1J6PA

Crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
407
structure length
407
Chain Sequence
HHMIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (TM0936) from Thermotoga maritima at 1.9 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords METAL-DEPENDENT HYDROLASE OF CYTOSINEDEMANIASE/CHLOROHYDROLA
total genus 132
structure length 407
sequence length 407
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1j6pA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6pA02
3PNZA 2AMXA 3MPGA 2R1MA 2FFIA 1FWJC 1FWAC 4XAZA 2Z7GA 4C6FA 4GY7A 3AUOA 4PCPA 4GXWA 4CQBA 2QT3A 2ZC1A 4LEFA 4AC7C 4C6BA 5G4HC 4G7EA 4IF2A 4CQCA 1EJXC 4BJHA 1UBPC 1GKPA 1P6BA 4ZSTA 2GSEA 1FKXA 2Z4GA 4LCSA 2G3FA 2FTYA 3ORWA 1ITQA 1E9ZB 3QGAC 4PE8A 3GUWA 2Z29A 3IRSA 4J35A 1V4YA 4P5UA 3GGMA 3G77A 2R1NA 4V1XA 4H9XA 1ADDA 4RDYA 1GKRA 3MTWA 3E38A 2BGNE 1R9XA 1YRRA 1FWDC 3S2JA 4H9VA 4C65A 2ANUA 3HTWA 4J2MA 3UBPC 2AQVA 2F6KA 3HPAA 3URAA 4KIRA 4XD3A 2XIOA 3EWDA 3OVGA 1FWEC 3F2CA 1RK6A 1V7AA 3TN3A 4G2DA 4RDVA 4IFRA 3S2MA 1EJVC 3T8LA 1M68A 1EZ2A 3RYSA 1XRTA 3QY8A 4DO7A 1ONXA 4JOMA 4BKNA 2GZXA 4H01A 3IARA 4XD6A 4NG3A 1A5MC 4LCRA 4RDWA 1FWBC 1W1IE 1UIPA 4KERA 4F0LA 2ADAA 4C6JA 4IGMA 4ERAA 1PO9A 4C6QA 4G7EB 1RA0A 2O4MA 1R9YA 2OQLA 4BY3A 4HA0A 4LCQA 4B91A 4B92A 1NDWA 4LAKA 2HPMA 4C6MA 1NDZA 4H9TA 3A3WA 2I5GA 1A4MA 4HK7A 4C5ZA 3BE7A 4QTGA 2QPXA 3NURA 3GIQA 4C6EA 4ERGA 4LANA 2Z00A 3DUGA 3PNUA 2QVNA 1O12A 5CH9A 4F0RA 2A3LA 4GX8A 2UBPC 1ONWA 3ITCA 3PAOA 1J79A 3WMLA 4B90A 4DNMA 4H9ZA 2P50A 3LU2A 3GTIA 2Z27A 4R85A 4DLFA 2Z25A 4GZ7A 4LALA 3FEQA 1V51A 4KEZA 4TQTA 4IG2B 3LNPA 3UR5A 1POKA 4C6LA 2Z24A 2HPIA 5AKQA 4WHBA 3URBA 1A5NC 5HMFA 1J6PA 4PBEA 2R1KA 4GY1A 2QS8A 3GRIA 2IMRA 1PSCA 3OU8A 3B0YA 4RDZA 1VFLA 1EF2A 4C6OA 2Z2BA 1WXZA 4LH8A 1KRCC 1FWFC 4DI8A 2WM1A 3LGDA 3AU6A 4KF1A 2R1LA 4EPKA 4IH3A 2VR2A 3F2DA 4YIWA 4NI8A 2WJFA 4DI9A 4GK8A 2HBXA 1EJTC 4I6VA 4HK6A 3GTXA 4R7WA 4C6KA 1ITUA 1UMLA 3K2GA 4KESA 3IPWA 4QSFA 2D2JA 4H9MA 1FWCC 2FVKA 2PAJA 4ZSUA 4ICMA 4QRNA 2RAGA 3LY0A 4GBDA 3TN4A 2HNHA 4IFOA 1J6OA 4RE0A 2OB3A 3S2NA 3GU2A 4XD4A 1QXLA 1FWHC 3OJGA 3PBMA 3TNBA 3SFWA 1S3TC 3LSCA 2W9MA 3R0DA 4CNSA 4XAGA 4NP7A 3MSRA 4PBFA 2UZ9A 2ICSA 3MVTA 1V79A 3T1GA 5FSEC 2Q09A 3DCPA 4LAMA 1EJSC 1NDYA 1A5KC 3F2BA 3K4WA 4WGXA 4DZHA 3LA4A 3OOQA 1P6CA 1V77A 1M7JA 3GG7A 3E74A 2KAUC 1UIOA 4DIAA 2D2GA 1K70A 3URQA 1A5LC 4KEUA 2VM8A 3IJ6A 1I0DA 3LSBA 4EP8C 4XAFA 2YB1A 1FKWA 3S2LA 3TN6A 1EJUC 1XGEA 2EG6A 1O5RA 2GWGA 3EGJA 3GIPA 2CZVA 4QS5A 2VC7A 3E0FA 3GU1A 1PTAA 3MJMA 1FWGC 4EPDC 3V7PA 4C5YA 2AQOA 2D2HA 4KETA 3E3HA 3ICJA 2HBVA 4LAOA 2Q01A 2E1WA 3UPMA 2DVTA 1A4LA 2I9UA 4B3ZA 3ISIX 4CEUC 1P1MA 4GY0A 4WVXA 3B40A 1I0BA 3K5XA 4IG2A 4I6KA 4UB9A 3MKVA 3O0FA 4D8LA 4F0SA 3S4TA 4E3TA 4DYKA 2VHLA 3F4DA 4RZBA 3UF9A 4EPBC 1E9YB 3T81A 2Z26A 2VC5A 4C60A 5FSDC 2DVXA 5LXXA 2Z28A 4C6PA 3E0LA 3IV8A 3IACA 3CS2A 1XRFA 3RN6A 4GX9A 4PCNA 3MDWA 4DZIA 4HJWA 4ERIA 1ZZMA 3E2VA 4XAYA 2GWNA 4IGNA 2PLMA 3IGHX 2EG7A 4EPEC 3TN5A 3OODA 4V1YA 3EWCA 1WXYA 3HM7A 2OGJA 4H00A 2R1PA 1BF6A 1RJPA 1K1DA 3O7UA 4QROA 3QY6A 2WJDA 4QS6A 4CNUA 3GTHA 4KEVA 4R88A 1KRAC 1YBQB 4MUPA 4GOAA 1RA5A 2FVMA 1RJQA 2P9BA 1KCXA 1KRBC 3MDUA 3GU9A 4C6NA 4CNTA 2GOKA 1RAKA 1EYWA 4IFKA 1QW7A 3QGKC 1NDVA 4AQLA 4DLMA 2VUNA 4UBPC 4H9UA 2E25A 2DVUA 2EG8A 3LGGA 2BB0A 1YNYA 3ID7A 4GC3A 1IE7C 2PGRA 4C6CA 2HQAA 1XWYA 3AU2A 4H9YA 4L9XA 2O4QA 3QY7A 3KM8A 3C86A 3OQEA 1DPMA 4L6DA 3N2CA 1KRMA 1PB0A 3RHGA 3A3XA 3B0XA 1K6WA 1POJA 3LS9A 4XD5A 3RCMA 4KQNA 2YZ5A 3CJPA 4IQJA 4IFKB 1RK5A 2YB4A 4Z42C 1EJRC 3URNA 3A4JA 3NQBA 3UR2A 1YIXA 3F4CA 4INFA 4GYFA 4HK5A 3SO7A 1FWIC 2Y1HA 3WYZA 4C6IA 1GKQA 1EJWC 3D6NA 3GTFA 2FTWA 1YMYA 4C6DA 1YBQA 4OFCA 1M65A 3MVIA 4CEXC 1R9ZA 2OOFA 1RJRA 3JZEA 4M51A 4LFYA 4J5NA 3FDKA 1A5OC 5HMDA 3DC8A 2PGFA 2YXOA 2PUZA 2WJEA 2P53A 3CAKA 1JGMA 5A6TC 5E5CA 2Z2AA 3WZ0E 3PANA 2OODA 1NFGA 1HZYA 4CQDA 5HMEA 3NEHA 1J5SA 3FDGA
chains in the Genus database with same CATH superfamily
4HPXA 2J8TA 2DZAA 1FWAC 1W1VA 4ATWA 4W8LA 1HL2A 1BVZA 1S39A 3CUFA 2PRHA 2C14A 1N7KA 5EMMA 5M3WA 3P5ZA 1EQCA 4QJ3B 3L4XA 1FWTA 1ZJBA 1P6BA 1B30A 1ADOA 2G3FA 1KCLA 2CFFA 2GUBA 1CENA 2WZHA 4O12A 2YKKA 4IQLA 3IRSA 3BAKA 5FF4A 3AUJA 4GVGA 3K8LA 1L0PA 3IGXA 1YRRA 3UU0A 1P6WA 1VYSX 2CHNA 3P8IA 1K8ZA 1F3TA 1F4HA 3WDHA 5KSWA 3E2RA 5D2YA 2AMGA 5FF7A 2X7VA 4DJFC 1V3HA 1G01A 3RLHA 2WPBA 1W8SA 1EJVC 1M68A 2PLCA 3IIOA 3TVAA 3WQ4A 2PC8A 3BLOA 3TLLA 2A2IA 4UTMA 3CQJA 2VX7A 4UTUA 2PDLA 1LF1A 3QQ1A 1BTMA 1CI1A 3W74A 3GY1A 4Q4OA 2RFGA 4M3PA 1US0A 1SJBA 4KWSA 1V6TA 1EWDA 3A47A 5CSUA 1MZHA 3OVPA 1UIPA 3I68A 1M53A 4S39A 4PH6A 3EPNA 3UJRA 5FEWA 5BOOA 1Q63A 2ISDA 2EPMX 3AWNA 4JL1A 4EVZA 1NAL1 5E9AA 3RK8A 3QLDA 1JDFA 2G97A 4YVVA 4LCQA 5CSYA 2W91A 4TMBA 4QFUA 2AQWA 3Q8RB 4HQVA 1E73M 3S0CA 2AL1A 4Y90A 5HJXA 1CB7B 3A23A 3W2JA 3GDTA 4P2VA 4IPIA 4QTGA 4A3RA 5A6AA 5AYZA 3BLDA 3A4XA 2ASLA 3DFSA 1Q6FA 2QVNA 4LVFA 1QHZA 2YCJA 3AIVA 4URIA 1G6CA 3CWOX 2B7NA 1J79A 1R2TA 1JEZA 2W8LA 1WUFA 3WLQA 1IXQA 4A6GA 2Z27A 2FLLA 4HYKA 4Z08A 1XINA 5REQB 1DVJA 1W2PA 1T5AA 5LYRA 4QDWA 2Z7KA 5AHFA 3QOKA 2ISWA 1E71M 9XIAA 3S47A 4REQB 2FGBA 4B9ZA 1JL8A 4Y9AA 4KF1A 2XGBA 2R1LA 4LBUA 5DT7A 1VEOA 2ZRXA 3R8HA 1XH1A 3B8WA 4DI9A 1DJXA 3VXGA 3WL0A 3W7OA 4N9DA 3LK6A 2HZGA 3UW6A 1GNXA 5BXSA 2HVOA 5C55A 3VNDA 5I0DA 1E6PA 2V5LA 3QW3A 4Y9MA 2HK1A 2V9DA 1NM9A 3PTDA 1E43A 3CO8A 3CUZA 1ADSA 1G4EA 2C6QA 3NZQA 2C2DA 3TN4A 3MS8A 1UZDA 2WQPA 4RZRA 5CAHA 3VIOA 4DL5A 4HNTA 5LIKX 4PMVA 4ECLA 3WJSA 1AL7A 4I9TA 2ICSA 5FSEC 2XIBA 1X38A 1MEHA 3A24A 4BZYA 4PSRA 4W4QA 2NUXA 5HNUA 1XQLA 5IBXC 1GYLA 3CV6A 1PDZA 4DIAA 4X61A 4HZ8A 2V3EA 2EHHA 2PWVA 3ES7A 3CZ8A 5A1AA 2WMGA 1TQJA 2V3GA 3NQ2A 1KC7A 3I6RA 3VC6A 5H8UA 2C2EA 1HJWA 4C7GA 3UG5A 2WMJA 5EMYA 4QS5A 1E0XA 2PDYA 1W3NA 1DWAM 2ZWZA 3TEVA 3V7PA 1CBGA 4RE3A 5KFZA 3E3HA 3GO2A 2X09A 5CPNA 1EDQA 2HTMA 2WVVA 3T40A 1E4LA 4TV5A 4DY1A 1OC5A 5K7JA 4HGXA 1W2VA 1QPKA 2PCEA 3CXOA 3NDYA 2HMCA 2PLKA 4ZENA 3V0SA 3V1HA 3PTQA 4JX5A 3SCUA 3AMCA 4C60A 1TJ0A 1ELSA 4ZO8A 1GQJA 1JNEA 1I2NA 3IACA 2V8ZA 4HU4A 4WXYA 3V18A 4HJWA 1DIDA 1W1B1 2PSNA 4P61A 3V6KA 4HCLA 3M1ZA 4P8XA 2QV5A 1LBFA 2R1PA 4CD5A 2PP3A 3N3MA 1E9LA 2WB5A 2C71A 1HP5A 3ES8A 1F73A 1VD6A 4XBKA 3MP5A 5GQBA 3TYEA 1VPXA 3OVQA 2HXUA 2RDTA 3MUZ1 4KEVA 1KCXA 4N02A 4AZ5A 2F38A 5F4SA 4CNTA 3FYOA 3W28A 2YIHA 1EYWA 1WZLA 5A8QA 2ZCGA 1UKPA 1CTNA 3ZM8A 4F8XA 4AQLA 3NDOA 3M0YA 3BJTA 4DJDD 1L6GA 1J18A 4EX4A 4C6CA 3BWWA 2VCAA 2VOMA 1T40A 3PUGA 1FDZA 1UP2A 3K30A 5C2XA 3T6CA 2R8KA 2XGZA 1DIKA 5HQLA 3LHVA 3N18A 3MA8A 3HQ1A 3G6LA 3IUDA 2FMOA 4IQEA 1EF3A 1X96A 5AZ0A 1SJCA 4KQNA 1HTIA 1MQRA 4C7DA 3GYCA 3MWAA 2FHBA 4Z42C 1K03A 2BGQA 4TU1A 5HWJA 1OY0A 1VJSA 3PZPA 2DT1A 2CITA 3IVTA 3G5EA 2C79A 4HPJA 5KT5A 1KB3A 2OT1A 3DI0A 3APTA 3ITTA 3ZR4A 3MUAA 5B80A 2R6OA 4AIUA 1KA9F 1TIWA 3RM4A 3RCYA 1I2PA 5CC6A 3UA4A 2Z1SA 1LLWA 3H54A 4M51A 3V6JA 3BJYA 3AXMA 4LC8A 5I5RA 4PTNA 4UFJA 5CBBA 3SUSA 3RR1A 3M9OB 5A6TC 3NSMA 4JIIX 1MFVA 1VYPX 2QDGA 3T5JA 4XWUA 4NL1A 3PANA 1OT1A 2VGBA 5LNVA 1O1ZA 3HN3A 3NEHA 3THCA 4QCEA 4GCXA 1P7TB 3NQMA 1H41A 1H11A 1YQ2A 1A53A 1FH9A 3GH4A 4D9PA 3TA6A 2Y5EA 2J66A 3CHVA 2TSYA 4ECRA 3RM9A 1E70M 3R8RA 4N6EA 2VI0A 3RB3A 4FSAA 1I1XA 2WVTA 5JMUA 4PE8A 1YLVA 2VEMA 5AYIA 1H50A 2EEXA 2YBTA 4L1GA 2DZBA 4MY1A 2Y7EA 2VWSA 5IXEA 1NELA 4DBSA 3GQCA 2VGIA 1VR6A 4EKJA 3RPDA 5CJ5A 1SZRA 5BROA 1TV5A 2ZUUA 3F2CA 1QBAA 7TIMA 3TN3A 2FB3A 1XM3A 4K8HA 5FEPA 1OFPA 2XYLA 1OFDA 3P62A 4JOMA 2PDFA 2WMIA 3KTCA 2PWFA 2P0OA 1NSJA 1BGAA 2Y24A 3R12A 2C8NA 1QPQA 3KWSA 3KFTA 4M82A 1NEYA 4PMUA 1QOPA 2WPGA 3GDMA 4F0LA 4NU7A 4OT7A 2WYSA 1KTCA 4C6JA 3R2GA 2OZ3A 4L61A 5C7VA 4ECZA 1NWTA 2W9BB 4TIMA 3T9PA 4RPPA 3RB4A 1LWJA 4PUUA 4LUIA 4MWAE 3VM5A 1EC8A 5KFDA 3NM1A 1R5YA 4C5ZA 2JEPA 1M3UA 3H23A 1YDVA 3R4IA 4ZVJA 1K7EA 4JQ2A 3EXRA 3TCEA 4YTUA 2W9AA 2O7SA 3VNIA 4R85A 2OLSA 3FEQA 3KOFA 4IGHA 3WBAA 4L7ZA 3LNPA 3OSNA 3UR5A 1BVNP 2ZTJA 5AKQA 1FHVA 2NVAA 2UY4A 3PR2A 3GRIA 1PSCA 5C9ZA 3LTSA 4D71A 5E0KA 4C1KA 4UTWC 1VYRA 3UG4A 5IRPA 3KHLA 3M44A 5BXPA 2EJ1A 5DQGA 3OHBA 4OZOA 2ZZ6A 3SY1A 3WF2A 4FNSA 4N2YA 3G24A 2GDVA 1Q6QA 3U5YA 4HK6A 3JW7A 5REQA 1R2SA 3TFCA 1E3XA 4AD2A 3BW2A 3IUIA 1WX0A 4WJ8A 1PKMA 2PP0A 3AHVA 3NR0A 4FX8A 2IQTA 1SO3A 3XIMA 3LRLA 1VIZA 3SZ8A 1JQXA 3W72A 4PUKA 4XIMA 1J6OA 1EH9A 2Q71A 1OK4A 3VKAA 3WDIA 4H6RA 4H83A 5A8MA 3TNBA 3WJXA 4OQVA 3D0CA 1H7XA 3AISA 4D6GA 4PGLA 2J75A 3WBXA 3PTMA 3F2BA 3MMTA 3RITA 1DJYA 3MR5A 2ZUMA 1JCYA 1AQMA 2UY3A 3W83A 4N9BA 2BHUA 3IWPA 3G1YA 3OG3A 3F5LA 1XRVA 1T8QA 1H51A 4AZCB 2J6TA 3CZJA 3RO8A 1TX2A 1RP8A 2ABAA 1S2VA 3V36A 2VEPA 1EXPA 1EJUC 1LWHA 1CXLA 1A0CA 3A4WA 3SCRA 5CEWA 1QT1A 1G0CA 4P7RA 5C54A 2DIJA 5KFGA 4IIEA 3OGVA 4D6CA 1TPDA 1YKWA 2IPWA 2DVTA 4Q8VA 1BD0A 4QP0A 5BZAA 2JKPA 3WL1A 4K8GA 2GOUA 3I7QA 3HGOA 4JTKA 1IF2A 2DZUA 3FLUA 3AXXA 5DY3A 4RZ6A 3H70A 2PFHA 1RBLA 2X1TA 5A6JA 5JVLA 1XRFA 1JZ3A 4MB4A 1PE1A 5AC8A 3PR4A 2E40A 5BRPA 4ERIA 1O68A 1KFEA 4CN1A 2EG7A 3UCCA 3IVUA 1D9EA 2WSRA 2G3MA 4WDTA 4RUCA 4MG4A 3TE9A 3W87A 3GUGA 5H6HA 2YR1A 3NYDA 4LVBA 3GH7A 4DL7A 4AY1A 4KWVA 5FJOA 2VT0A 2FQIA 3V6HA 3RILA 3I65A 3PFMA 4H2CA 1XF0A 4LSBA 4M6QA 4DJEC 1QW7A 3UZ5A 3TZNA 3W84A 4DL3A 2Q6ZA 2J25A 2YYTA 2ODOA 1RPXA 3C2OA 1YNYA 3CQ0A 3HJEA 4NJKA 2WJZA 1LJYA 3MCNA 2BMBA 4P8WA 1JX4A 1DWJM 3QY7A 3OQEA 3W1NA 3DI1A 2Z1XA 7PTDA 1PBGA 3CAQA 3A3XA 1K1SA 5LIXX 1D7FA 3PVFA 4WK9A 3UR2A 1KR1A 2QDDA 3SJNA 1E5JA 1XGZA 5G1MA 1UZHA 2Y7GA 3R0KA 5EFDA 5C70A 2FLIA 2DT0A 1CW2A 5KT3A 3UVIA 4W7VA 4OFCA 1M65A 1C9DA 2PDUA 1VLWA 2VDGA 2Y7DA 2WXDM 2OOFA 3WH9A 5KFEA 3ARXA 2Y0FA 1PX3A 2OSXA 1LG1A 5HR6A 1Q85A 3KRBA 2VGGA 4MF4A 1PZ1A 4QWEA 1RLDA 2YCLB 3UYIA 3TSMA 4FB7A 3H22A 1OEPA 3R13A 5D02A 1R8LA 1T99A 2HSAA 2MANA 1GG0A 4YTQA 5I3JA 4XBJA 3AUOA 1SW3A 3SADA 2OG9A 5FACA 1L8NA 3WLIA 4ZGYA 1GZ1A 1XLGA 1XD1A 2BZNA 3WEMA 4XIAA 3BSGA 4NLGA 3TC6A 3T09A 2ATMA 1CZ1A 4OUIA 3THUA 4GD0A 4W88A 4AXNA 1QCWA 1MEWA 4P5UA 4IIDA 1UPPA 3SR7A 1W3IA 1UUOA 3THDA 5T91A 4FIQA 1ITXA 5FCZA 4ZE5A 5KT7A 4HNVA 2AGQA 3HFYA 2LLEA 3OIHA 3WBEA 2WSQA 3O6DA 1EP2A 3M7WA 1V7AA 3ABQA 2ZXBA 3CL6A 4XO7A 3QKZA 3BANA 1S5VA 3KVLA 4UQBA 4DAFA 2R82A 1H7OA 3RPMA 5A6LA 1FQ0A 5LSMA 1LT7A 1XYLA 1ECEA 1W3LA 5KG0A 1F6PA 1ZQ5A 1O95A 1XYCA 3LCHA 3WK0A 2GQAA 6ALDA 4E38A 1CLXA 1EGVA 3F1QA 3MANA 4KS0A 3H2CA 4LAKA 4FS2A 2QPSA 4GZEA 2NX3A 1KXVA 1XCXA 3GR8A 2BOGX 3IAQA 3N15A 4MADA 2CZFA 3L2LA 5FA5A 3QVQA 3KVMA 4O1BA 3WK3A 3CT2A 4FR1A 1PAMA 5KFYA 3DBPA 2P8BA 5H8PA 4B15A 3UQNA 1LL4A 1IZKA 2I5QA 3N4AA 3HURA 3MR2A 1XIEA 1AZ2A 3TFXA 4WHBA 1DJWA 2D0HA 5HMFA 2WVUA 1OIMA 3KZPA 4JEJA 2CETA 1XLHA 4KWUA 2RGMA 5L1IA 3W25A 3CL7A 3KP1A 2DFAA 3H4XA 2DIEA 3W7IA 4A05A 4P7LA 3SURA 2O7QA 3NQCA 1DEDA 1ECQA 3SUWA 1TZ9A 1TCMA 2DSZA 4AWTA 3IPWA 1GPWA 4I7VA 2NXIA 4HKPA 3WJWA 3N6QA 4B2DD 1PPIA 1TPWA 4H8NA 3ZVHA 1CXHA 4ZOAA 2NLIA 4IFOA 3KBNA 1XGDA 3ZSSA 2VKZG 1FWSA 5BYWA 4IXXA 3GG0A 1S3TC 3W27A 3CM4A 5BXTA 4EANA 2FGZA 5CC3A 1V79A 3DEQA 3L4WA 2D69A 3GXTA 1EJSC 2WMFA 1PTDA 1DORA 1P6CA 3AIWA 1JCXA 3APGA 3LBCA 1AQFA 2OQHA 3U4FA 5JUVA 3SN1A 1XLCA 2D2OA 3RJXA 6ENLA 1D3GA 3S2LA 3F5JA 2OO6A 1ZP4A 3G3MA 4GNVA 4MB1A 5DMLA 2EPLX 4O8AA 5I3FA 5D2WA 4WF7A 4TVCA 1IXOA 3NQGA 1GOIA 1QK0A 4KCTA 2YLAA 5LA0A 4Z2JA 4H41A 3GDRA 4IM4A 4DXVA 2C15A 4M19A 4AISA 3ARQA 4W85A 2BQRA 2YDSA 1W1TA 3K5XA 3MKVA 1G94A 2VTFA 4EEYA 3GLCA 1R3RA 3NVTA 1HGWA 3U2ZA 2QUNA 2YPIA 3LB0A 4J3UA 3KRSA 1XLIA 1C7SA 5IDIA 5BRBA 4M56A 3AMGA 4RJEA 3O6YX 3IGHX 3P80A 4J3ZA 1VPQA 3TROA 3V1PA 2FTPA 3BLIA 1UMYA 3OODA 2ZUSA 3BAXA 3HM7A 4EOUA 4GQBA 3VDGA 2E1DA 2QGHA 4JTFA 4L4LA 1IWBA 4R8UA 3WLNA 5M03A 3V35A 1MXGA 4A8NA 4IICA 4WZHA 3DZ1A 1JXKA 1IZJA 3VNYA 1KRAC 3E9AA 1JQVA 3AZRA 4AYGA 1S0MA 1KRBC 4IIGA 2J6UA 3DH7A 4QW9A 1FFQA 5G1TA 3S1VA 5HWNA 3EMQA 2POZA 3QJAA 4NAFA 1A5SA 3O8AA 1BG4A 3AS2A 2DVUA 1WBJA 1H7WA 5GNXA 3L2MA 1XWYA 1QNSA 4RL3A 1D3HA 1O5KA 5A8NA 3LM7A 2VZVA 3AXHA 1ZHAA 3VZXA 3TH6A 1I6NA 1N55A 3S6TA 3IN5A 1J5TA 4O0KA 4UCFA 3LS9A 2F84A 3FGCA 1HVQA 4S2CA 3RCMA 2WC4A 4F4RA 1UUQA 1XV8A 4MNLA 1HKVA 3URNA 4E6MA 3HFTA 2E5BA 1LZOA 1HL8A 1HJQA 2G5WA 2GJXA 3BLLA 2Y1HA 3L7RA 1EJWC 4GQGA 4GJIA 4AWEA 1G5AA 1KWGA 4XO6A 1R9ZA 5AHLA 4HHLA 1ZCCA 4WR3A 3S1WA 4WD0A 1GCYA 3W7JA 4R9OA 3E2QA 1Z32X 5DCBA 3FDKA 4HTBA 1LLZA 3CAKA 5KT4A 2XFFA 2I1OA 3NGFA 1TRIA 2FLPA 4IUOA 2DT2A 3VE7A 5CBJA 4FHAA 4PRRA 3IIZA 2PEVA 2DJLA 1J96A 3PNZA 2ZWYA 3JRKA 4AIEA 1W54A 1TWSA 3L4TA 4XQ6A 4CNOA 3BSMA 2PDGA 4Z1YA 3O06A 4C6BA 4DAIA 3ZZ1A 4DYEA 1UWRA 1XYBA 1IGSA 3HJZA 1GKPA 1K02A 3LYEA 2WMKA 2KZHA 2FTYA 5DRCA 5A2AA 2YGYA 5I7GA 3ORWA 1PCKA 1WZAA 1WKYA 3L5LA 3AHTA 1ADDA 4H9XA 1QW8A 2YL9A 4JIHA 2AQVA 3WQDA 2F6KA 3B0PA 1E40A 3W2UA 1PIIA 4LVAA 3W23A 2YFOA 2W61A 3ZJ6A 5LHEA 1L8PA 5MKGA 1O94A 3M9YA 3G6MA 5C9WA 4S3AA 4A21A 4XUYA 1XG4A 2F2KA 3VMNA 4KKXA 4KFPA 5AB3A 3K1GA 1EX5A 4GNKB 3CQKA 4XD6A 3BLFA 1E56A 1BVWA 4RDWA 3M5VA 4DNHA 1JYNA 4ZO7A 1S10A 1LT8A 4PMNA 3CUJA 3GYEA 2HNEA 4O14A 4ZQOA 1RA0A 4HNUA 1HJVA 2PRLA 3KHHA 5KETA 4UQCA 3PN8A 2WC7A 4LS1A 1V0LA 4MNJA 1DL3A 2HPMA 5J04A 4E3VA 5KFWA 5KFMA 2RDJA 3MBDA 1ZJAA 1M41A 4PODA 4G3IA 4H9TA 1RVKA 4S3EA 1HX0A 4DUXA 5I00A 3BE7A 3GIQA 5FEZA 1SZEA 2V63A 3MSGA 2A3LA 4GX8A 4ADUA 2VFHA 1HKIA 1ZLPA 3TYAA 3MB9A 3TW9A 4FNRA 1YHTA 1Q8JA 4XAPA 4HSOA 1VRXA 5JH2A 4Y8FA 3BOXA 1UJQA 4JNMA 2OWCA 4RNIA 4W93A 3NL6A 4ZE4A 3RGTA 5RUBA 2RHGA 4N6FA 1K9EA 2FMNA 1XPYA 1SUXA 1FHLA 5EKYA 2ON3A 3L65A 2C2RA 4KCUA 4O15A 1I2OA 1MDRA 4GK8A 2H8XA 4NZ1A 3REQB 2WKGA 1CPUA 5G4EA 4IMDA 2X40A 5D2VA 5EMJA 1A5BA 1JYWA 4ZSUA 4LX4A 3TNOA 3NPUA 5TBOA 2JEJA 3VDCA 2F7FA 1YDYA 4AZ6A 1V02A 4NAEB 3QQWA 2ALRA 2R8WA 1Q2SA 1ME8A 4HYRA 2E3ZA 1L2UA 5GJMA 4ACZB 1VFSA 1XKJA 1VZWA 5TQLA 1NOFA 2CWNA 4S38A 1P0EA 7REQA 1OADA 2XZ7A 3TOPA 2BSLA 2BXVA 1XIHA 3G0SA 1X6UA 2NXGA 2OJPA 3B8UA 3TTEA 3RX4A 1OVDA 1PX8A 3VGBA 4CD8A 8XIAA 1C29A 2NX1A 3HF3A 1XGEA 4H3DA 1ML1A 3NQAA 4IUGA 4MSSA 6REQA 4PMRA 3CZKA 2V4RA 2VCCA 4MNKA 1PTAA 4ECTA 1OJXA 1W31A 5GPRA 3Q8PB 2J9ZA 3INPA 4DN1A 1TRDA 2Q01A 2DSWA 1A4LA 4RUBA 3PJWA 1W5OA 4HA1A 1BYDA 1TTJA 5DRIA 3WD2A 3EX4A 4F0SA 1UG6A 2VEGA 4XKYB 5KFJA 4XK2A 3W26A 4DO4A 1JFHA 1TX0A 3L66A 3T81A 3RB0A 2VC5A 2C1IA 3TTYA 1SW0A 4FXJA 3QPZA 2YLLA 4QJ1A 1I8JA 4DO6A 1AODA 4K3ZA 3E2VA 4YLWA 2B4GA 4MZ1A 4RE2A 3LERA 3P93A 2YSWA 1HGYA 2RDIA 1W56A 1SO6A 4RNOA 4QNWA 4V1YA 5KZMA 1WKEA 3U2EA 1WXYA 1CGVA 1XLMA 4AWSA 2GVJA 4ZA0A 1GJPA 2G41A 3LI0A 3PW2A 3W7EA 4JY8A 5AC7A 4OWGA 1JDCA 2VX5A 1PKLA 3VIIA 1YDNA 1RJQA 1C8YA 5IHSA 1LBLA 4Q8PA 2QJIA 5ECUA 2GJXB 2ZZ3A 1OX4B 4C6NA 3M0HA 1UB3A 3AROA 1XKYA 4FLRA 1SO4A 4JFUA 5HNNA 4DLMA 5HNTA 3W81A 5GJNA 3LGGA 1V6YA 4I5UA 3BW3A 1TIMA 4PBGA 3UFYA 2C22A 3UZWA 1KFKA 2DSUA 5XIAA 3RR4A 3PK7A 3T44A 2A5HA 3UR7A 3C86A 3MHFA 4PMDA 1XUZA 5HPOA 1QVBA 1JPKA 2ZDSA 1V93A 1UC4A 2ZA1A 3LRKA 3NVDA 1KWKA 1FWRA 4B5TA 3SCTA 1UPMB 4ALDA 2GUUA 1B54A 2H8ZA 1W9UA 1S46A 5CZJA 1LBMA 4R53A 3WYZA 1RQEA 1Q7ZA 1QI3A 5DN1A 1QUMA 4H6KA 4C6DA 1HUVA 3SM0A 4OVXA 2WZIA 2YDAA 4XVDA 5D03A 2QNEA 3K46A 4PZVA 1UKTA 2Q3OA 4OBTA 2V2CA 5DQPA 2YXOA 4IIHA 2JKAA 2PLJA 2XCAA 2V5KA 4US5A 1NFGA 3G3DA 4DBEA 5AFDA 2VR5A 5IDZA 5HMEA 4IPNB 3GAKA 3W24A 2D1ZA 2W6RA 1NIUA 3V5FA 3FN9A 3LD5A 3GHUA 4EE9A 3FS2A 2Z0IA 2VFGA 4E5TA 4FLOA 4RW3A 5ABTA 4MJ4A 3OYZA 2GSEA 3P0WA 4M24A 4ZSTA 4DJED 2WLYA 3AMLA 1R3QA 1PZ0A 2FHFA 2H9AA 2Z29A 2CLEA 2CHOA 2MNRA 3IK2A 4J35A 1UQZA 2X30A 3SECA 3WD4A 5D8WA 4ED3A 3UYCA 4F48A 3B05A 3PB0A 3N2BA 4H19A 5JBDA 4ORMA 1FWDC 4FOJA 4CCEA 4IRCA 5HUOA 3LGEA 4H2HA 4YN5A 1HF6A 4KIRA 4W8AA 5CZKA 3DC0A 4HTYA 4LGXA 4UFKA 4AW7A 3WH6A 5KFRA 2BNJA 1VBUA 4E0CA 1J9YA 2Y7FA 4NHVA 3RYSA 3HIJA 3QY8A 2QR6A 1V8EA 4AZBA 3W00A 1WDRA 7XIMA 3BAJA 5K9XA 3S83A 2QCHA 2YA1A 4L64A 3CK5A 3LHUA 1H60A 2FH6A 4O1DA 4JQ1A 5CZTA 2TAAA 3W1MA 4O16A 3WF4A 3STEA 3AFBA 4EYIB 2YZRA 3A5VA 2ZUNA 4TUFA 3WBYA 3WENA 4DEZA 1AH4A 4KT2A 4Z2KA 3VDAA 1B9BA 1XLKA 1TV3A 1TSIA 4GZJA 4ZOBA 3GS6A 2NV9A 1Q45A 4YR0A 2UBPC 1RV8A 3S3GA 3WMLA 3C0SA 4H9ZA 2G96A 1JI2A 1NF7A 4JNZA 2QJHA 4ECXA 4IG2B 4KWOA 3THQA 1ZBWA 3U6WA 5KTLA 3CPUA 3URBA 1M5WA 3N11A 1I1WA 2QS8A 1CIUA 2E6YA 5ABEA 3UNTA 3M0MA 3RU8X 4DB7A 3B0YA 3PUEA 3B8DA 1VFTA 2CBIA 3TKFA 1EF2A 3N73A 1JRBA 4NY2A 5EFFA 4E4FA 1E0TA 1C8VA 2IA6A 1XIBA 4GG9A 4R7JA 3CMJA 1NARA 4I6VA 3GTXA 4FO4A 2VFIA 3BLPX 3ONCA 2NSXA 3W9ZA 3W2MA 1V3IA 4V2XA 4LJ3A 5HAOA 4NNAA 1OABA 3LPPA 5EDWA 2D2JA 1W5PA 5A2CA 2YOCA 5MHBA 2B7PA 3BAIA 2L5HA 3NNTA 4JHOA 3W70A 4A8RA 2ZUVA 4CCCA 4JEQA 1P7TA 4RUAA 3WO8A 2HXTA 2EF9A 3ABOA 1NFBA 4Y6GA 1KD0A 2D20A 3ITLA 2BHZA 1QI0A 2ZRUA 4JD4A 3N29A 2OYMA 1TO3A 3R0DA 4GUFA 4CNSA 3AS0A 5L1JA 2Y62A 1TYGA 3TSDA 4LXFA 1D8CA 4PBFA 3T1GA 4HNNA 1H5VA 3H53A 4WGXA 3II1A 3DG6A 4GIEA 1ISVA 4DVOA 2AOSA 1JAEA 4U3AA 4QHRA 5F2GA 1KM3A 1BAGA 1FXPA 1WOBA 2ZDRA 2NXHA 3CAVA 2IKHA 1JPDX 3RLVA 2J6VA 2VQUA 2ZZ4A 3QTPA 3L68A 4AF0A 2HJPA 1SO5A 5FJRA 1NWRA 4M6UA 3V16A 2CPUA 2D2HA 3DERA 3EWBX 4KGLA 3UPMA 2D23A 5AHNA 3SW6A 4CEUC 1PIFA 3DX5A 2VXNA 1GVEA 3GVRA 2WSPA 1KM0A 4HPNA 3RX2A 1O1HA 3H6OA 4LYRA 2GJPA 2PC4A 2DVXA 4ZL1A 2Z28A 2OX1A 3LX9A 3IV8A 3QV8A 2OEJA 3RN6A 1T96A 3ARUA 1W0MA 2GWNA 1LQAA 3BICA 1SMAA 5D37A 5EBAA 1TPFA 3I3EA 1K7XA 3I3BA 1X7IA 5KINA 1S3HA 3ABXA 1ZSXA 4KPLA 1XIIA 4MTVA 1BGGA 1P1XA 2E77A 2VO5A 3GIKA 3Q8QB 1S2WA 1UR3M 1K9FA 4CCDA 3TQ1A 4MM1A 2QCNA 3GHSA 1V6WA 3GIYA 3JR2A 3KOWA 3STGA 4ZQPA 4O3NA 1JDEA 2W9CB 4X9SA 3MHGA 3NQEA 3C0JA 4RZ4A 4D1IA 2GOKA 3O3RA 4DJDA 3B4UA 4J3TA 3QGKC 1FCVA 2FZNA 3M0VA 2IW0A 2PMQA 2OU4A 1KFWA 3GFYA 3M4HA 3MUY1 8A3HA 4YNGA 4UQEA 1JULA 5CPTA 1HJXA 4I9JA 1JZ4A 1VQTA 3RBEA 1Q13A 3W38A 1JCTA 4ZFMA 4QITA 4IFKB 3CB8A 4Z0SA 3LHWA 2OWWA 3A4JA 3BQ0A 1X1ZA 3DFYA 2WHJA 3VYLA 3L0KA 4INFA 1WDDA 4C6IA 4NXSA 1E3ZA 1M7XA 3TCSA 2XN0A 1YMYA 3WMSA 1Q6LA 4Q6XA 1OCNA 1JZ2A 2JFEX 1VB9A 2BASA 4H6QA 3W2KA 3PR5B 4J9QA 2XSAA 4WRHA 2IPJA 4AEFA 4ROPA 1GZJA 4AX6A 3C6CA 1P0BA 3D47A 3WF1A 3FV9A 4D8ZA 3T4CA 3SJ3A 4CQDA 4QLKA 1OGSA 2R1MA 1HN1A 4FXRA 4S3JA 1OF6A 1QAPA 1YTKA 2ZKMX 4QGCA 3C2EA 3M5XA 4IMGA 4ZB2A 2VZUA 5KFKA 4TTUA 3GSMA 7A3HA 3LDVA 5FOOA 2ZC1A 4PN2A 1TPVA 3MUIA 1DTUA 5JIPA 1DWFM 3QZ8A 4MAZA 3Q65A 2D24A 1BYAA 2G4FA 3R5EA 1FOBA 5BOEA 4IR9A 3PSVA 5HUPA 5G2HA 3IANA 3IAPA 1U5JA 1ZTVA 4RLIA 2WOQA 5ABGA 3C3UA 3HGRA 2R1NA 1V0KA 4FBUA 4L65A 4UMCA 3KVKA 1GTEA 1FFRA 3ZR5A 3WSUA 4L80A 4QM1A 2QJGA 3N4FA 4GMEA 2UVUA 2QIIA 5HDRA 2WM0A 3LQGA 3GX9A 4GE8A 5HJYA 4AZGA 1XH2A 1WXJA 2XIOA 3EWDA 4MFDA 3ITVA 3OVGA 2CCRA 4R34A 2D0GA 4LYQA 4I9MA 2E9MA 4NIRA 1S2UA 4TVUA 3PB2A 2I14A 1DQUA 2BQUA 4NZ4A 1EPVA 1MFUA 1J10A 1Y0EA 3KOZA 1JZ5A 1J0KA 2ZICA 3VCCA 2C13A 2WSYA 1XLAA 1Q8AA 5HOSA 2H6RA 3W1LA 4HJFA 2PODA 3WD0A 4C6QA 1UR1A 4G7EB 3ENLA 1YE4A 4U4MA 1H7RA 1BXNA 4O28A 2INFA 1R2RA 3W3OA 1S1RA 1MYRA 2E6FA 1GJWA 1EUNA 2RDXA 4DF0A 2ZRVA 3UWWA 4C6MA 2HDJA 2J7GA 3DFTA 3G1HA 3RM8A 2I5GA 4MJMA 4AH7A 3CHDA 3WJYA 3PW5A 4C6EA 1QR7A 1UZ1A 3USZA 3B0VC 4F0RA 4RXGA 1XIDA 2A0NA 4FOUA 4A8LA 2ZX9A 4CD4A 1CGTA 3VCRA 3CMGA 1E1EA 2C19A 3CUGA 1FA2A 1NFPA 5I3HA 5DX7A 2DW6A 1GVFA 1QU4A 5F4WA 1KFCA 4GUJA 2IMRA 5IOBA 4JDBA 4C6OA 2Z2BA 1Z44A 4DI8A 3ONBA 3OHIA 1HNYA 1W5MA 3NPVA 2NWRA 2P3EA 4JIEA 2O0TA 2OZTA 4ED8A 1TVPA 2HBXA 1EDTA 1PZ2A 4QLJA 1OYBA 4I7UA 3M0ZA 2G8ZA 2ASDA 1VJZA 3R25A 1Q7MA 4LBSA 1VFHA 2B81A 2DH3A 4M7SA 1KCZA 3KHJA 2D22A 1FWCC 5FJPA 2GGEA 4EK7A 3OA3A 4NYYA 4ZOCA 4LRTA 4ICMA 5CPMA 4GQQA 2JEGA 3VOHA 4JBRA 3GD6A 2Y4SA 1S0NA 1OX6A 4L6HA 3CTLA 3M07A 4LNYA 1KR0A 2ZX6A 2CLOA 3BAYA 2EGZA 2V67A 4MPKA 3LA4A 1AJ2A 1XJBA 2DW7A 3WEZA 4FBTA 5IHRA 6A3HA 2KAUC 1UIOA 3CWNA 1SGJA 3NGDA 4HYVA 3OLEA 1UBSA 4NYUA 2VGFA 4KGJA 3GV8B 1WAWA 3GZ3A 3W1UA 1MQPA 1RPKA 2C0AA 1WP6A 5KG7A 3GG8A 4HSHA 3SUTA 4XV0A 2ZIDA 5LNRA 3EAUA 5K4XA 5BXRA 4EPDC 4C5YA 3BGJA 3BDKA 1OM0A 4QG6A 3DYPA 1TFVA 2XH4A 4OHQA 3S8HA 1CCWB 4E2OA 1XLBA 1XISA 4ZZ9A 2QJMA 1RXOB 3NM3A 2Z26A 3LCGA 3K8MA 3C0QA 5D9PA 3SBFA 3PZVA 4BQ4A 4GC4A 5L1LA 1A47A 4AU0A 4LUSB 1LM1A 4JHMA 4XAYA 1FHDA 2XH7A 1XC6A 3O9NA 3WMBA 4UFLA 5TD4A 1D8WA 1PEZA 1HO4A 4J27A 2GLKA 3TN5A 4DBUA 3H24A 4GVHA 4DXKA 1JD7A 3WF0A 1U22A 4YU1A 3VIKA 3KP0A 2PTDA 2ZVIA 2NVDA 2ZTKA 2DIKA 3IEBA 4JX4A 3WLHA 4JYEA 3TTOA 2OELA 2DZSA 3GTHA 1OFQA 4Y7EA 4L1XA 3W7CA 5AVHA 3IRDA 1N8IA 1ZALA 3QSTA 3QM3A 3UVAA 3POHA 3QR1A 3ARTA 4JCLA 2JE8A 1RAKA 4JTEA 1K4GA 3UXKA 3M9NB 1I4NA 3TQKA 1RH9A 3G6VA 1RHCA 1AQ0A 1SM9A 3PM6A 2BXYA 2E25A 1KM1A 3MKCA 3DAQA 4D1JA 1Y65A 4LY4A 3ID7A 5K4ZA 1IE7C 1RD5A 1G4SA 3WJZA 2ACSA 3B97A 3ANVA 1EOMA 5L6UA 3MFIA 5FJIA 4I8DA 5KG1A 3QHMA 1PB0A 3LUTA 2J6XA 1GG1A 2IPFA 1ME7A 2YZ5A 3EB4A 3W7LA 5KFBA 1WKDA 5EMLA 3E2SA 4FXFA 1SJAA 2VCBA 3FXGA 2ZQ0A 3UWQA 5A94A 3W7HA 4HK5A 3MW7A 4S3GA 4Z2IA 4XSLA 2HEJA 1OG0A 1T7LA 3TW6A 2Z6JA 5HK4A 1GVSA 2WTFA 4ADSA 5DBTA 2QDEA 3EDJA 3EB2A 1UH4A 4RNFA 3JZEA 4LFYA 3TJIA 3LN3A 1AL8A 3GIIA 3PULA 5CZSA 3AS1A 3CO4A 4AWUA 4LAZA 1V6UA 3AJXA 3BSHA 4QEEA 1SR0A 1NTHA 4U31A 1A5UA 2FFIA 4FS9A 4GY7A 3DGBA 3GNOA 5B7YA 2P0IA 3OB8A 4GFSA 2JALA 1LUCB 3WLPA 4BA0A 4J9RA 2QCMA 5KMYA 2GVYA 1QHPA 4NI3A 4O11A 1LL6A 3LXCA 2C1GA 2I57A 3UPBA 1ITQA 1E9ZB 2ZE3A 5C0QA 3F4NA 3PF3A 3LCWA 3GGMA 1DWGM 3ARSA 3PZIA 5G5IA 5E9XA 4NJGA 1TPC1 4S3KA 2ANUA 2G3NA 3EA1A 4FNTA 3GH5A 1VGAA 3KHRA 4EXBA 1W1YA 3FDSA 4ZXOA 3NA8A 3VZYA 1QMLA 4K7YA 3QMTA 3QC3A 5KEZA 5CLTA 4O3QA 3B3DA 2W63A 3IUHA 1TUFA 2OZ8A 1DJIA 1G4TA 1GJUA 3H7VA 4AX7A 3PPGA 4H01A 3T0DA 3FHQA 4R3UA 1YNQA 3UNDA 1ZGDA 3UESA 4H4IA 1AH0A 2NT1A 3TMLA 2ZZ1A 4HU0A 1AUSL 4V33A 4NNBA 1R3WA 4Z1AA 7REQB 1Y5WA 4QWAA 3SQMA 4WOQA 5DMMA 1KM4A 1IXPA 4B91A 3MYPA 4JQ3A 4L4MA 1UWTA 5C5JA 3K8KA 4TR9A 5I24A 2XC9A 4Q8QA 5CGTA 3M41A 2E67A 1BFNA 4O4VA 1VEPA 3VDHA 1C8QA 2PP1A 1VCFA 5C5YA 4YCPA 3MC5A 1TJPA 1DYSA 4BF7A 1ONWA 4LOCA 4REQA 2HISA 2QVHA 1UWUA 4W84A 2OR2A 1OGGA 2P50A 4AZCA 1UD2A 3SQSA 4DLFA 1PKNA 4K68A 3EWWA 4U10A 1OQFA 4HD5A 1POKA 5KFUA 1A5NC 4AHPA 4IRKA 4PBEA 2XVPA 4F2BA 4OECA 3MP4A 3I6EA 3DKLA 4N42A 5JIWA 3CH0A 5AECA 1WXZA 1M03A 1RCXB 2QUUA 1IT7A 2WVSA 3K13A 3VFCA 2RJHA 3KX6A 2XIJA 2WO5A 3SCPA 3W7DA 1JFXA 5L1KA 4QEHA 4WOZA 3H40A 4NI8A 4XZMX 4CNNA 5J5RA 4EACA 1UJPA 4Q33A 3WELA 1ITUA 3UZYA 5H2ZA 3VD5A 2ALZA 3EKGA 1XLLA 2ZE0A 4JTLA 5KG3A 2AAAA 3NPWA 1W17A 2WK2A 4V27A 3CV2A 2FZDA 1WUEA 2ZZ7A 2V2DA 3I6TA 5A8PA 1LOSA 2DQXA 2ESCA 3KOXA 1JJKA 2OB3A 1KW1A 4UR8A 3SFWA 3F4VA 2Y88A 1XSIA 2XVNA 3MV01 4MWAA 2QF8A 4LAMA 2PTWA 1H49A 4I3GA 3MFHA 3T4WA 3WLMA 2ZA3A 2ZX5A 2I9EA 1GWJA 1K4HA 3EOUA 4WKFA 4B4HA 3ZT6A 2BODX 2UVWA 3IJ6A 2YYUA 1JDAA 3T2OA 2JKEA 4IX0A 3SRFA 2XIQA 1VLIA 1P5BA 2H3BA 2XH2A 2A3BA 4GH3A 4NQ1A 1OHLA 4GIYA 3UXIA 5HANA 2J7DA 4PMZA 3MZNA 3MJMA 3KRUA 4JX6A 3GZAA 1IEWA 1X39A 4X2RA 3IV3A 4RV8A 4NJIA 1PVNA 2EKCA 2HBVA 4HMDA 2QEZA 2XIIA 3MI2A 3SAZA 4UB9A 4OE7A 6PTDA 1KLYA 4NZJA 5EL1A 3GFXA 3GIJA 1MWOA 2A6NA 3LXBA 3MU7A 1PS9A 4E4UA 5HULA 3MZ2A 3KLLA 3RAXA 5A69A 4HA3A 1S1PA 4PB5A 4Q8FA 2OTDA 5GNYA 4NSBA 2AGOA 1BLIA 3TDFA 1B4KA 1C8XA 4Q8TA 1OFOA 2R91A 3TR2A 4AY7A 3TTQA 1NWUA 3KHGA 4R88A 3WUEA 1VCGA 4ML9A 4WY0B 3L67A 3LXAA 2E5DA 4K8EA 4MOZA 3VOJA 2CLHA 1U5VA 4ICCX 4FNPA 3NQFA 3WQ8A 4M29A 4IFKA 1GOKA 1B2YA 3ABRA 1YX1A 5KZDA 1MW0A 1X7FA 4O1CA 1XYMA 2AKZA 2HQAA 5EB8A 2Y6ZA 4YR3A 4MIMA 3E1F1 4AYSA 2C3ZA 4P7NA 2FHCA 1DXFA 5BCAA 2DZPA 1MSSA 1XLFA 2GYIA 4BEQA 1XDLA 3BGAA 1POJA 1F3EA 2YX0A 4JAWA 3CV7A 4MMWA 1EEPA 2XTKA 4XD5A 1OZQA 3LRMA 4O13A 4YYFA 1XCWA 3M0LA 1VIWA 1B3OA 3R7MA 3CWHA 3M9MB 1TV7A 3NO3A 5AYBA 3WH5A 4RZ5A 2NQLA 3V0TA 5H8MA 2Y85A 4ZCWA 3W73A 3OW1A 3M16A 2W9BA 3W53A 5DF0A 4JTUA 3T2PA 3L12A 1PZ3A 4LEQA 4IT1A 1E9IA 2JQXA 3TV8A 1TWZA 5D38A 1BKHA 4J3WA 2GL5A 2Z2AA 4HT3A 4IIFA 3BG3A 3EX2A 4RCXA 5H1WA 1TB3A 1HZYA 3KRZA 1W6TA 2YCIX 4DJFA 1V0NA 4QAIA 4LU0A 1MUCA 5MF5A 1UOKA 2QULA 4XAZA 3N2OA 3GXFA 5A8GA 4GXWA 4CQBA 1MW2A 4JQ4A 3VE9A 4LEFA 3VGFA 1J0YA 1XYAA 1E4IA 4MKNA 1Q5MA 3D3FA 4OBSA 1TMLA 4DPPA 4POCA 4DL4A 2NZLA 1I2RA 3KE0A 3HPFA 3B04A 1B9ZA 2PDCA 3U4AA 2P88A 4KFOA 1H1ZA 2BXZA 1M6JA 2VDIA 4LUYA 3G8EA 1YADA 3D5HA 3W7RA 3ZXWA 3SUUA 4O3PA 4IJCA 3TMQA 1ICPA 4PUJA 4F50A 4XZIA 2NQ9A 4J3SA 4LVGA 4JNYA 2XG9A 4ACYA 3H12A 3BO9A 1SPQA 1V3JA 2ACUA 4M6VA 1FWEC 3VIPA 3B0UX 4N9EA 3A4AA 1PIGA 4IL2A 4IFRA 4IGSA 4UNIA 3WNLA 3CZGA 3NPXA 1E4NA 3ECQA 1IM4A 3O1NA 2VA2A 1GW1A 3FSTA 4CVWA 2BV9A 3W2NA 3EMZA 3TQ0A 2QMKA 4UXDA 4EXQA 5KFIA 3FY1A 1SQ7A 1TZ7A 2ASHA 3DFQA 4K2SA 3SCOA 6XIMA 4CN4A 3TAOA 4HMEA 5EGRA 1P4CA 4MHBA 4QDMA 3UWYA 5DFAA 4QAWA 4WGHA 5DMNA 2DUAA 1VFMA 2HROA 3BQ1A 4GC7A 3CB3A 1RZMA 1WNOA 4XG1A 4HK7A 4ONVA 3BC9A 3PPFA 3LHYA 3DUGA 1GHSA 2JGYA 4RNMA 1TJ1A 2V3DA 1K8XA 3ITCA 3VIMA 1CXIA 1EA9C 4W7WA 3C61A 5BMXA 4DNMA 2WHKA 4H7ZA 3NQ6A 2XGPA 1OBAA 2VYOA 4LALA 1B3YA 4Y8EA 1E5NA 5DGBA 4MB3A 3CUHA 3BMWA 2E9BA 2FDMA 5A6SA 4O8RA 1KBJA 3OU8A 1RSCA 3GFZA 4KWWA 2V69A 1PYFA 4LH8A 4XZHA 3IJQA 3PSWA 1YYAA 3FJ4A 3O15A 3DFOA 2VR2A 3F2DA 1EP3A 3PUOA 3L23A 2PTXA 3LCFA 4UTJA 2PDWA 4WXZA 8RUCA 2FGLA 2DV0A 3K2GA 1HXJA 3U9IA 3N1AA 4TV6A 1EC7A 1ZUAX 3KBWA 3EYPA 2J4GA 2W66A 4AMCA 4ED1A 1GVYA 3FKKA 4HCDA 2J24A 5FF3A 3V75A 3PBMA 2VEFA 4IMFA 1GYNA 3EOSA 5KFFA 5LA1A 5CJNA 2H9AB 3MBFA 2PZNA 1T41A 3B9AA 4Y9PA 1VFUA 3LCIA 2AAMA 4DRSA 3GVVA 3QZ6A 1HKWA 3KWXA 4M81A 3O6AA 1ESWA 3NUKA 2QCGA 2FIQA 4IP4A 2C16A 1RD6A 1AJZA 5HJLA 2CZVA 4JN7A 1FWNA 2BGSA 4YJ5A 1N2VA 1QOXA 4QW8A 5A8OA 1BQCA 4KETA 4YQWA 4WY0A 2AQ4A 2J8GA 4PCTA 1VJIA 4AD1A 2TPSA 1RBOB 5A5WA 1ZBKA 3VKCA 3QZ7A 1R87A 4PCSA 3WLKX 1W8GA 1CWYA 4WVXA 3MYOA 3N14A 3QR3A 1FCQA 4QISA 4DYKA 1B3XA 3AQUA 4NZCA 3V5CA 3A12A 3W71A 1E9YB 1X1OA 3LI1A 3NL3A 1C9WA 1R46A 3PWIA 3CS2A 3UJFA 3MDWA 4DZIA 6REQB 1KLZA 1ZNNA 1VP5A 1SFTA 1Q66A 4HB7A 4RW5A 3ABZA 3FFSA 2NV2A 4MJZA 2AU0A 2ZOXA 3DIPA 2WNNA 4H00A 4QROA 1IGWA 1YE6A 2CXEA 5CPSA 4AEEA 1W3JA 3SGGA 1JD9A 1JNDA 3GV5B 3HPXA 4CCZA 2YFNA 1ZAIA 1XG3A 3M47A 5F1UA 4HNLA 2C7FA 2GSJA 3GNRA 1A3HA 4LT9A 3GR7A 3VFLA 3EDKA 2PGRA 1AA1B 1TWIA 2DPIA 5G2IA 1DIEA 1AJ0A 3A64A 4LB4A 4MLRA 5LIYX 2XM2A 5J5DA 1TE1A 4FLSA 2GQ8A 1VAHA 4NAEA 4CU6A 3TJ4A 1EJRC 3NQBA 1YIXA 3N9SA 4WDUA 4OTKA 3E96A 4HZMA 5AYYA 3MHUA 3BOFA 5EU9A 4IQDA 3BCJA 1JIBA 2BOFX 3DYMA 1HJUA 2YA0A 3ZLGA 3WK1A 2GSHA 4Q4SA 1FX6A 1H0IA 3BK0A 1DIOA 1EQPA 1OB0A 2DZVA 4E2DA 2G3IA 3KOYA 1BSLA 3S5NA 5D2XA 5A6BD 4MAVA 4ZB5A 1GTHA 1U30A 1IQ8A 3T8QA 3G1AA 1XPGA 2XDFA 2IXVA 3UGVA 4LF2A 2WBKA 1TR1A 2A85A 4GVIA 4FR6A 2RH9A 4AC7C 1XYZA 5SWUA 1RP9A 4ZO6A 3VD9A 3NZGA 4NF7A 3WH7A 4ECVA 3R6IA 1LQ2A 4OOZA 3LG3A 3TP4A 3ZQ9A 1AD1A 5A3HA 5CC7A 4M1RA 4AZHA 2IBKA 4IPPA 1V4YA 4QJ4B 4V1XA 3DG7A 3V4BA 4CUCA 3VNKA 2WWDA 1XICA 3MTWA 3E38A 4NNCA 1F2JA 4IPJA 3RRAA 1R30A 2PTZA 3B9OA 1QNPA 4I90A 1KV8A 4LV4A 4N4PA 1TZZA 5CCZA 4WSJA 3W75A 2Z1KA 4XD3A 3NFUA 4DUWA 4YXGA 4JFSA 2BBFA 3S2MA 2BTMA 1N8FA 3GG1A 2VVSA 1XRTA 1A49A 4J9LA 4OOUA 4GJ1A 3S9YA 5AHIA 3DFPA 5FF2A 2GZXA 4GJJA 4J9PA 2WZMA 4AG0A 3FOKA 3H2FA 1EL3A 1W1IE 3W1RA 3GC5A 4O1AA 2ADAA 3ZJ7A 5GVJA 4LUTA 3SCVA 3KS6A 1SW7A 3NO1A 1UH3A 2JF7A 1ME9A 2XVGA 4U5KA 3YPIA 2A3HA 4MZYA 2QJJA 4BY3A 4HA0A 4JTIA 1MDLA 4B92A 4UZUA 2Y2WA 4C1LA 6TAAA 5CPQA 3PW0A 1OT2A 4DJFD 3I3DA 3PVXA 1VPYA 4EF8A 1X8FA 4D8AA 1LQ0A 2E68A 1MW3A 2REQA 1H7PA 1A4MA 1Q6CA 2EJAA 4H7VA 2OT0A 2HVMA 3IIPA 4PUMA 4WKHA 1GQNA 3DXIA 5CH9A 1EDGA 2CEQA 1BRLA 5C9UA 4GUHA 2J7CA 1XBYA 4FXSA 3NEVA 4JTJA 3GXPA 1ZJHA 4QCFA 2FVLA 3E12A 1IYXA 2IKIA 3FA3A 2CLKA 3DBNA 5A95A 2BWGA 4IHCA 4BR1A 4R33A 4OIFA 1L6FA 1F8IA 3P7YA 1IT0A 3QFWA 4IL0A 4J3VA 1VFLA 2WW5A 3T0BA 3G0XA 3BCDA 3EEGA 2VZTA 3R79A 3AIRA 3HQOA 3SSJA 5HA7A 4FS1A 3O63A 5CKSA 1R38A 4PUEA 2VVNA 1H7NA 2J8FA 4PEEA 4E2VA 4LS0A 3TTSA 2GJRA 4FAMA 2ZBTA 2PDQA 3FAWA 3W07A 4MNMA 4IISA 4LNCA 4F2UA 2O92A 3S1XA 2VRKA 5G2WA 2VC6A 4ECQA 4E2BA 3LPFA 2KX9A 4QRNA 3LY0A 1MUWA 2ZYFA 4FNUA 1EC9A 1SMDA 1XYFA 2VJXA 4N4QA 4O54A 3WLRA 2HS6A 3VNJA 3OJGA 5M2FX 3E49A 2BY3A 5ECVA 4CD7A 3P81A 4XSMA 1C7TA 2X2GA 1FY6A 1DTNA 3WDJA 3MVTA 1QWGA 4UTKA 2XM1A 3BAWA 4UMAA 2ABBA 2X0SA 1UROA 4CD6A 1V77A 1O60A 1THFD 3GG7A 3VNMA 1J0IA 2VD8A 3E74A 3DU0A 1V7YA 2P10A 3URQA 4QNEA 7ENLA 2PB1A 3FKRA 4GYKA 1I0DA 1UZ4A 4AZIA 1ZBVA 1X98A 5HXMA 1MXSA 3P5YA 4AF0B 3NSXA 1KKOA 4JYDA 5AC5A 2QIWA 4NX0A 1FWGC 3IIXA 3P84A 2PGWA 4Q4MA 3VPLA 3CL8A 5TIMA 3VD4A 3WUFA 2OX4A 2WHLA 1G67A 4DZAA 1EWEA 4PFMA 4F0HA 1EP1A 1P1MA 4F0MA 3OVRA 3UWEA 3VOIA 4DBWA 4D6HA 3SIMA 4PUNA 4WDWA 2WBGA 3GNNA 4EAMA 3UWVA 3POCA 5EPDA 4F9DA 4NVTA 4C6PA 4GCAA 3AXKA 1H3GA 4GX9A 2V3FA 3VIFA 3FVMA 5I06A 2YL5A 1B0IA 3AICA 1J0HA 3NL2A 1QNRA 2VR4A 3L4YA 1SFJA 4W87A 1UC5A 2Y8UA 3COTA 3EWCA 4QSHA 3PBUA 3ZMRA 5I78A 2VRQA 3GTNA 3AYTA 2VZSA 3AHXA 3KDNA 1PTGA 4QE4A 5D04C 4W5ZA 3UA3A 3WX7A 4ECYA 4HCHA 4J9JA 4EIVA 4RKAA 5PTDA 1OD0A 1XLEA 5EBUA 1XIGA 4JTAA 3UY7A 1E55A 4N7QA 3G1XA 1SFSA 4YVXA 4Q4PA 4GPNA 2X1SA 3AZTA 1UWSA 3BLKA 3ALFA 3AS3A 5D32A 3A9BA 4H9YA 1U1HA 4G56A 3EXTA 4H8VA 1XSJA 4FF7A 4MKSA 1TUXA 3C4UA 2GK1B 3SN0A 3BTNA 4UTTC 5JXQA 1IHIA 1KRMA 4TX6A 1UR8A 2F61A 1KXQA 3OGRA 2DZWA 2ONEA 1W9BM 3TZFA 3RCNA 3GE7A 4RNHA 2R94A 2C0HA 1AMKA 2DT3A 3N9KA 1C91A 1XS2A 5C8BB 3W02A 1SYTA 3ZVHB 1N8WA 3EBVA 3GTFA 4DL2A 2FTWA 3LM3A 5DELA 4GI9A 1GZGA 5LNWA 3RLUA 1NH6A 1MNSA 1NY1A 3WQFA 1JVNA 4KRTA 1Z7AA 2IKGA 4QR6A 3RMEA 5HMDA 4QG9A 2PGFA 1UASA 1XBXA 1JGMA 4AB4A 3WZ0E 4J28A 2FJUB 3WH8A 3DG3A 1XRSA 3W29A 1WDSA 3I10A 3KW3A 4D6IA 1EHNA 4G7FA 1Z8AA 3BVJA 3LV6A 1WE5A 3PZQA 4XZBA 1CB2A 5FAGA 5IFTA 4DYJA 1M01A 2QT3A 1E6NA 2Q3RA 3UY8A 4B3KA 3QRHA 2PDXA 1TV4A 3LPGA 3LEPA 1Z41A 3BW4A 3W6LA 1B3ZA 1US3A 1XFBA 4GXPA 2C28A 2GQ9A 4G1NA 3VX0A 5K2ZA 3GWQA 3TC7A 4UTTA 2VC9A 3W7QA 4AIOA 1OK6A 3WDPP 1HVXA 3S2JA 3RU6A 4J2MA 1F4AA 4ILSA 3BZGA 4UFMA 5JBFA 4BI5A 2DPJA 3TOYA 4QLLA 3C5QA 5DG9A 3P60A 2NV1A 4UUIA 3FVDA 1QI5A 3FJ6A 1CX9A 4WIWA 3BQ5A 2OVLA 4CVUA 2V5BA 3OEXA 1QASA 4Y96A 3C2FA 4O52A 3U2CA 5IFPA 4BKNA 2PZ0A 2DEPA 3IARA 4LVDA 1ISWA 1TWDA 4NG3A 5I79A 1VBRA 3NL5A 3AJ7A 1JF5A 1TELA 4U2YA 4KERA 4RR4A 1G1YA 2R14A 2HVNA 2JIEA 1V03A 3O2LA 3IGUA 3NOYA 2OQLA 4PTDA 1TQXA 5KFVA 3B8TA 1SVDA 3MO4A 3WQGA 4GGBA 3A21A 1KFJA 2XWEA 5T9BG 1XDMA 3KHDA 1GUVA 3LNMA 4PB3A 3H7RA 1KFLA 3GR4A 1ODUA 1YNPA 5FAJA 1CNVA 4LANA 2Z00A 2P8CA 4B4FA 1BYCA 2A4AA 3WFZA 4C1NB 2PWGA 4JQAA 5F2IA 3CNYA 1YXYA 1R7AA 9XIMA 1VBJA 4LPCA 3VILA 3GTIA 3PZ9A 5KFHA 4ZR8A 1OIFA 4WCJA 1TMHA 1J12A 1PXGA 4HOWA 5KG2A 3J7HA 4IXHA 1YW1A 3REQA 4RNJA 2R1KA 3N34A 4GY1A 4Z0JA 2OFJA 4CNPA 4ZTXA 2X16A 4WX2A 3ITGA 2WM1A 3CAWA 4UTFA 4M7TA 1FRBA 4M6PA 3VI2A 5HPCA 4IH3A 2JEIA 1QO2A 1OX4A 1KM2A 5FKYA 4DHGA 4PTWA 4TX9A 2FPVA 2WSKA 2CW6A 5M5DA 2W67A 2UV8G 4QSFA 5D4YA 2VEIA 3N13A 3DHFA 2R9RA 5E70A 6TIMA 1M9HA 4L9YA 1IIGA 1XD0A 5AYXA 1DJGA 2B7OA 5CGMA 3OO2A 3PUDA 3MP3A 2YL6A 3CLMA 4ASTA 1VS1A 5C2CA 4XD4A 3AALA 3O05A 1B3VA 4PTMA 3LCLA 3EDEA 3WMCA 3ELFA 2IQ0A 2HRWA 3N19B 2CLPA 1OX5A 2DDXA 1T3NA 4JDYA 4A8IA 3EDDA 2HV5A 5IBXA 3NG3A 3A6OA 4UWMA 4XX6A 4ZO9A 4UQDA 1H2JA 1A5LC 3OTRA 4D6DA 2VM8A 1UA3A 3HV8A 3C56A 2DUXA 3G1VA 4G1KA 3NZ1A 2OKTA 1KTNA 2OPJA 3ARYA 1IR1A 4Q4RA 5FJTA 1JYXA 4B5WA 1I60A 3E6EA 3E0FA 2YCLA 1G7UA 3V5OA 1WO2A 3UG3A 3S5SA 1E51A 3SRDA 8CGTA 3R11A 2W7OA 3RO6A 3E0VA 1V3MA 1I0BA 2XSBA 4JZ5A 1KBLA 1RVGA 2OKOA 3MWCA 1X6NA 2QXWA 4WDXA 3WNKA 1KCKA 5LXXA 4NXKA 1LYXA 3QYQA 3AO0A 2RJGA 2VL4A 1H62A 3PBWA 4B16A 3KL3A 3CYVA 3LLDA 2FZMA 3SCNA 3SRHA 3OYXA 1R3YA 1A80A 2CWXA 1J93A 2ZXAA 5A6BA 4AD0A 5D05A 1YTEA 3BURA 3WQCA 3M64A 1N48A 3XINA 2PDMA 2BX7A 3STCA 3DESA 4J40A 5CGQA 4LY8A 4F66A 4Q7IA 2DZXA 4MWAB 1YBQB 2J47A 4MUPA 1OC6A 4AXKA 3OZOA 3VOFA 5C71A 3PJUA 3WQWA 4DJDC 3W2LA 3C2YA 2P5NA 5DBUA 3DFHA 1NDVA 3MR6A 3ANUA 1DE5A 4H9UA 3P14A 3T05A 2FZ9A 3N9RA 2INZA 1MI3A 5FD0A 4MZ8A 4L4OA 3HG4A 4KBXA 2I5IA 1TR9A 2RUSA 4F0KA 1XI3A 4HHPA 1K8YA 2NUYA 4BWLA 2A79A 1SSDA 4GFIA 1JPIA 4QE5A 1B5TA 3AYSA 5GJPA 3P2VA 3A9IA 4PMJA 2Y8KA 2FPYA 4HA4A 3DHDA 1FCBA 1ZU8A 4O3RA 3R1ZA 4GO9A 1W3HA 1EO5A 2ZXQA 4GYFA 2W9CA 3G6YA 1DJZA 4L9ZA 4BWLC 3F5KA 2GGHA 3VIJA 3ZO9A 4H8UA 1JYVA 3RG6A 4JTHA 1MQQA 5DQHA 1N56A 1I45A 4AAJA 4YHEA 4NRSA 1PWLA 2X1UA 3G1FA 2ACRA 1BKSA 4S3DA 3U2OA 1HO1A 2PUZA 5DQIA 2QCDA 2Y5JA 2W0UA 4FALA 2X2YA 4MVAA 4BF5A 2R8HA 1PUDA 5E6ZA 4NAFB 3AC0A 1FHUA 4LF1A 2GVEA 3WIJA 4Q3MA 3WNMA 2ISVA 5FEXA 1MO0A 3UG8A 2PU0A 2J74A 1JZ8A 1C93A 3MKKA 4RK8A 1YXDA 3R43A 2V6AA 4RV3A 2XHYA 1GK8A 2A7NA 3P3BA 4K1WA 3ATYA 1XC4A 5G4HC 3PBGA 2RDUA 1CXFA 3RIKA 4XUGA 1FKXA 2Z4GA 4LCSA 1PJ9A 1JG9A 1ZAJA 3ALGA 3NDZA 4EXAA 5TF0A 5FI8A 3BCFA 3T5LA 4WJXA 3U48A 1K6AA 4MYXA 2DSKA 2O55A 4KH2A 1F6YA 2GQ3A 3CYJA 4Q8EA 1KM5A 4US5D 4GA8A 3BH4A 3QN3A 3AMDA 3HTWA 1QATA 3UBPC 2H3DA 4KW2A 2OH2A 2QJNA 3RMJA 1GGOA 3SY8A 3URAA 1U1UA 4DWSD 3ZLHA 4NZFA 4R5EA 1J2BA 3MY9A 4QXIA 4W8BA 5FJJA 1G9HA 2OYKA 4G2DA 3VKJA 2XFYA 3W1AA 2TRSA 1EZ2A 3JZUA 5T8GA 3QW4B 3JVAA 3PJXA 3WLLA 1K1QA 4F4YA 2WAGA 2Z6IA 4O0ZA 2GPTA 2E7FA 4FZIA 4LCRA 4OJYA 1GVIA 4GKLA 5FL1A 2WKLA 4ZQNA 2R8GA 4CQAA 1IEXA 1L6SA 1RQHA 1IR2A 1FWWA 4D6EA 4JPGA 2OEMA 5I6SA 4QX4A 2J9YA 2CERA 4A2SA 1OG6A 4ED2A 1Q4NX 2FJKA 4B3LA 3N3TA 3HQNA 4JXCA 3ZIZA 1ZFJA 3A3WA 3BGGA 4GWEA 2QPXA 3NURA 4CLMA 1CXEA 5DXYA 5E0CA 4RXFA 4ZXLA 1J2WA 1QO5A 1XSKA 2CBVA 4BEUA 4EYHB 3IIVA 1MZRA 1PV8A 3HG2A 5KFSA 2HWGA 3ARZA 2A3CA 3VKDA 2Z25A 4K39A 1OSEA 3L21A 4AUBA 2CESA 2XCPA 2XINA 2O9TA 4C6LA 1JZ7A 4BF9A 3CQIA 4GYPC 4F4XA 3NQ7A 2CLFA 4RDZA 1GEQA 1RUSA 4ED0A 1T8XA 4F4ZA 4UTWA 3ZSTA 4IPLA 1OCJA 3ITOA 1F6KA 1U5HA 3GW3A 1UD5A 3QV7A 2WMIB 3MT1A 2BFGA 2E28A 2PS2A 4FK9A 4NZ5A 1TPUA 3LLFA 3HQPA 3NOEA 4ADTA 3CQHA 2PI6A 3RRXA 1QOQA 4A3QA 3EWZA 4NILA 1IXNA 1LORA 2GK1A 4Q7NA 2CLLA 2BLEA 3H55A 6CGTA 2RAGA 4GUGA 5KITA 4J9KA 1Q2RA 4GBDA 1E0WA 2HNHA 1XXXA 4C90A 2E6DA 3A22A 1FTXA 4MJ2A 3LSCA 3OBAA 1PHQA 1VCVA 2CIPA 3T0TA 3T42A 4QWDA 4LYKA 1IIHA 1KKRA 5D30A 3L9CA 3EX6A 1E1CA 5EA9A 5ABHA 1OZMA 4PCFA 4NASA 2E4TA 1E6RA 3OOQA 1WBHA 1M7JA 3P6LA 1GONA 3I4EA 5KG4A 2CZEA 2ZA2A 1K70A 4ED6A 3RBDA 1B57A 2P1FA 4KEUA 2UVRA 1S97A 3RFAA 2JBMA 1KTBA 2RGLA 2DPEA 1FKWA 2VZOA 2BR0A 1TG7A 3LENA 4W89A 1E1CB 5EY5A 2I17A 1UH2A 4FA3A 3TYCA 4JGDA 5LIWX 1GVRA 3ZOAA 5KFOA 4J9NA 3FHAA 3GU1A 4BS0A 2QPUA 3AYVA 2AKMA 1ICSA 4A2RA 5HWMA 3S1GA 3LMYA 2Z1VA 4DPQA 3RF9A 2WV8A 1HT6A 1VFOA 1ITCA 5DANA 1E0VA 4OU1A 1CLVA 2W3ZA 4WJEA 5AHMA 4GY0A 1P0NA 4IG2A 5AZ1A 3S4TA 1OD8A 1W5QA 3G1DA 1TA3B 4W7UA 5FSDC 5E93A 3Q8SB 5E0FA 1IWAA 2NX9A 1JCLA 2AL2A 5CZ0A 3H2EA 3TJXA 3MMUA 5L9FA 2OOGA 2DGAA 7CGTA 4PRWA 3EX3A 5KFPA 2V38A 4NX5A 3O7UA 4A35A 2PDHA 1QRQA 2X42A 2WJDA 1E6ZA 4N9CA 3GVQA 3W82A 2PD9A 3TWAA 4GGHA 4ATLA 1H1NA 3SGZA 4UC5A 4UIOA 5AY7A 1BXBA 1E15A 1LWIA 3SEPA 1SZNA 3E0IA 3TYZA 4Q8MA 5KG6A 2YBUA 2QCLA 3GU9A 4PB4A 2E0PA 5F1VA 3LMZA 4TX8A 3UXAA 1W9XA 3BMVA 2DSVA 2QCDB 1E4MM 1UOZA 5D2TA 5F9LA 3I4KA 3DYOA 1UWAA 3H4GA 3W88A 5AVNA 4WKAA 1JI1A 4ACZA 5LKYA 2FKPA 4GYJA 4CU8A 1X1NA 1OGBA 2E8ZA 3STFA 3QZAA 4JN8A 3T07A 4AEOA 5XINA 2HS8A 3OLDA 3GDBA 3U7VA 4ZMGA 3OIXA 1CYGA 1CEOA 3W7KA 8TIMA 1TVLA 4JIQA 3RUBL 3EMCA 1EXBA 1HJSA 4DQWA 3BV7A 1GKQA 4UQAA 5KZ6A 4PSPA 2E8YA 1W3TA 2OO0A 4GZIA 1R3VA 5BU9A 1IEVA 3QYSA 1W32A 2W5FA 3WQOA 5T14A 3CEPA 1E6SM 3CTTA 3KBSA 2PURA 2A7RA 4IWWA 4YS1A 4R27A 1A5OC 1AW5A 3C0LA 4L6OA 3PWAA 2WJEA 1RCOB 4CU7A 4P8VA 4RE4A 2J88A 1GHRA 4P8UA 1AW1A 1DWHM 5HR7A 3S42A 1GOXA 5HNRA 2BVTA 4AD4A 3LBOA 1J5SA 1BWVA 1Z6KA 3LHZA 1AW2A 5K9CA 3MPGA 2Z7GA 1JUKA 2PWUA 4ZOEA 3GM8A 4S3BA 4Z17A 3WN6A 4DM2A 3W6MA 2Y63A 4GVFA 4M5PA 4J9SA 1ALDA 4IMCA 4MWAC 3ZT7A 3RAOA 5J8LA 2QLYA 4D72A 3FYYA 3D3AA 2EPHA 3H2AA 2PBOA 1GKRA 3H21A 1O5QA 3G1SA 2REQB 3MUCA 5KFLA 5C6MA 2QQ6A 4H6EA 3VKKA 2G37A 1YPFA 4JTQA 1X6LA 1GQKA 3MJYA 1EIBA 3GDLA 1T94A 2C18A 1G69A 3VA8A 1NF0A 3ZFHA 1HW6A 1PKYA 1QNVA 4HSNA 1VHCA 3VM7A 4I8YA 4Q4KA 4K6AA 5XIMA 4UCGA 4W5UA 3AHYA 4J9OA 3IJIA 2PDNA 3SCSA 1OF8A 4NRRA 1IWPA 5CC5A 2QZRA 3EOEA 3B03A 4CQ9A 3EXSA 1J0JA 2UY2A 2YW3A 3TW7A 4XTDA 4MY9A 1NU5A 4GQ0A 3SI8A 4MUZA 1O4UA 4X22A 5DEZA 2F6UA 3QMSA 3K4DA 1TTIA 3PY2A 3HU7A 1LG2A 2XH0A 4HPGA 3P61A 3CUIA 2ACQA 3DHUA 1SU5A 4WUIA 3FJLA 4ZB0A 1V0MA 1O12A 2G3JA 4JR5A 4GXMA 2V2HA 1EFZA 5DGAA 4GABA 1JDDA 3R94A 5CJMA 1AK5A 4B90A 3H7UA 3LU2A 2FFCA 4QE1A 3S5OA 3UJ2A 1XLJA 4I7WA 1F3WA 1S2TA 4JS3A 1EJ7L 1F05A 1YTDA 3OBKA 4X3ZA 3WUGA 5K3VA 1GQIA 4DBDA 1EZWA 3KXQA 3KBVA 1OCBA 4MWAD 4LBRA 2YDQA 3QF0A 4ML4A 3TJLA 1EJTC 5DT5A 1Q6RA 2NQZA 3ZS4A 3QH2A 3GILA 5TAOA 2J9XA 2HK0A 4M0XA 4YHGA 4YWSA 1OFBA 5KT2A 1BYBA 1UUMA 4LUTB 3G18A 4Q8NA 4XTIA 3LV5A 4XB3A 2OYLA 5I3DA 1J0ZA 1TKKA 1EBHA 3Q67A 1XBZA 2WZTA 2XVKA 3L0NA 3R10A 1ZS2A 5CLWA 1FWHC 5EMKA 3DDMA 5E6YA 2YXXA 3S9ZA 2UZ9A 3SQLA 4EBEA 5I3KA 3M0XA 4ECSA 3TK7A 1V6XA 1KNWA 4NT0A 4H8HA 3K4WA 1LLOA 1BG9A 1DHPA 4DJEA 2W4XA 3AIBA 4A29A 5DCEA 3E02A 3IJ9A 3D46A 4M8UA 3UCDA 1ZJIA 4DELA 3UZZA 2NW0A 1FP9A 3TN6A 5HMSA 1O5RA 3GIPA 4X63A 4EAYA 4L4PA 1DP0A 2BY2A 2VC7A 5A6MA 5AC6A 1EEXA 3KLKA 3VC5A 1ISXA 2HCVA 4A3UA 3HG5A 4PMOA 1XW8A 3APYA 4RPQA 4OV9A 2I9UA 2V0TA 2GGJA 3ISIX 4HIBA 4AC1X 2CXGA 1BF2A 4I6KA 5KFTA 1FDJA 2EBNA 3BQ6A 4E3TA 1W3KA 3MQTA 2VHLA 2PWDA 3C3NA 5DXXA 3FK4A 3PG9A 2WCGA 2UVVA 5BW6A 3DENA 3E0LA 4F2TA 4Q8OA 1SFLA 1F74A 1D3CA 1ZZMA 2ZXDA 3E0WA 5D33A 4DM1A 1IEQA 2YL8A 5FL0A 3PFRA 4EPEC 4Z2GA 1KQYA 3UXDA 5JUMA 1ICQA 4FIRA 2R8JA 1UR9A 2W62A 4JYFA 1VH7A 3NAVA 3T7VA 1Q6DA 3MMDA 3NWRA 3F4WA 2DZTA 1L6WA 1F61A 4MYAA 2J7FA 4CNUA 3ZR6A 1NP2A 1F3XA 4PUDA 3NZPA 2P9BA 1FVPA 1KGWA 1QW9A 3UEQA 4H04A 2V68A 2Y89A 5M17A 2CNCA 1PYMA 1UP3A 2YXGA 4V15A 3BMXA 2W27A 4KCVA 1ZY9A 3N04A 1R3TA 2FLNA 3CUXA 4DXXA 1IZCA 3ZYZA 2BB0A 1ZL1A 2I16A 1TCDA 1GVOA 2QCCA 2O9PA 4L9XA 5GNZA 2VFDA 4IJRA 3LPOA 3T2QA 4LAUA 2OGYA 3NYZA 1M7PA 2QMJA 2WNWA 1W91A 4HHMA 4C1NA 3W7MA 3G8RA 4J3XA 1QK2A 2YB4A 4LV9A 1PWMA 2XFRA 3MO7A 1E72M 2PD5A 3SO7A 2A1YA 3LBMA 4QWCA 4GH1A 3D6NA 4ROQA 2JGQA 3FJNA 5BWAA 3KCLA 3MVIA 1QWKA 4U7CA 3CH9A 1BSIA 3MCOA 1QPRA 4J5NA 3CBWA 3WG6A 1AZ1A 3LCXA 2ZZ2A 4LWWA 4B5SA 4GI4A 4E8DA 4JFWA 2OODA 3UWUA 1W9VA 1HG3A 3QKEA 4RNNA 4JN6A 3S6DA 1FH8A 3G1RA 4FNQA 3N6JA 4XZLX 3QEZA 2HE8A 3ITYA 4DWDA 5CSSA 3W76A 3U0HA 3HG3A 1BWLA 4PTXA 3HB9A 2EKGA 3H2MA 3Q58A 3WLTA 1M7OA 2PU1A 4MLJA 2JEQA 3VNZA 4LUSA 1LOLA 3GUWA 4O19A 1F76A 2GDQA 4O1EA 4RDYA 2PCQA 3L2IA 5I03A 3KDOA 1R9XA 2OSWA 5I07A 1KBKA 1QNQA 1RBAA 4N0RA 3N2XA 1E6QM 3DFNA 2J13A 2XGIA 4IJBA 4PR4A 2BVDA 4UOQA 2ZUWA 4ZQRA 3VGGA 1GW9A 4RDVA 2XIMA 1GT8A 3BJSA 3CEUA 1UWIA 3GXIA 4JKLA 4ZTYA 4C7FA 3MI3A 2YDRA 1DHKA 1US2A 5AHEA 3W86A 3O07A 2FYMA 3OHAA 5A6KA 4F79A 3FA4A 3I7SA 1PO9A 1EYEA 5L9XA 3TLQA 1CDGA 2VD9A 3KCOA 1S38A 4H7CA 2PDPA 2F9RA 1NDWA 5G1YA 1GVQA 4HP5A 3WD1A 4F3HA 2A7PA 3BG9A 1NJJA 1H09A 1EGZA 2I56A 4I5RA 1A0DA 2J79A 3QQ0A 1QDSA 2PDBA 2BS9A 2ZADA 2X7WA 2FB2A 1W9PA 2OLAA 3PZGA 2YCKX 2V5DA 3KCJA 3EDFA 3PAOA 2QGYA 2ZRYA 3R8GA 2XZ9A 3KEHA 1WQ5A 2P3ZA 3RNDA 4IP5A 1TA3A 3T0CA 4GZ7A 3UZJA 1D7KA 3KTSA 3SUVA 4TOQA 1V3KA 2HPIA 2XN2A 2CHRA 1H4PA 3EZ4A 1I2QA 5KG5A 4ECWA 1Y8BA 4KRZA 1I75A 1M1BA 3CLWA 2IQDA 3FAXA 1XFCA 2WANA 1XH0A 3G2GA 3KTXA 3WLSA 4QDPA 2Y8VA 2PRMA 2WQDA 1Z3NA 1AG1O 1O7AA 2QCFA 4O3SA 3SB0A 1E0UA 2EXOA 4UNLA 2V30A 3M6DA 1ZB5A 4X0VA 4UFHA 4Y2WA 5TNVA 3NGJA 3SI9A 1MRAA 3UXLA 2V5JA 3H4DA 3TX9A 2SFPA 2FVKA 5LA2A 1D2KA 4JV1A 2ZX8A 3AWOA 3QXBA 1JZ6A 1YPIA 2PWHA 1PCWA 4NJHA 1TV2A 5CAKA 1HFBA 4PTVA 4JTGA 3CPRA 3FXYA 4NP7A 2GGIA 2YCEA 2F6XA 4GIAA 2G4JA 4GUIA 4Z2HA 2A21A 2J6SA 2Q09A 4W9TA 1NDYA 1S5TA 3HPZA 2WNZA 3WNPA 5EWGA 1U33A 4D6FA 2X41A 4PRTA 2D2GA 3CGTA 1WDWA 3OQ8A 1GOMA 1XL9A 4TTGA 4XAFA 2YB1A 2Y70A 4Q22A 4S2BA 1BHGA 2EG6A 1CECA 2NUWA 5EWFA 4AD3A 1MXDA 2W8KA 1W37A 3JU2A 4M80A 3SDOA 4EBCA 3W6YA 3A13A 4KEMA 3NQ8A 4TXEA 3WF3A 1XLDA 1X97A 4FF5A 1N82A 3WFAA 3B40A 4MDOA 3EPGA 3TSBA 5I09A 5K9DA 1QFEA 1KBBA 3F4DA 3UF9A 3H26A 4K38A 3R58A 2WLZA 2GGGA 3M0KA 4PCNA 4JTCA 3BL3A 5KFAA 1CGWA 1BEUA 1NOUA 5FIPA 2PA6A 2PLMA 2CZDA 3CT7A 3EWYA 3GXNA 3ARPA 1DKWA 2NVCA 2G0WA 3E5BA 1XDJA 2Z1BA 5DY2A 2OGJA 4TQSA 1JUEA 1CT5A 1RJPA 3TWBA 3PAJA 4AVNA 1XHGA 3IJ8A 3QY6A 3U3HA 2VRJA 4EWND 1IEIA 1YXCA 3W7NA 1CXKA 3UJSA 3QR0A 1LCOA 3E5PA 3RJYA 4IR1A 3GBDA 2WMHA 4WLCA 3GQYA 1NP0A 3S46A 3C52A 4B2DA 4XISA 1WKFA 1Y5VA 1RY0A 3AU2A 3QTGA 2OCZA 3GAYA 5C9XA 3BQ2A 1OC7A 1S5WA 2ZX7A 2V82A 1AQHA 3WCZA 4WEVX 3FYPA 4L6DA 1OFEA 3WQPA 2BOEX 1RCQA 1ZAHA 3CJPA 4IQJA 1JF6A 3T08A 3N6HA 1DBTA 3VOGA 3F4CA 2D0FA 3MSYA 4D6JA 1GYMA 5KFCA 4S23A 3T78A 2BVWA 2X1RA 1J01A 1Q3NA 4O53A 3GHRA 3P8JA 4PL2A 1YBQA 4HZ7A 2Z1WA 5F2LA 3V3WA 2QAFA 5B7ZA 4KFNA 1WPCA 1CGYA 2DU2A 3ABSA 4JTTA 1JPHA 3GC2A 5FESA 1ZCOA 4JL2A 3S6OA 1VBGA 2O9RA 1OYCA 1BXCA 1XBVA 2CLIA 4CQ8A 4J9MA 3VUPA 5BOFA 5AC4A 1XX1A 3RXZA 5DLFA 4J2PA 4DF1A 3H8AA 1FWJC 2E5CA 1B3WA 5CPOA 2V4QA 1DOSA 4LQ1A 3TA9A 4PCPA 1QNOA 1TMQA 3WNOA 3ERPA 1TE6A 4R7OA 4JY9A 1JCJA 3GK0A 2PDJA 4E8CA 2ZUTA 2QAPA 4IF2A 1GORA 3FX4A 4BJHA 1VEMA 2WC3A 4Q6JA 1RQBA 3W7PA 3T5HA 2NT0A 3GW0A 3CMFA 5C7HA 1R3SA 3G77A 4J4KA 3B4YA 1L6YA 2B7QA 1F07A