG1A 1BLIA 4CQ9A 3L4YA 2DGAA 8CGTA 1S2WA 4S3DA 2Z1WA 1Q8JA 1VRDA 4AD4A 4QG6A 1QI2A 5JBFA 5L1JA 2ACRA 1VBUA 1R3YA 4F2BA 3RRXA 3LCFA 5AC5A 3VIPA 3FJ4A 3TQ0A 1OD0A 1W1VA 3ARTA 1PKNA 3R2GA 3L7RA 3RAOA 2QDEA 5K9DA 1BXNA 4RL3A 3MMWA 3C2FA 4H8HA 4NYYA 3GHSA 5KFOA 1YQ2A 2OT1A 5F1VA 1V5XA 2DQXA 2ZZ2A 2ZFAA 4JUZA 1R3SA 1Z8AA 1L0PA 2QPUA 2CLPA 3QFEA 3CLMA 1UR3M 3Q8RB 3VFLA 1DQWA 3WDPP 1VRXA 4I9JA 4PMYA 3LGGA 3GU1A 4KCUA 1XRVA 2VVSA 2JFEX 1P1MA 4FZIA 2YZ5A 2ZRUA 4TQRA 1BSLA 3AHXA 4JX5A 4AZCA 2PTZA 1Q66A 2J62A 3IRSA 3UZWA 2AL1A 3TN5A 3MHFA 2WC4A 1HF6A 5D32A 3WLIA 3ARYA 2FKPA 3NR0A 5G1MA 4NZ3A 1O12A 4BHYA 4AX6A 4HNCA 2W4XA 1YPXA 3N6QA 4ZQCA 5KG0A 1EUAA 4UTIA 2I5IA 2V4QA 1DXIA 2E0PA 1VFHA 3EMZA 2WHKA 4HU4A 1XICA 2FLLA 3DAQA 4H7CA 1S5WA 3BXWA 4KEVA 1EBGA 3OLDA 2GDUA 4UFIA 4DUXA 2WCGA 1B5TA 1R38A 3W6MA 1OJXA 5EU9A 1Q7QA 2ZX7A 4JX6A 2D23A 2QPSA 3OW1A 5EYWA 4S1FA 4J2MA 1UC5A 1RQBA 3LEPA 3QXBA 5I3KA 3LM7A 4MZ1A 3MBFA 1AL8A 3GTFA 3QH2A 3L4WA 4JTUA 4QP0A 2EGZA 2NZLA 3N29A 5JBEA 1JAKA 3AJXA 5EMYA 1YDVA 3IACA 4BFAA 4S3JA 1MUWA 3LUTA 2D2OA 1C9WA 4M19A 4TV5A 3M5VA 1NVMA 3UP8A 2JF7A 3SN0A 1RK6A 5GNZA 3QPZA 1N7KA 3HZ3A 1NY1A 4ECXA 3MHUA 2OVLA 5D04C 3WQCA 2F2KA 4JZ5A 3BSMA 3U2ZA 5CBBA 4C6OA 3OLIA 3VABA 1X8FA 1EGMA 4O15A 3MFHA 1QNPA 3WLMA 2AGTA 3AUJA 2PDNA 3SDOA 2D0GA 1HO4A 1RSCA 3OBEA 3OG3A 1FH9A 1VP5A 3WSUA 1C91A 3MO4A 4V33A 1QXLA 2XHYA 3FA4A 3RM9A 3VGEA 5BW6A 1GNXA 2Z6JA 4NI3A 3ARQA 4ZOEA 5JXQA 4GJ1A 5L9FA 2VC5A 3MANA 4MDOA 1GYMA 4FSAA 4HTBA 4BR1A 1XUUA 1JEZA 4HN8A 3CUGA 2UZ9A 5CJMA 3MUZ1 4QG8A 1VD6A 1OYCA 4V2XA 1FWEC 5KFWA 9CGTA 2XH7A 4DELA 1IXPA 1EDQA 4C90A 4N6EA 5E09A 3PN8A 5KINA 3UGRA 4JQ1A 4J3XA 3GO2A 2VO5A 2F9RA 3NDYA 3URQA 2VT0A 3CIWA 2NUWA 4QW9A 1GQLA 4PTWA 4GY1A 1VPXA 3DFQA 3VGGA 2WV8A 1EP3A 1L6GA 1Z44A 1A0DA 1A47A 3ITVA 4QRNA 1ZRQA 1MUCA 1UD4A 4HPHA 2CLEA 1ONRA 5D2VA 3G1YA 4B5TA 5ABHA 3T05A 1WOBA 1OT2A 1UD8A 2DT2A 3UPMA 4CU8A 2E9MA 4ZXOA 5AZ1A 4CNSA 4ATDA 2ZTJA 5C54A 1W5NA 4XAGA 5A6LA 2J8GA 2H8ZA 2WK2A 1SW7A 3KLLA 3RBDA 1K9EA 1HJVA 1SPQA 2I7GA 3BQ6A 3IVUA 5DQIA 3UY8A 2VC6A 3BSGA 2BHZA 3GR8A 4KWVA 1AH3A 5I79A 1YBQA 4S3GA 4Z1YA 3CZEA 1DJGA 1RD6A 4A3QA 1WDQA 2O9RA 3P74A 3N2OA 2QLYA 1TCMA 4WZHA 3LCIA 1B4EA 2E3ZA 2XIJA 4ZODA 1HG3A 5CPNA 1GZ1A 3WH6A 3QTPA 3AMCA 4YR3A 2WSYA 1VYSX 3B9DA 1ZALA 5CPQA 4CVUA 4Y90A 3WL1A 5KFYA 2F6UA 4ZR8A 3EEZA 3FXGA 3E02A 4S3AA 1IYXA 2JALA 3W7HA 5IDIA 2PCQA 2DUXA 5DQHA 4B91A 1E0UA 3GNPA 4AHOA 5A6SA 4LVAA 4C91A 4LBRA 1L6YA 2ALZA 1W0MA 1HXJA 1RVKA 5GJMA 4HVXA 4QSFA 3RCYA 4JQAA 4TTGA 1OF6A 4LEQA 1HKKA 4LF1A 1EYWA 2AQ4A 2XZ9A 5AFDA 4GUGA 1LWIA 4QLJA 3UJ2A 2Z1XA 1V3JA 4KWWA 1D3GA 2VFHA 3O63A 2YIHA 1XLJA 4F50A 2W7OA 2AAAA 2DZUA 2Y2WA 4YVXA 1RP9A 2ZE0A 1E3XA 4IIGA 1EZWA 2VFEA 2XSBA 1PB0A 1Y65A 3WNMA 3DC0A 2VL4A 1SJCA 3IGUA 1E55A 1PUDA 5FI8A 4MKVA 1FWNA 1LUCB 4AVNA 1QNVA 4B9YA 1PKLA 1JXJA 2H90A 2P5NA 3WJYA 2PZ0A 2ZOXA 2PDMA 2QYGA 1OM0A 1VGAA 2QUTA 4E3VA 1W5OA 3JZEA 3W85A 1MZRA 5AC4A 5JQ9A 3VDBA 4EACA 5D02A 4KS0A 2ZQ0A 1XBYA 3PJUA 3TJ4A 1EC9A 1IGSA 2ISWA 2WVSA 3M43A 3COTA 4FXRA 4IP4A 4DM1A 4D6JA 2EKCA 5KZEA 4BQ5A 3U4AA 4KFOA 4LS2A 3U4FA 1FP8A 4LBUA 2PU1A 4EKJA 4W89A 4JIRA 1U1HA 1EBHA 5E0FA 2BY1A 4DJFC 4PB5A 2BR0A 4P5UA 2FHBA 1YW1A 3NGFA 1VPYA 3OVRA 3GYEA 3GV8B 4R9OA 1HVQA 4QITA 4WXZA 2PBGA 4LRTA 3C2EA 3GXMA 4RV8A 4EK7A 2BOEX 1KXTA 4LVGA 3H70A 4IJCA 1NARA 2O4QA 1DKWA 3ZJKA 3GIYA 4H9YA 4DJFD 4YVPA 2J9ZA 5BMXA 3WO8A 4X0NA 3GQCA 3T2QA 1GOMA 3ITTA 1PXGA 4D9PA 3STEA 4MWAE 4PMQA 3BGGA 2C0HA 3CZJA 3IIXA 4DZAA 1NDYA 2ZVIA 2POZA 4L7ZA 5BOEA 2R24A 3W1AA 5U4NA 2Z24A 1MO0A 2PTDA 2BOGX 2W5FA 4AUBA 1KRAC 1CPUA 1ICQA 3B03A 4F0HA 3DN5A 4IZGA 3KHDA 3RF9A 2OJPA 1ALDA 5KT6A 4P7QA 4G8TA 4IP5A 3GVQA 1IXOA 4X60A 1U22A 3N13A 2ZUWA 5D9NA 3CL7A 4MUPA 2QCCA 2HDJA 5DO8A 1BPLB 4PTDA 1AW5A 4YHGA 4NU7A 1J0YA 1JRCA 2J6SA 2TRSA 3C8FA 4ZO8A 3RB4A 1KM1A 4F2TA 2A7RA 2NV1A 5CKSA 5D2TA 4HHHA 2VD8A 1BEUA 1XWYA 1BAGA 1BQCA 4DLMA 4S3BA 4J3UA 3DGBA 2VEGA 4TUFA 2DZWA 4Q8QA 3T9PA 2R1LA 4ED8A 4WDXA 3NJ3A 3KRSA 3BCJA 4L9YA 1SUXA 2XIQA 3R79A 4DIAA 5DY3A 1V3HA 2ISVA 3KWSA 1QOQA 4EAMA 1ECQA 4RNMA 1XH0A 3N3TA 4A05A 4Q4KA 2XTKA 3A24A 3VMNA 2REQA 2C28A 4JHMA 5CC3A 3EDKA 2I9EA 1E70M 4GYKA 4IPLA 5FIPA 4DHGA 4PCTA 4I9MA 4DUVA 4Z1CA 1S9FA 3TAOA 4DLFA 4K8HA 4MKNA 3O6YX 3QZEA 1W1ZA 4U2ZA 1F61A 3PPCA 3SFWA 5AHEA 4IIFA 3KTXA 3IJDA 3MSGA 5E9AA 1R85A 3E49A 1SZFA 2RDWA 4R7WA 1CGUA 3PAOA 1JYNA 3MV01 4O3RA 2FDMA 5A6AA 4KH2A 1S5TA 2XH2A 5MKGA 1DJXA 4F4RA 3MKVA 3LTSA 3ELFA 4XD5A 3B8TA 4ERIA 2NLYA 3SCUA 5TF0A 5KFEA 4RE4A 1PIIA 5FJPA 3KFTA 2WMIA 1W3KA 1E4IA 4DF0A 2V0TA 4ZO6A 1W1A1 4DYEA 1IZJA 3KBNA 1W5MA 1K3UA 3QSTA 4YWIA 1HL9A 3KHRA 3FYOA 3O0KA 3LI1A 4BF7A 1TIWA 2PF0A 1X7IA 3RXZA 2JKAA 1TPFA 2OODA 4NP7A 5FF2A 3GW3A 3C0SA 2OXNA 3TW7A 4EBCA 2BWGA 3R43A 1WZLA 2YDRA 1WO2A 4UBPC 2V6AA 4DWSA 3VTRA 2PRMA 3MR3A 3R0UA 1HL8A 1XIBA 1E40A 3M5ZA 5I3HA 3ABQA 2J7EA 3G6LA 4Y8EA 1KB3A 3DENA 3OHAA 6TIMA 3QN3A 1R2TA 1J18A 2DORA 2PDYA 2C18A 4PB4A 4GVIA 4LNCA 3MQTA 4ED6A 2DUAA 1SFTA 2ZA1A 4HJFA 3C2VA 4HD5A 1RBLA 3EWUA 4IXXA 1OBAA 1G7VA 3P5ZA 2GK1A 1NP2A 1WA3A 6REQB 3PTKA 4JNMA 2NQ9A 2EO7A 3DOPA 3DKLA 3WQGA 2DW6A 3H2CA 1KXQA 3BICA 4JFTA 4W7WA 4KQNA 5AHNA 2X7WA 5DCBA 1LORA 5CSSA 2P88A 1DP0A 1LBLA 3RR4A 4RDWA 4UTKA 1EO7A 1K9FA 3BZGA 4MB3A 5DLCA 3APYA 2HQAA 3KW3A 3CMGA 1UZHA 4DJEA 1Q4WA 2CESA 3M16A 1W9BM 4JDBA 3P67A 1GQJA 5EWFA 1Q65A 2PDJA 1JCXA 4R7OA 1SW3A 1YPFA 1FHDA 2Z1SA 2Z2UA 3W72A 4GWEA 4IX0A 9XIMA 3ERPA 2UY3A 3K46A 2C6QA 3JW7A 1Q45A 2VD9A 3I7SA 2TPSA 1TYGA 2WLZA 1XG4A 1AL7A 4GXWA 3W2UA 1C90A 1DWGM 1XIFA 3S6TA 3QQ1A 1H0IA 4IPPA 5IRPA 4C6EA 3ZSSA 1ITCA 1H7WA 2X7VA 3CUIA 3P80A 1V02E 3HQPA 4PUEA 4V1YA 3UYCA 1EJSC 1RALA 4GYJA 5F4SA 3G6MA 1UJQA 3WJZA 4DZIA 3GTXA 5EMJA 1W5QA 4YL2A 4ALDA 1TREA 3OVQA 7A3HA 4LXFA 3BTNA 3PW0A 4F9DA 3L4XA 4UMBA 3LBMA 4DBWA 5KG7A 1T8XA 1S0MA 1V7AA 5I02A 2W62A 2D20A 4O1DA 2PC4A 3TMQA 5M17A 3NWRA 2AGKA 4WKFA 1GZGA 4U6PA 1ZSXA 5C7HA 1H7PA 2YFNA 2ABAA 2R94A 3DYPA 3NIYA 2OOGA 4RPPA 2FVKA 3W1MA 4IIBA 4A8LA 3V18A 1YTKA 3BW4A 2WOQA 1U5JA 1TX0A 3KUMA 3LCXA 2QPXA 3AYRA 3VC6A 4E8CA 4TX9A 1YTEA 1X96A 4ECRA 3SJ3A 2X1IA 3GIIA 3CIXA 3OBAA 3N4FA 3U9IA 5F4WA 2X42A 3L4TA 5KFSA 2Q8XA 1UD2A 1HKWA 4A8RA 4UFLA 1R7OA 2ISSA 3LGEA 4FA3A 4Y9OA 4KIRA 1TELA 4DEZA 4EF9A 3D0CA 3PUGA 3GVGA 5CPTA 2FZBA 4C1NA 5LNUA 1XXXA 2BX7A 5A2BA 2QQ6A 1O60A 4LUJA 1R0MA 4RJEA 3KBMA 4I5RA 1MNSA 1RAKA 3TC6A 3GY1A 3W00A 4NRSA 5LGZA 4JHZA 2FZDA 3PM6A 4C6LA 1ZGDA 3UZZA 1DTNA 3QC0A 1YEYA 4IJBA 3S5SA 2JK2A 3AJ7A 5D2WA 1KR1A 4LFYA 5D03A 2QXWA 2VRJA 2DU2A 1NM9A 1QDSA 4Q45A 2J6UA 3W7IA 1E56A 1ESWA 1JRBA 1W31A 2BQUA 1EXPA 3WG6A 1KXHA 1CZ1A 4KETA 2X1SA 5J04A 2J88A 3DDMA 4NKCA 2Y5SA 3KL5A 3KTCA 1G1YA 4U33A 3BOLA 4IQDA 4OV9A 3WQPA 4JR5A 4YMZA 1TRIA 5DMMA 3IANA 3AMDA 4FX8A 4AISA 1UWUA 1QW9A 3HIJA 3QMTA 2E28A 4A3UA 4ATLA 3ID7A 2CXGA 3M0ZA 3M7SA 3NDOA 3UW6A 3B97A 3RNDA 2V5DA 2CWNA 3STGA 3JVAA 1SO5A 1PL9A 1XV8A 4H6EA 4HCHA 1W3TA 1YBQB 3F7JA 3WD4A 4IM4A 3CXOA 1Q6RA 3V1HA 3GTNA 3TDFA 2WKLA 2OGYA 5HMDA 4XUYA 4MB5A 1P7TB 3ZWTA 5KSWA 3GIKA 3Q65A 2I14A 4HBKA 2YBUA 4Y9PA 1WYIA 2CBVA 1EOKA 1RCOB 1XISA 2VR5A 4J3VA 1YYAA 2CZFA 2W67A 1LBFA 1RP8A 1VIZA 1JIBA 2DSWA 3B9AA 5H6HA 1YX1A 3G1AA 4AF0A 4GUFA 3LI0A 4K6AA 3W73A 1VHNA 4EPEC 4UTLA 2Y85A 3GLCA 4PN2A 3KRBA 3FEMA 3BMVA 3WQ5A 1XKJA 2FJUB 5E6ZA 3WBWA 3PBGA 4FLSA 4P8XA 5I00A 4MKSA 3FJ6A 3B0PA 4GQGA 3NYZA 5A94A 3QKEA 1ZB5A 3KOYA 3TWAA 1NSJA 1ZTVA 1T40A 3U3HA 1QO5A 1E9YB 3IARA 4GKLA 1EP2A 4CCDA 3PPFA 3EPGA 4IG2A 3VMOA 3KM8A 2I5QA 1B90A 3G0XA 1XJBA 1GCYA 4QDWA 5KEZA 2RUSA 3SW6A 1UKTA 4FX7A 1BTCA 4YNGA 5AOUA 1A5BA 1OZQA 5M5DA 5KFCA 6PTDA 2A79A 3QZ7A 4IPJA 1W9PA 3T5JA 3ITYA 1Z7AA 1QFEA 2OEKA 1V77A 3RU6A 3HFTA 1ITXA 1LTDA 4PSRA 4DL3A 3B8SA 1HJSA 4UQ9A 4IOTA 2Z00A 1HW6A 3POCA 3PG9A 3RJXA 2NW0A 1H49A 3QMRA 1RHCA 3CL8A 4WY0A 4KMQA 1FHUA 4GGHA 7ENLA 3W7PA 3HB9A 3BSHA 3BAXA 1PWLA 4NRRA 4B3LA 1V6TA 4UZSA 3GHUA 1X98A 4U3CA 3SCWA 3V5CA 1MFVA 4XD4A 4QEEA 4WQ6A 2NV2A 1ITQA 3T0TA 5M2FX 4NIRA 1S0OA 5BRQA 4Q8OA 2J7GA 1OC7A 5A6JA 4GD0A 4LU0A 2ZBTA 1M7OA 2HPIA 4XZ9A 4O0ZA 1JCJA 3R0DA 4Q8WA 3L65A 3R94A 3GV7B 3BOFA 3NXLA 1ZY9A 3C56A 3PZMA 3WJSA 5HWMA 1UZDA 1XDMA 2IKIA 3QYQA 5I5RA 5TIMA 3W23A 3V0SA 3UJEA 4MVAA 3C6CA 4HKPA 5I78A 5XINA 1LG2A 2W91A 2ZADA 2FZMA 3E3HA 2ZXDA 1C92A 2YR1A 3TMLA 1ZU8A 2ASDA 2ZWZA 4K8EA 3H2AA 1F6PA 3W7EA 4A3YA 1IE7C 3CH9A 3T8LA 1ONXA 2CHOA 4M51A 4RUBA 1OADA 1PV8A 1XLKA 4EWND 4JKMA 5B7ZA 2Z2BA 1RV8A 1KM0A 4DZHA 4PMJA 5HQMA 4OECA 4Z17A 2AL2A 2XFWA 3SCVA 4HHMA 4O12A 1VJIA 3BLEA 1TA3A 3P0XA 1FCUA 4O3QA 1ZPTA 4F66A 5F2LA 1CXFA 3PTDA 3L4ZA 2IS7A 3KBWA 2IMWP 3E0LA 1E4MM 4G7EA 1LP6A 2BBFA 3IK4A 3PBUA 3TTYA 4L1XA 3BJSA 4KIEA 1CBGA 2OZ0A 5CPMA 1FWJC 5DX7A 5KG4A 4AG0A 4Z2IA 1KRBC 1DJZA 1KBBA 1VEMA 3WBEA 4ML4A 2NX3A 4L64A 5AVHA 2DP3A 4CD7A 3SIMA 3VGHA 4V15A 3W27A 3BLDA 4GYFA 2XGQA 4LGXA 1P1XA 4XKYA 1UKQA 5E0CA 1A53A 1ZS2A 2CIPA 3BMXA 2ESCA 3IJ8A 2WQDA 3VXGA 3Q2DA 1MDLA 3W76A 3RX4A 1UPMB 4GC7A 1AJ2A 4QJ4B 1EEXA 5E5CA 2BY2A 4HCDA 3F4VA 3VDCA 2J7FA 1Y5VA 2REQB 1U5HA 4WCJA 3VFCA 2PWEA 3USBA 4GI6A 5DY2A 1H5VA 1VZWA 3B06A 3LLFA 4F4ZA 4M5PA 2V5JA 5G1TA 3G6YA 4KCWA 1JXKA 4U3AA 1PE1A 3BARA 3PZ9A 3VKCA 1G6CA 2RJHA 3IEBA 2BGNE 1FWHC 3ZT7A 4L65A 2GYIA 4XX6A 1H1ZA 4PUNA 4WY0F 3CUJA 2E77A 3VKJA 3OZPA 2G97A 1FHLA 1HFBA 1QNOA 3PSWA 4WJXA 4U4MA 1V0MA 1V6XA 1U30A 5MKGB 4D6HA 2P0OA 3P60A 3A12A 7TAAA 7REQA 3VZXA 2XSXA 4QXIA 4GABA 1O68A 1JPKA 3H2EA 1M9HA 2WSKA 4BF5A 3EWWA 2WMIB 6A3HA 5XIMA 2VR4A 4H2CA 3GXDA 2ATLA 1NP0A 4JOMA 1DXFA 3V5FA 3IJ9A 1M68A 5REQA 3WQ4A 1W3LA 3UCDA 1ZAHA 4HMCA 1J0ZA 4UTUA 3F2CA 4QAIA 4WKAA 5CJNA 3G1SA 3F4NA 1FWGC 3W28A 5AB3A 3PUDA 3W9ZA 2VOTA 4ICMA 1TX2A 3HQ1A 1QVBA 3TROA 3MSYA 2CITA 5FSEC 3DESA 5J5DA 2QCHA 1JF6A 1HGYA 4LJ3A 1QBBA 7XIMA 2A5HA 5HK4A 1PEZA 2C71A 1OD8A 1XR2A 4GY0A 1UWRA 4IICA 3NPWA 3DFPA 4JFWA 3RPTA 4DXXA 6ALDA 2GSJA 5HPOA 3S0CA 4H83A 3QKZA 4K7YA 2W8LA 4AHPA 3CASA 1OIMA 4AYSA 5K4ZA 2VHLA 4C6DA 4XBKA 3K1GA 2GK1B 1TWSA 1W32A 1HTIA 2FMNA 5FF0A 4JDYA 2PTWA 5AYYA 3UNTA 3GUWA 1RLCL 1OWQA 2CW6A 1UBSA 1GOXA 4YWSA 1CLVA 4DN1A 2GL5A 5CAKA 5HR7A 3KDNA 4MYXA 3A5FA 5T26A 4UTTA 1AVAA 4D6CA 4DF1A 1SZRA 3WF3A 2V5KA 3TC3A 4AIOA 4C6QA 1EJUC 1UASA 3FCPA 5E1QA 3OHBA 2CXEA 1E6SM 2ZDRA 4INFA 3ZVHA 1EJTC 4KF1A 3SECA 3HURA 3T6CA 1H11A 3ZVIA 4NZFA 4RDYA 1MMFA 1RBAA 2EJ1A 2RAGA 4FOJA 4MHBA 3SAZA 3DBPA 3CB8A 3UG8A 2BVTA 2P8CA 4Q8NA 4AEOA 5F7UA 3FHQA 3M0LA 2YFOA 3WDRA 3OZYA 3CQHA 4QM1A 9XIAA 5A2AA 3CWOX 1BRLA 2VJXA 4H41A 2UWFA 4O4WA 1W3NA 3N34A 4Y8FA 5F2GA 4FF5A 4PODA 2VVNA 2DVUA 1XD1A 2YKKA 5FJJA 3H6OA 2QF7A 1O5QA 3VMPA 2EG8A 3SM0A 3O3RA 2C13A 5H8MA 1WOAA 3TFCA 3M0VA 2AGOA 2R8GA 4O28A 2Q6ZA 1LM1A 2B4GA 5A6KA 4DJDA 3SUUA 4ED1A 3SEPA 4E2VA 2WZHA 1EDGA 4PZVA 1K03A 4TO8A 1RQEA 1E1CA 4O1EA 4UUIA 4KT2A 2BXZA 3UZXA 3SADA 4GMEA 1XYZA 4XSMA 3MKKA 2E5BA 4IGHA 4R85A 3NZQA 5HNTA 3T0CA 4GK8A 5BZAA 1BKHA 1LRTA 2BXVA 1K8XA 5DMYA 4R8UA 1PIGA 4FNTA 3C86A 1X38A 1GZJA 2NQJA 1KGUA 1ECEA 3WQ6A 5A8OA 3TEVA 1JDDA 4XZWA 4HYRA 2BQ3A 4GCXA 2CLFA 1YNYA 1UOKA 3G1XA 4H7ZA 1FH8A 3IGSA 5IBXC 2QVHA 5I77A 2XVLA 2Q8LA 4C1NB 3QZ8A 1R2RA 2PDHA 2VOMA 1GYNA 5C9UA 1E6PA 3C2YA 2FLIA 3VIMA 2Q8ZA 2YDAA 5JH2A 1LL7A 4IF2A 4KESA 4M3PA 2NSOA 2GWGA 5BCAA 2BTMA 3EBVA 1WQ5A 4M24A 3EOOA 2PEVA 4DYKA 2ZX8A 3S42A 5KG3A 1J93A 3M07A 1N82A 3VKBA 1LF1A 1EWDA 5CZTA 4JEQA 1X7FA 3A47A 3M5YA 4MAVA 3ALGA 1SSDA 5EY5A 3KCJA 1W9VA 1TWIA 1BWLA 3V6JA 1G94A 3A4AA 5T9BG 3W7JA 3NUKA 1RA5A 3ABSA 3W84A 4OWGA 4B15A 3AIWA 1HVXA 2QS8A 1CCWB 2XWDA 3CV7A 4Z1DA 1IWPA 5DCDA 1TPEA 3IUIA 1DHPA 3URBA 3KRUA 1QK2A 1L6WA 1WXZA 4TMCA 3PC0A 1UA7A 2UV8G 2XN2A 5BU6A 3M0MA 4Q8VA 3WDHA 2DEPA 2G50A 2Y7EA 2P0IA 1A5AA 3KDOA 4I7UA 2G3JA 1H50A 4NSBA 4C6FA 5FD0A 5CSUA 3NGDA 4UQDA 4O3NA 2OKTA 2PWUA 4HU0A 3EWDA 4S23A 3G3MA 1UR4A 2D1ZA 4DO5A 5CXPA 2VYOA 4W9TA 1K8CA 5ABFA 1ZP4A 4YHEA 2WHLA 1D3CA 2WNNA 2V82A 5HXMA 4BY3A 2OG9A 2QCNA 3PB2A 1W3JA 1FWWA 3WLNA 4H3DA 2EG6A 2TAAA 4QE5A 1DYSA 4GE8A 1B3XA 2GQ9A 2BHYA 2ZUNA 1E9LA 2EJAA 5FJRA 1B3ZA 3UNDA 2YYUA 3XISA 3TUUA 4EAYA 4LAMA 4X63A 3T81A 2I5GA 5D4YA 3UWQA 5LNWA 2YA2A 1UKSA 3EOEA 3GB6A 3I7RA 4IRKA 5E6YA 2DSZA 4GYPC 1XIGA 1THFD 2Y8VA 4EYIB 5HBFA 4BA0A 2HZGA 5AHMA 1YTDA 2NQHA 3CMFA 4HGXA 1TVLA 4WSJA 3UESA 2J8FA 1GYLA 4ECTA 3RN6A 4QLLA 3EAUA 3THUA 5D9PA 3GXTA 1JZ8A 3JRKA 3VKDA 3KZPA 2ZVRA 4W8BA 2YL6A 3WNKA 3NZ1A 3LBCA 4CNPA 3ITOA 3PWAA 4Q3MA 4AMAA 2WVVB 5BROA 3W1RA 1XRSA 3NPVA 2FMOA 3SRHA 4LY4A 3W7QA 4ROQA 4Z2GA 3ECQA 3PAJA 4C65A 4E2DA 5CZ0A 4UQAA 4W93A 4WY0B 5EMLA 1XLLA 3AXIA 3BW3A 4IXHA 1TV3A 4CEUC 2V69A 1DIEA 1FWTA 3TA6A 3W29A 3MO7A 4X9YA 4MOZA 4ZEPA 2V2HA 3NSXA 3UQNA 3N73A 1EZ2A 1GONA 2V2DA 1LJYA 3GAKA 3BZJA 5C71A 2X09A 1XLFA 4AD2A 1WAUA 2XGIA 4WF7A 4DY1A 1I4NA 3RLVA 2OGJA 1TB3A 1SW0A 1KA9F 2VRKA 2DH3A 2V38A 3KL3A 2V67A 2E25A 1QNQA 3NQ8A 1TPH1 3GR4A 1UW9A 3V6HA 2FHCA 3WK3A 1GOOA 4HK7A 3VUPA 4XV0A 1LOLA 5F1UA 1GORA 3V6KA 3VOCA 5TD4A 1PTGA 4J28A 3BLOA 3H23A 4H6RA 5CZSA 1JPIA 2QCMA 1WDWA 2JQXA 4HHLA 4LPCA 5LIKX 5LNSA 3MHGA 2Q3OA 4OU1A 4FBTA 3BAJA 2VR2A 5ENLA 2CZ5A 3RITA 3CUHA 1SFJA 3NA8A 3BGJA 3ATZA 5KT7A 3AIQA 3I3DA 1GVOA 1W1YA 4AMCA 3ISIX 4WOZA 4JL2A 2G3IA 1PCWA 4F0RA 1UWIA 3QGAC 3G0SA 1NJJA 5DT7A 4HZMA 1FWSA 3V0TA 3TSMA 3RB6A 2WMGA 3AMLA 3NL2A 3AHVA 1W2VA 1JDAA 2XVKA 4AH7A 1M65A 3HGOA 5FJTA 3WK1A 4GNKB 1UUOA 1ZQ5A 3RLUA 4DL5A 3R0KA 3NO3A 1J2BA 3MCOA 4RNJA 2PTXA 2E09A 5HNNA 1BVWA 1C7TA 3MV11 4DF2A 4GFSA 2UY4A 3TWBA 2WMFA 4Y9AA 2IQ0A 2E9BA 4KERA 4NI8A 4JQ2A 1V51A 1VCFA 3B0XA 1Q13A 1WKFA 3UPBA 2WMHA 4FOKA 1VFMA 4GX9A 1VENA 4FHAA 3UJRA 3V36A 3GDKA 2W7PA 4XKYB 3MSRA 4CU7A 4MJ4A 4K8GA 4GY7A 2OZ3A 2E6DA 4A22A 1S0NA 3LTYA 1NIUA 4AY8A 1PDZA 2ANUA 4W5ZA 1CTNA 5AYIA 3S9ZA 3UXKA 3REQA 1A0CA 2GJLA 2V4RA 4PBEA 1J0HA 4IRDA 1MEWA 3TTQA 5FL1A 4J40A 3H2FA 4OV4A 3CH0A 2PWHA 4GNVA 3FNDA 2AOSA 3H8AA 1MQRA 1QOXA 5KT4A 1W56A 1R6WA 5KITA 4HA4A 3UG3A 3CQKA 1Q2RA 3Q58A 4GBDA 3SFKA 3VCCA 3QHNA 3HPXA 2A2IA 3BV7A 1O5XA 1P4CA 1K7EA 3QQWA 2DZSA 1TSIA 3LOTA 4AAJA 3WMLA 4GPNA 1LZOA 1P0DA 1Q3NA 3PUEA 4A3RA 1GT8A 2J7DA 2P50A 1ME7A 4JTTA 2ZRZA 4X61A 1R46A 1VFSA 3THQA 4Y2WA 4XVDA 2WWDA 5LIXX 4XZMX 2ACQA 5JVLA 3LQGA 1E0TA 4WVXA 3FDSA 3KOZA 3TQVA 4EANA 5KFNA 3VM5A 4HZ8A 1GOIA 1GHRA 2VENA 3P93A 2YBVA 1AODA 3CWNA 4RKAA 1OABA 4EE9A 4YXGA 3MR5A 1IF2A 2X41A 2XM2A 5FACA 1N8FA 4DL7A 5FEXA 2QF8A 1F4AA 1V3LA 4JIIX 4QS5A 3SUVA 2P53A 4MG4A 1QNSA 3EKZA 3IJ6A 1HL2A 4B3ZA 2QUNA 4OIFA 5EWEA 3SGZA 3G0UA 3F4DA 2CU0A 2NLIA 3FJNA 2J47A 3WBXA 5C9WA 2J25A 2PD9A 4DRSA 4KFPA 3FOKA 2CETA 2YB1A 2NWRA 1K77A 4O16A 4CQAA 4GGBA 3PPGA 4WOQA 4ECLA 4J9KA 4E5TA 2ZZ1A 2XDFA 3M46A 4MJ2A 1P0KA 3LPOA 3SRFA 1FWAC 3RYSA 3O15A 3WQFA 4Z1AA 3HN3A 4MF4A 2A0NA 1IWBA 2OQHA 3GE7A 3TNBA 4NY2A 5D30A 5KG2A 1QI4A 1LYXA 3PK7A 1E1EA 2D0FA 3DHDA 2EKGA 3MB9A 3RMEA 1SO4A 1KBKA 1XQKA 1S1RA 3VGFA 4HNUA 1F74A 4LS1A 2FLNA 1UQZA 4LUYA 5E70A 4JAWA 2NVAA 3V4BA 3R89A 4EOUA 3H4DA 1JQXA 2QCFA 3FGCA 2WW5A 1T99A 4JN6A 3ZM8A 2XC9A 4C6PA 2R8KA 1ONEA 2FVMA 3OIXA 4JCMA 5CGQA 3C0LA 1DHKA 3QF0A 4R3UA 4GO9A 3PBWA 5HMSA 1A5KC 1WXJA 4XB3A 3G6VA 4AWEA 2J79A 4OT7A 1YE4A 3WFLA 3IPWA 2HBVA 3R7MA 3RMJA 1OIFA 4H8UA 2HK1A 4KGJA 4TV6A 1JPMA 4CD6A 4L80A 2XIBA 5ECUA 2NXIA 3SCNA 1R9XA 1GVQA 2Q71A 5GNXA 1KFLA 3O7UA 4REQA 1VHCA 4GQ0A 3AS3A 3VVGA 3H4GA 4QWDA 4H00A 5A6MA 3ZT6A 1E6RA 3GDBA 2KX9A 4H01A 1M1BA 1HZYA 1IT0A 3S5OA 5IFPA 3W1UA 1E1CB 5DG9A 3N2TA 4FAMA 4WD0A 4O1CA 1M03A 2JF6A 1HIZA 5CC5A 3E0VA 3QR0A 2VQTA 3H2NA 6CGTA 5I03A 1PYFA 4HPGA 3KS6A 4FBUA 4TU1A 4BK9A 4ZXLA 1KTBA 3V75A 3OLGA 4R8UB 4RLIA 2R1PA 1W1PA 1ISVA 4A29A 1NEYA 2CCRA 3HBLA 4I8YA 1X1OA 3RR1A 3B0UX 4L4MA 3TAKA 2PDWA 4PUMA 4LUTA 1R3QA 5HWJA 1EKOA 3VGBA 4MTVA 1WDSA 4LS0A 3VIFA 2WPBA 1EJRC 4PE8A 4PC8A 4GZEA 1KKRA 1AW1A 1N8IA 4GHRA 3VOIA 3GX9A 4UR7A 3B4YA 3LZ3A 3QQ0A 1AZ1A 3ZSTA 4P7RA 3ONBA 4MMWA 1UWQA 2WHMA 3TKFA 3TYUA 4IRCA 5KFPA 2GQ3A 2BY3A 4DO4A 3W7MA 4LVBA 1V3MA 3NTYA 5L1IA 2BDQA 3MA8A 3RO6A 5DQPA 1CXEA 1OX4B 1RY8A 3BL3A 5FAGA 2OELA 3O16A 3DEQA 4GIRA 1XG3A 3VILA 5GJPA 4W8AA 4D71A 4HK5A 1QPNA 3PZNA 3AAMA 3GFXA 2C16A 3NAVA 2CLKA 1AK5A 5EBUA 2DSUA 1M53A 3N14A 2OLAA 3NDZA 3TJXA 4GZIA 1K1SA 2WM1A 2R9RA 2GJXA 4MY1A 1I60A 4D8LA 5BNKA 1VPQA 3E2RA 5FJUA 3VAVA 4F0MA 3WQWA 1TUFA 3IJLA 1A3XA 4K39A 4JTFA 3YPIA 2MNRA 1X8CA 1J2WA 2YCIX 1ZBWA 4QGCA 3IJIA 1XPYA 3AWNA 3GKFA 4XBSA 1F76A 3IJQA 3RB3A 3VNLA 2A4AA 4LY8A 2G4JA 3E5PA 1KR0A 4XZLX 5HQLA 3MR2A 4IH3A 3VO0A 4JNZA 3W7CA 4H6KA 3G1DA 4O1AA 2VCBA 1V4YA 4LEFA 1HJWA 1Y7VA 4NNCA 4X22A 5GVJA 4GVHA 3UZ5A 4XD3A 4DAFA 2L5HA 2OYKA 3PZGA 2GDQA 3B9NA 1POJA 3BE7A 3ZR4A 2ICSA 5HPCA 1NDZA 4LRSA 1YNQA 1YLVA 1VR6A 3SN4A 2ZYFA 1D8WA 3LPGA 1XYAA 1E0VA 3CO8A 3ZYZA 2J78A 1KD0A 3IRDA 2YDSA 5C2XA 2BASA 4G9PA 1C8XA 4O1FA 1FCBA 1VH7A 3U5YA 4NXSA 1NDVA 2Z25A 2WZTA 4NVTA 2VA2A 1JZ7A 4GZJA 2PGFA 1K02A 1OF8A 1HN1A 1IZKA 4V1XA 4P7NA 1EX5A 5IDZA 4W86A 1RCQA 1HX0A 3CIVA 3MW7A 1JD9A 2ZIDA 3QW4B 2WZMA 5LHEA 1R9YA 3KP1A 1GHSA 3WQDA 3B8IA 1PZ1A 4UCFA 3R12A 2XINA 2DIEA 4OUEA 4UZUA 1OFPA 1JI1A 5C2CA 1O95A 2PDIA 5EBAA 4M6PA 4GBUA 2V3EA 2VUYA 3GBDA 4P7LA 4BQ4A 3EMQA 4ED3A 1QCWA 5DEZA 3WH8A 3VD3A 4M56A 3VIJA 3VX1A 5I2UA 4EX4A 3QV7A 3U2CA 1E0XA 2NT0A 2R91A 3M41A 3TE9A 4JQ3A 4CLMA 3GBEA 3TYBA 1FXQA 1EPXA 3GYCA 1GOWA 3R5EA 1L8NA 3N12A 2NVDA 5CG0A 4HHPA 4JYDA 3SY8A 4Q8EA 4AD0A 2FZ9A 1BWKA 4KWOA 4FIRA 2YW3A 4TQTA 4RE2A 4HNNA 1RJPA 1XFBA 1MYRA 3ARPA 3QLLA 1Z69A 3AXKA 2W9CB 1BYAA 4KFNA 1G69A 3UY7A 3CUFA 1UOZA 2VX7A 2AQOA 3TXZA 1A3HA 4H4IA 1E1FA 1I1WA 3HG2A 4MGGA 3NOYA 4AVOA 2GVLA 5TQLA 1NH6A 1KLZA 2OEMA 3ZLGA 4I5XA 3CB3A 1NAL1 5IFTA 4S3EA 1ADSA 3GVRA 3O05A 4JTEA 2EG7A 4PMOA 3CGTA 4MLJA 3AICA 3W02A 1NFPA 3VNMA 1B54A 3K4AA 1BGAA 4RE0A 1UKOA 4X3ZA 1PYMA 1ADOA 1GGOA 4N4PA 4J9OA 3S3GA 5HANA 4BQ2A 1FDYA 1O7AA 4TMBA 2W61A 1JYVA 2J75A 4XIAA 1KBIA 4X2PA 1MW0A 3GIMA 3S6DA 3NZRA 4RX0A 3ZT5A 3DG6A 5KFBA 2MANA 1V7YA 3GC5A 3PF3A 2I9UA 2HE5A 1UUMA 2CKRA 1D3HA 1A49A 2FFCA 4WXYA 5M1TA 3TCSA 3CV1A 4CQDA 4NAEA 3KHJA 4AIUA 3ZIZA 4NZ5A 1Z89A 2XVPA 3MCMA 3L5AA 2C1GA 1R7AA 3QM3A 2CERA 1JULA 5I09A 3RPMA 2OQLA 2QDHA 4LBSA 3WDIA 2YJQA 4QWEA 2F2HA 3ZJ6A 3CTLA 1XSJA 1T94A 4MY8A 1TJPA 3ARVA 3A5VA 1I0BA 1TIMA 2GSHA 2Y4SA 3NSMA 2GGEA 1CGWA 5AHLA 1VCVA 4MZYA 3HGSA 4G7FA 1Q6GA 1IEIA 4WGXA 2EHHA 2XM1A 1XSKA 3DCPA 2AGQA 1W37A 5CEWA 4NZCA 4QWBA 2QAFA 5AKQA 3WQVA 5HJYA 5ECVA 2VFDA 2CBUA 5LSMA 2PI6A 4Q8TA 4H9TA 5FAJA 3DHFA 3M0KA 3OOQA 3E96A 3L4VA 4M8UA 1UYQA 2YCLA 4R33A 3UA3A 3UR7A 5I3DA 1E6ZA 1O4UA 1J0IA 3DG3A 2B81A 3F2DA 2WANA 3OSNA 4I6KA 1TPDA 5CAHA 3BAIA 3EWYA 3CT2A 3LV6A 2NXGA 4W7VA 2VWSA 3REQB 3SR7A 1OFDA 1C8VA 3W87A 4H7VA 4JTIA 4MPQA 1I45A 1XIHA 3ITLA 2RDTA 2R8JA 4WJ8A 5HAOA 1W3HA 1M7JA 5KFUA 2WSQA 2W9BA 4DWSC 4C6JA 4FLOA 3T4WA 3W75A 1G4TA 1WBHA 3ZR6A 4EBDA 4QR6A 2Q01A 2PURA 2B7PA 5HUPA 1V6UA 3F4WA 6TAAA 1XRFA 1UR9A 3S5NA 2GJNA 2GWNA 3AHTA 3LPPA 3SRKA 2VZVA 1PZ3A 3R25A 5A8QA 2HXTA 3P2VA 3VC5A 4DWSD 4ACZA 3HG5A 1QT1A 3L5LA 1XH2A 4Y96A 1W3IA 1IIGA 3GH4A 3PFMA 2OO0A 1ZP3A 2WC3A 2GUYA 4IL0A 5FEWA 3WK2A 4PL1A 4PCPA 3GZAA 1UC4A 2NXHA 1E0WA 3V7PA 4OUIA 3D3FA 4PULA 3QRHA 2J7HA 3LY0A 4DJEC 1P48A 4OBSA 3BVJA 3CU2A 3OZOA 1KM6A 2DT0A 3KL0A 5AYZA 3M6YA 5BWFA 4RDZA 5D37A 3MY9A 4PMDA 1OCJA 3SUWA 3KOWA 4OBTA 3IIOA 3WLRA 3KWXA 3WH7A 1GJUA 3KVLA 3W7OA 2BGQA 2OT0A 2D73A 4F79A 1JDEA 4XISA 3WMBA 4GUHA 2QCDA 3A3XA 4DJED 2H6RA 2G5WA 1RUSA 3UETA 4QAWA 4R7JA 1HNYA 4AVFA 2NUYA 4CN6A 5T8GA 4B2DA 2X2GA 2J9YA 1YADA 1XBZA 2VWTA 3ITCA 4QBXA 2O9PA 4XZNX 4PMXA 2CLIA 1M04A 3C61A 4RXGA 4P61A 2ZUTA 1R3WA 4ZE5A 3TR9A 1TE1A 2Z2AA 1W9DM 3TQKA 3HF3A 1IT8A 5F9LA 4TXEA 5C9ZA 1MXDA 4YTSA 4QNEA 1AH0A 3BG3A 3DFYA 5DANA 1IGWA 3AOFA 3AC0A 3A64A 4ZQMA 3ONCA 4DBDA 4CQCA 5LNRA 3Q94A 3OA5A 3GG8A 1NFGA 1DEDA 3VIIA 3WY1A 3CHVA 3BK0A 4F0LA 2GZXA 4AWUA 2DVTA 2QIWA 4IUGA 2P9BA 5MF5A 1HP4A 1GVEA 1FQ0A 1CB2A 1JFHA 4JTKA 2TODA 3IVSA 3CZGA 4PUDA 2EPMX 3FYPA 1XLDA 3GSMA 4QSHA 4D1JA 1VS1A 1KCKA 3NQGA 2WWCA 3O0FA 3N1AA 2W92A 3ARSA 4OVXA 1RXOB 1GVRA 4Q4QA 5H2ZA 2J24A 1VF8A 3UWUA 1CNVA 5CPSA 1EC8A 1HP5A 4JEJA 1P6CA 1KNWA 3OHMB 4EIVA 3QZAA 5D38A 1R47A 1UWTA 3VZZA 2X0HA 1BKSA 3TYZA 4CD4A 1CXHA 4JTQA 3W7LA 3Q8QB 3UWEA 1F07A 4C6NA 9RUBA 3C2OA 2ACUA 1XINA 4JPGA 1EYEA 4G5DA 4IQJA 2VGBA 2G96A 2Z1VA 5EWGA 1OVDA 4Y9NA 4BS0A 3LX9A 4U7CA 1I2NA 2Z1KA 2PODA 1E5NA 4ONVA 5K9CA 1W9UA 3TK7A 5F2IA 1DPMA 3FN9A 1BQGA 3G22A 1BXCA 4FMVA 3Q37A 5AC7A 1C29A 1A0EA 4LNYA 3W3OA 2G4FA 1FTXA 2WSRA 1R3RA 3LV5A 1US0A 1QBAA 2OSYA 2B7OA 4QE4A 5IXEA 3G2GA 4J5NA 3RDKA 1I0DA 3PJTA 2GGJA 1E6QM 1UBPC 4YIWA 2DZXA 1CGTA 2OZ8A 1OFBA 3HQOA 3FSUA 3V3WA 1TPC1 3RK8A 4F48A 3WUBA 4M81A 4I6VA 1QI0A 3HPAA 1GEHA 4PUUA 1A5CA 1CW2A 3NO5A 5TNVA 4UTMA 3EYPA 3MI2A 3SUTA 1LRQA 2QJMA 3RO8A 3MBDA 2X8RA 4IMDA 1B0IA 2QKFA 3FEQA 3MUAA 4Q4RA 4XK2A 4LCSA 8TIMA 4CKQA 3CS2A 4NLGA 3P8JA 3TX9A 2WHJA 4C7FA 2A6LA 3RJYA 3PPHA 5A8MA 3ARZA 1ZFJA 5LA2A 2PDFA 3PWGA 1A3WA 2Y5EA 4L4OA 2FGLA 1JZ5A 4LWWA 1H5YA 5KFHA 3C0JA 2RDJA 4CGTA 4FP1A 3Q67A 2R8IA 3BCDA 4CNNA 1M41A 2IQTA 4IMFA 3GDMA 1V0KA 4HN4A 1K9TA 4KBXA 4NG3A 1IV8A 1L6FA 1FVPA 1WB0A 2X1TA 1HKJA 4CN4A 3UJSA 1JJKA 4IR9A 4F4XA 1VFOA 2PDGA 3DYMA 4CN1A 1SJDA 3ABXA 3EWBX 5I24A 3MFIA 4AFYA 4HQVA 3N3MA 4Q8MA 4O3OA 3LXBA 2GFTA 2C79A 4S3FA 5I3GA 1BXBA 2VEPA 2VI0A 5FKYA 2Y61A 4ED2A 4JICA 3H4XA 1AD4A 2FTYA 5T14A 3EWXA 4KRZA 4ZFMA 2OCZA 4W88A 1US3A 1XLHA 4BI6A 5RUBA 1GTHA 2O7SA 4N7QA 4DO6A 1G4EA 1VIWA 2CZDA 2VEIA 4J35A 4LCQA 2VGIA 2ODOA 3MMUA 3M9NB 2OMAA 2V3FA 4GACA 4WUIA 3AZTA 4N0RA 2CLHA 1WPCA 2OB3A 3GIPA 1EPVA 3OVGA 3R4IA 2A21A 1IT7A 2NX9A 3AISA 3WLTA 3KVJA 2D2GA 5KFLA 4C6KA 3QHMA 1KQYA 1UIOA 5B80A 3SURA 3N9RA 1UMYA 2V5BA 3MC5A 3ITGA 3PNUA 3T5LA 6XIAA 3SCRA 2HMCA 4MJZA 4BEUA 3LHUA 1JPDX 2ZA2A 5HULA 4MY9A 1H7NA 4LYKA 2A85A 2A7PA 2A1YA 1AMYA 1Q6EA 1EP1A 1V8EA 3QW3A 1V0NA 4OJYA 3I6EA 2QV4A 3RM8A 3VNIA 5DLFA 4FXSA 4H1ZA 3TOYA 3L9CA 3GNRA 3HFYA 2Z27A 3GDTA 4MNJA 2V5LA 2ISFA 2YXXA 3BDKA 1WUEA 3NOEA 3KVKA 3GVVA 4NX5A 4QW8A 2VZSA 3TXVA 4Q7NA 3KLKA 2RDXA 1TPVA 1LG1A 1JZ2A 5B7YA 1T3NA 1NF0A 1KO0A 2CHRA 3WZ0E 3KCLA 4NF7A 4GX8A 3KHHA 3CNYA 1O5KA 2VGFA 3XIMA 1H1NA 4Q8PA 1AW2A 1UR2A 4PBFA 4GUIA 1H62A 1QO2A 2YYTA 2IQDA 4ZSUA 1LL6A 3VNZA 2G3FA 3MT1A 2WJDA 3ZMRA 4IJRA 3M0XA 2PDQA 5HINA 4DEFA 1JCYA 1XLIA 1ZAJA 2FPYA 1B1YA 1Z48A 3CEPA 2C3ZA 1KWGA 3O2LA 3KZSA 3MS8A 4RK8A 1YIXA 1T0OA 2XJ7A 1PZ0A 4DNMA 2ZCGA 4PEEA 3BAWA 1T41A 4LF2A 3U2EA 2PS2A 3V1PA 1LWJA 3XINA 2WQPA 5KFVA 3TTOA 3V16A 3NQAA 3NQMA 4CUCA 3QY6A 4MNMA 1DJWA 4EEYA 4A8NA 2FGBA 2OLHA 2RGMA 2DFAA 4ORIA 4X2RA 1J5TA 3R8RA 1OCQA 3P61A 1NQKA 1XX1A 1QASA 5T9CE 4FS2A 3KRZA 2IPJA 1KC7A 3AIBA 2UBPC 4NHVA 3ANVA 5CBJA 2YLAA 2V30A 4H9UA 2WVTA 2ZC1A 2QIIA 2VFFA 1R86A 1M01A 1GVYA 3L67A 4QISA 5BOOA 3W53A 3VOHA 2CBIA 1TR1A 3MJYA 1ELSA 4ERGA 3DI0A 2BODX 2C15A 3LHZA 3GNXA 3K8KA 1W91A 4EVZA 3N11A 5L1LA 4PL2A 1W9XA 5AZ0A 3EA1A 3M9MB 3PVXA 1XL9A 3BJTA 5EFDA 3B8DA 3R11A 1CIUA 2O9OA 1DORA 2W0UA 1X1ZA 5D2XA 1J10A 4H8NA 2OR2A 1XDLA 2INZA 3A4XA 4AZBA 4QLKA 2JEPA 4ACYA 3RRAA 1REQB 4BWLA 5LIUX 4QDPA 1HQTA 3DFNA 4B4FA 2Y63A 1TVPA 3ICJA 4WGHA 1E72M 3MP4A 2EPHA 3CL6A 4UOZA 2E8ZA 4R9XA 3NL3A 4M6VA 4PTXA 3K5XA 1PTAA 4JQ4A 3P14A 1J5SA 2QVNA 3VPLA 3LCGA 3WLKX 1U2YA 1ZBVA 1B9BA 2QDGA 5KFZA 5DN1A 4CCCA 2BGSA 2ZUMA 1K6WA 1XLBA 4MFEA 3GDRA 1PX4A 3ZO9A 1L2QA 2GJRA 1SZNA 4J9MA 1WV2A 2V9DA 1V03A 3T1GA 1AQHA 1QTWA 3EX1A 3DHPA 4O18A 1G4PA 3W01A 5LIWX 3SCTA 3S1XA 4URIA 3WLLA 3K13A 1FWIC 1TUXA 5A8GA 5H1WA 3U48A 3S9YA 4UTWA 3APTA 2IKJA 1DWIM 5CPLA 3T78A 4JV2A 3KP0A 5BRPA 4QDMA 1RPXA 3VNDA 4NZ1A 1JZ3A 4ENLA 2R1KA 3FIGA 3GHRA 1CGXA 3WFZA 4Y6GA 1KLYA 1A80A 3WCZA 1JDFA 5G2IA 3UWYA 3U6WA 1KM5A 2B0MA 3TQ1A 3IV8A 1H41A 5J8LA 1MI3A 2Y8KA 3CQ0A 1TTIA 5K4XA 2CC0A 4K1WA 3A22A 3P8IA 1PSCA 3AHYA 3C8NA 5HDRA 4I7WA 2OH2A 1DJIA 4ACZB 1OK4A 3WYZA 3PTQA 5JU6A 1VKFA 3IJ7A 4JTCA 2V3DA 3HTWA 4JKKA 5XIAA 4GVFA 3H21A 3PW4A 1V6WA 3PBYA 4B90A 5KFIA 1XYCA 4UTTC 3WN6A 3ANYA 4AZCB 4KWSA 5DG8A 3BQ1A 1B30A 4I90A 4XZHA 5H91A 5LZLA 3VZYA 3VNYA 1H3GA 3S47A 3FS2A 3GNOA 2O9TA 3VIGA 4DYJA 4QCEA 3EOSA 4GJIA 5I07A 4GCAA 5G5IA 4CQBA 3EPIA 1LUCA 1X39A 3TR2A 1F5ZA 3WF0A 3G1FA 1S2CA 3VU2A 2X1UA 6XIMA 3ZOAA 5DMLA 3G1RA 3KX6A 1NELA 4JTSA 1S3HA 1PPIA 3FVMA 4MWAA 4QEHA 1GKRA 1DIDA 1BVZA 1LQ2A 3AUOA 3W83A 3GXPA 1VLIA 4LYRA 4NAFA 4MNLA 5CGTA 1OZMA 4M7SA 2A3CA 1FXPA 1IR2A 1LOQA 3CTTA 4K68A 4EYHB 1ADDA 1TWWA 3IIPA 3MMDA 2XFFA 5CZJA 1ME8A 4Q7BA 3KHLA 2XVNA 1FP9A 4WSHA 3CBWA 4IFRA 2IUZA 1N56A 2YX0A 3PVFA 4MFDA 1BD0A 1BFNA 4DJDC 3FV9A 3M47A 5A1AA 2PWGA 3S1VA 3BAYA 2G95A 3HO8A 4OE7A 3BURA 2AMGA 1CYGA 1ZETA 3HPZA 4BEQA 3ZWSA 3LRKA 4XSLA 2HWGA 4KCVA 4QCFA 2WM0A 4ZCWA 4LV9A 5HOSA 4HSNA 3GS6A 1I2PA 2VC7A 4GXPA 2ZRXA 3EPNA 3QFWA 4WKHA 3RGTA 4DJDD 3TYCA 3NXFA 2JBMA 3NSNA 3PW2A 2XZ7A 4OZOA 2R8HA 3BMWA 1XYMA 3UF9A 3M44A 1NTHA 4R53A 2XPKA 3C5QA 4RE3A 1K8YA 2NV9A 4GIEA 1JVNA 4OKDA 3B04A 3VDGA 3PP7A 3WDJA 3FAWA 2QDDA 3FA5A 5EPDA 4JX4A 3W22A 3VOGA 1OINA 2EPOA 3OQ8A 4JXCA 4LVFA 2EF9A 1IEWA 3AIEA 3WUEA 1TZ7A 1ODZA 2DY3A 2JEGA 5CGMA 1KRCC 1UD6A 3CC1A 2XISA 3WQ8A 2EXOA 5FESA 1J0JA 4JV1A 2Z4GA 3TTEA 3TFXA 1RPKA 1FDZA 5KMYA 3S2MA 4H9VA 4UCGA 4IMCA 5KFTA 5HMFA 4Q6JA 3GTIA 1VC4A 1GTEA 4E3TA 3GC4A 3WUFA 3VOFA 4V28A 4LCRA 4DQWA 4JTAA 4W7UA 4ZB2A 1D7FA 1JUBA 4DZ5A 3NG3A 4UNIA 1T6MA 1TV2A 3LHTA 2JEIA 1M5WA 1XLMA 3STPA 3ALFA 3UJFA 2PDUA 3BUVA 4HSHA 4E8GA 3JU2A 1IWAA 1E9ZB 3MUCA 3ZS4A 4LYQA 4KW2A 2J66A 1GOQA 2ZICA 1PIFA 1JGIA 3M1ZA 3B8WA 1XH1A 2WC7A 2UVUA 4O50A 1BVNP 4NYUA 3AYVA 3OSPA 1RVGA 1ML1A 4UFJA 2J27A 4OBRA 2W79A 4JV0A 2X16A 1E15A 3WD0A 3H55A 4QIUA 1TKKA 5IOBA 3QPEA 2GOKA 2BMBA 5AVNA 4GA8A 3LENA 4LANA 3B4UA 1GW9A 3SGGA 4TR9A 3F2BA 4XAZA 1BF6A 1KFCA 1MVYA 3AZRA 3SSZA 4MZ8A 3D6NA 4R5EA 2P8BA 3EMCA 1PDYA 5J5RA 1DXEA 1PCKA 2IKGA 1SQ7A 3W7NA 4CEXC 3ZR5A 4KCTA 1EA0A 4LUSA 2E68A 4L9ZA 3ZLFA 3LA4A 1NWTA 5KFFA 2J6VA 2NQLA 1XYLA 1RR2A 2Q3RA 5I7GA 4MADA 2B7NA 3T0DA 2QHAA 1SO3A 2RFGA 2QUMA 3TLLA 5I6SA 2GVGA 2YXGA 2BOFX 2I56A 4L6HA 3KEHA 4UQEA 2FTPA 4IIEA 1VFUA 7PTDA 3S6OA 1AQ0A 3DFTA 1QPKA 3DX5A 4GUJA 3CZKA 4DBEA 1PTDA 4FLRA 4QJ5B 1AQFA 4FXJA 5ABGA 3W2JA 2Y88A 4DB7A 4Q4MA 3LB0A 1Q8AA 4WRHA 4XVEA 2DIKA 1VBRA 2EAWA 3STFA 2PU0A 3SCQA 4Q4OA 3BANA 1UKPA 5K7JA 4J27A 4CNOA 4AWTA