4CQDA

The reaction mechanism of the n-isopropylammelide isopropylaminohydrolase atzc: insights from structural and mutagenesis studies
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
401
structure length
401
Chain Sequence
KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSAAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE
publication title X-Ray Structure and Mutagenesis Studies of the N-Isopropylammelide Isopropylaminohydrolase, Atzc
pubmed doi rcsb
source organism Pseudomonas sp. adp
molecule tags Hydrolase
total genus 161
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 4cqdA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4cqdA02
3RYSA 4ERIA 4HJWA 2Y1HA 3BE7A 4PE8A 2P50A 4TQTA 3E2VA 3F2BA 4ICMA 1A5MC 4GX8A 4GZ7A 1HZYA 2YZ5A 3QY7A 1FWCC 3ITCA 3FDGA 4KEZA 1EJVC 3SFWA 4CEXC 2DVXA 2F6KA 4V1XA 2WJFA 4PBFA 1ONWA 4C65A 3GTFA 2Q09A 2RAGA 4NP7A 4F0LA 4GY0A 2ZC1A 2AMXA 4B91A 1UMLA 4H9VA 4G2DA 4DZIA 2QT3A 1NDZA 4C6BA 1NDWA 3GIQA 3F4DA 4BY3A 2EG6A 1EJSC 4IFKB 3E38A 1KRBC 4GXWA 2EG7A 4C6NA 4E3TA 1IE7C 4PBEA 1NDVA 4G7EB 1J79A 4V1YA 3EGJA 1J6PA 1FWHC 3WMLA 3F2DA 4I6VA 1PB0A 1RJPA 4C6IA 1PO9A 1V4YA 4MUPA 3E0LA 1UIOA 2WM1A 3UBPC 4EPEC 4B90A 1XRTA 4C6PA 4KEVA 4IG2B 1YBQB 4F0RA 3CAKA 4IF2A 4QTGA 2I9UA 3LGDA 1A4MA 5HMDA 1PTAA 3B0YA 2GWGA 4HK7A 3GGMA 4NI8A 1POKA 2VUNA 1NFGA 2QVNA 3MVIA 4C6MA 1FWIC 3ORWA 2D2GA 2FVMA 3WYZA 2E1WA 3FEQA 4IFOA 1I0BA 3HPAA 3S2JA 1M68A 1A4LA 1WXYA 4AC7C 2OODA 3MTWA 1EJXC 3OQEA 1UIPA 3DUGA 4XD6A 4H00A 4HA0A 4LEFA 1EJRC 2R1PA 3GTHA 4XD3A 3S4TA 4CQDA 3GU1A 4DLFA 1K6WA 2Z28A 3RN6A 3N2CA 4LFYA 5G4HC 3TN5A 4RDVA 3TNBA 4P5UA 1KRCC 3AUOA 5HMFA 1EYWA 1WXZA 1R9YA 4C6EA 4C6CA 3GU2A 4C5YA 2ANUA 4LAOA 2VC7A 3LSCA 1EF2A 3TN6A 4EPBC 3KM8A 4LALA 1FWBC 5HMEA 4H9YA 4CNSA 3S2MA 1R9XA 3C86A 2AQVA 4JOMA 3IJ6A 1R9ZA 4DI9A 4C6KA 2PUZA 4H9XA 2E25A 4OFCA 3CS2A 2OGJA 1RAKA 5FSEC 3FDKA 4ZSTA 2YB4A 1K70A 4ZSUA 4UBPC 1FWGC 1W1IE 3IGHX 2HBXA 1A5KC 2DVTA 1RA0A 4R7WA 2FTYA 4EP8C 4KQNA 3URQA 3EWDA 1J6OA 3PAOA 2AQOA 2PAJA 3S2NA 3SO7A 4PCPA 3V7PA 2CZVA 3MPGA 3R0DA 1A5NC 3QGAC 4J2MA 4IQJA 1DPMA 1I0DA 2PLMA 3LGGA 4DYKA 3T81A 4BKNA 1J5SA 1ZZMA 1XRFA 3MJMA 4XD4A 3LNPA 4KERA 3GRIA 4LANA 4H9UA 1YRRA 4DO7A 1M7JA 1ONXA 1K1DA 4PCNA 4GY7A 4C6OA 2W9MA 1FWFC 4GC3A 4DZHA 2VR2A 2OOFA 1ITUA 4RE0A 3GG7A 2FFIA 4LAMA 1YNYA 3K4WA 4LCSA 4J5NA 3MVTA 3DC8A 4IH3A 5AKQA 4AQLA 3IACA 1GKRA 1FWAC 2GOKA 4CQCA 3O7UA 3OVGA 3IRSA 4GY1A 4KF1A 4CNUA 4H9MA 1PSCA 3RCMA 4CNTA 4XAZA 4HK6A 3URAA 4CEUC 2Q01A 3D6NA 1XGEA 4RDWA 3IV8A 2QPXA 2Z2AA 1FKXA 1RA5A 1O12A 4L6DA 1QW7A 4GX9A 1A5LC 5FSDC 2Z4GA 4C5ZA 3S2LA 3GIPA 3LU2A 4XAYA 2FTWA 2R1MA 4LH8A 3MSRA 2BB0A 4QRNA 3B40A 1RK6A 2XIOA 3PNUA 5CH9A 4QSFA 1KRMA 3OODA 1NDYA 4J35A 1O5RA 3OU8A 1YBQA 4KETA 1RJQA 3F4CA 3LY0A 2Z27A 3IARA 3G77A 4KESA 2VHLA 4IFRA 4H01A 3O0FA 1GKQA 1P1MA 1V51A 4HK5A 3URBA 2HQAA 4C60A 2YXOA 3K5XA 1VFLA 2EG8A 1P6CA 4QS6A 4LCRA 4NG3A 4EPDC 3GUWA 4XD5A 2QS8A 3HM7A 1V79A 4C6JA 1FWJC 4I6KA 3PNZA 4XAGA 2R1KA 3PBMA 4BJHA 3A3WA 4WVXA 4LCQA 1A5OC 3T1GA 2VC5A 2ICSA 1QXLA 4D8LA 3A4JA 1YIXA 2ADAA 3GTXA 1ADDA 2Z00A 1KCXA 4INFA 3GTIA 1FWDC 3E3HA 3HTWA 2Z25A 2UBPC 2G3FA 2GZXA 1YMYA 3NQBA 3CJPA 2R1LA 2A3LA 4DLMA 2GWNA 1POJA 1GKPA 3ID7A 4YIWA 2WJDA 4B92A 4C6QA 4CQBA 3PANA 1EJWC 3LSBA 3K2GA 2PGRA 4RDYA 4B3ZA 3B0XA 4RDZA 4GBDA 4R88A 5LXXA 4GK8A 2UZ9A 4GOAA 1BF6A 5A6TC 1V77A 4IGMA 1S3TC 2D2JA 1V7AA 3URNA 1ITQA 4KEUA 1M65A 4GYFA 4H9ZA 4XAFA 2DVUA 3RHGA 4IGNA 2FVKA 1RK5A 2WJEA 3JZEA 2O4QA 3E74A 4EPKA 1EJUC 3UR2A 2VM8A 3QGKC 3T8LA 2HPIA 1RJRA 3GU9A 3ISIX 3MDUA 4H9TA 4Z42C 2Z24A 3NURA 4QS5A 2O4MA 3LA4A 4KIRA 4IFKA 4RZBA 2PGFA 3MDWA 4M51A 3UF9A 2OB3A 4R85A 3UPMA 3DCPA 3E0FA 4UB9A 3IPWA 3NEHA 2YB1A 2Z26A 2D2HA 1KRAC 4G7EA 1EJTC 2KAUC 3TN3A 2Z2BA 3MKVA 5E5CA 2HNHA 1EZ2A 1XWYA 1JGMA 4C6FA 4C6LA 4QROA 4DI8A 2Z29A 1FWEC 1P6BA 4IG2A 4DNMA 4DIAA 2R1NA 3QY6A 3ICJA 2OQLA 3QY8A 2Z7GA 4L9XA 3EWCA 2P53A 2BGNE 2I5GA 3UR5A 1UBPC 3AU6A 3TN4A 4WHBA 1FKWA 2GSEA 3OJGA 3OOQA 1E9ZB 4WGXA 2IMRA 1E9YB 3A3XA 3LS9A 2P9BA 4C6DA 2HBVA 3WZ0E 2HPMA 3F2CA 4LAKA 4ERAA 4F0SA 4ERGA 3AU2A
chains in the Genus database with same CATH superfamily
4QNWA 2E8YA 3CGTA 1D7FA 4NJGA 4KW2A 5CC3A 4PN2A 4CCEA 2W9CA 3MSDA 2YZ5A 4ZEPA 4RXGA 3THCA 1I2PA 1G4SA 1QR7A 1PCKA 3QSRA 3KBWA 2HVMA 1NJJA 4UMAA 3TYZA 2Y7FA 4GY0A 4A8NA 2GDUA 2NW0A 3P82A 1UP3A 3W7CA 3AZTA 3GVRA 4WSHA 3SY1A 1ADSA 3GAYA 5KFWA 3OGRA 5F2IA 5CC7A 3CT2A 3RMEA 4HGXA 1FH8A 4A3YA 1TVNA 4ALDA 4V1YA 4JPGA 1TV3A 4QSHA 5CZ0A 1QJWA 4A21A 1XLMA 3TYBA 1C7TA 1QHZA 5BRBA 2WM1A 6TIMA 1WXJA 4GMEA 5H91A 3RPTA 4KEVA 6XIMA 5M17A 3ONCA 4FPSA 2HVNA 2D23A 3CIXA 4W93A 2JEIA 3OHIA 3GGMA 3Q4DA 1VJIA 3FKKA 1CXHA 1YE4A 4IMCA 4CD7A 2Y6ZA 1FDYA 3AISA 1C29A 1JPDX 1TPFA 1DHPA 3VKKA 2W5FA 2YOCA 3T0AA 4N9BA 3W1RA 1A4LA 1MFUA 3KVLA 3WH5A 2ZRVA 3DUGA 4LYRA 4H00A 4AHPA 2OJPA 2GVGA 1DXFA 1DJGA 4CD5A 2F84A 4GRSA 4O16A 2ISVA 2Z28A 5EGRA 2A2IA 4S3EA 3VZZA 3AUOA 3IJ8A 3BC9A 1JCMP 4GI8A 2VFIA 1WXZA 3DYMA 1LQ0A 1NWRA 1E9IA 3PBWA 4WXYA 4MZYA 2ANUA 1Z42A 4AEOA 3WCZA 3ABRA 2HXTA 3GVGA 5AC4A 4ZQNA 5G2HA 4D6DA 1OABA 1FY6A 3UT0A 3NQCA 3WLHA 1AH0A 4R7JA 1OFRA 4CVUA 4HHLA 2A85A 3IIVA 2PUZA 1F07A 2O9RA 2OGJA 1F5ZA 1I60A 2PDCA 4RPQA 3T78A 3U9IA 3BDKA 1A5KC 2O0TA 1AQHA 3CIVA 4MWAC 5CBJA 1K8ZA 3H53A 4WLCA 3ARSA 2H9AA 4MYAA 3WL0A 3V7PA 4IL0A 3L4VA 4A3RA 3DYOA 4DF2A 4G6CA 4NT0A 1OCBA 1SW3A 3NQ2A 3ARTA 1PHQA 1AW1A 3EOEA 5DY3A 4UTMA 1HVXA 1TRDA 2W9MA 4TTUA 3TP4A 4L64A 4RE0A 3SM0A 3UERA 4BK9A 4J5NA 4F2TA 4WUIA 3UP8A 1GKRA 3O7UA 1GVRA 5DLGA 4EBEA 4LNYA 1V02E 2RKXA 3DFPA 3VC6A 2W92A 3W84A 3CASA 2VA3A 2Z6JA 2HVOA 4GX9A 1ZAHA 4W9TA 1A5UA 1A53A 3QKZA 4LH8A 4PRTA 3PWGA 1F3XA 3QFWA 4RE3A 3BJFA 3CMFA 5E1QA 5A6BD 2CZEA 3LI1A 1MEIA 4WSKA 3H22A 1EEXA 3F4CA 2X40A 3L12A 3G77A 2VCCA 4PB4A 4Z1CA 2VCAA 3NO5A 2GGJA 3GR8A 5AZ1A 1BGGA 1KLYA 4OE7A 1TQJA 3K8LA 5DBTA 1AZ2A 3ZR5A 1LG2A 1M04A 5HQLA 1PYMA 1LUCA 1KKOA 4EF9A 1D3CA 3CAVA 1OHLA 3WMBA 5FEWA 4FS9A 4G7FA 1SVDA 5C2XA 1I2RA 1P1XA 1OX4A 1E0VA 5KFDA 1HO1A 4ROPA 3OYZA 2A21A 4OV9A 3CV7A 4Q4QA 4B5UA 5E93A 3KRBA 3LM7A 3SSZA 1FWDC 2GZXA 1TUFA 1TCDA 1AD1A 3ZS4A 4XZWA 3MSGA 2VTFA 1UYQA 1R85A 1PZ3A 3IWPA 2IS7A 3UY8A 4J9RA 3ATYA 2FLNA 3O16A 1F73A 2VZTA 1IQ8A 1TPVA 1O95A 1MW1A 4M1BA 3VCCA 4RNFA 3URNA 1EC7A 2F8QA 3WLRA 4I8DA 3GHRA 4GYFA 4H9ZA 3VMPA 3R8HA 1KA9F 2O4QA 4J9JA 3TJIA 1R2SA 2I14A 1ZAJA 4AZ7A 5KT5A 3RM4A 4H9TA 3LG3A 3G8RA 4GHRA 4M80A 3SEPA 3C0SA 4GXPA 1F2JA 2SFPA 3ERPA 3UWYA 4U10A 2ALRA 5B7ZA 4B5WA 2DUXA 1DE6A 4HTBA 1WP6A 2O9OA 2QJNA 3S6OA 1Q6DA 3W1LA 1W1ZA 4MHBA 1J12A 2W8KA 1HKJA 1W0MA 3A47A 1V0LA 4I5UA 2W62A 2Z29A 1FWEC 3LHYA 4IG2A 2JEGA 2UVRA 2R1NA 2G3MA 5GVJA 4L80A 2PPGA 1G9HA 4PMZA 1Q8JA 4MJZA 3SADA 1MUWA 3BO9A 5I5RA 3VPLA 1EF3A 3TN4A 4QQ3A 4ZOCA 3U48A 3NL6A 1VBHA 5AYYA 4J3VA 4FXRA 2IMRA 2ZIDA 2NQ5A 1H7NA 3MMDA 3I4EA 4WY0B 2XVNA 4O3SA 1JCXA 1XLHA 1TG7A 3DH7A 1W91A 1A3WA 2Y88A 4QCEA 4ZTXA 3A5FA 3FS2A 1Z32X 3ZO9A 2Y1HA 1UR9A 2EHHA 4TQTA 4IR9A 4F0KA 3CIWA 1DQXA 1S2TA 1KM1A 2ZRYA 4J3ZA 2R9RA 3OHAA 2B7PA 1OG6A 1F6KA 3FDGA 4JD4A 3SUVA 4X9YA 2PRMA 1QOQA 4DWSC 1WUFA 5BXTA 4LVFA 3PW0A 5KFHA 3PG8A 3H4WA 2PDWA 1QNPA 1U1HA 5LGXA 3R43A 1VYPX 3PP7A 1U22A 2CESA 1Z69A 2ZICA 1V6UA 5TNVA 4MWAB 4FR6A 2NX3A 5FI8A 3U4FA 4WD0A 4N42A 5KFQA 1F6PA 5FOOA 1SZGA 2QMKA 1U1UA 4LXFA 3U57A 3KTSA 3CHFA 4AY7A 2R8IA 5EDWA 1EOKA 5I6SA 3RITA 4GXMA 3I7SA 4NJHA 2E6YA 4ML9A 1FWHC 3AO0A 4Y96A 3WMLA 4WSJA 3W1QA 1KM6A 9XIMA 3T40A 5CZKA 4YVVA 3UBPC 4NXKA 5CPSA 2XFYA 3EKGA 5JMUA 3GIIA 5HMDA 1E4IA 5AC8A 5IFTA 2REQA 4K3ZA 4XTDA 4J9LA 4FBUA 4TV6A 1WQ5A 1S97A 2V5CA 2VX4A 2JE8A 3V1PA 5D4YA 4HKPA 1RLDA 2E1WA 3XIMA 4DUOA 1B9BA 2JKPA 1M68A 2ZUTA 3KAOA 2JALA 2OWWA 3FVMA 1EJXC 3L0NA 3NZQA 4IPIA 1WKYA 5EMUA 1OZMA 4DJFC 3FY1A 2ATMA 4LEFA 4EAYA 3TDFA 4BI7A 6PTDA 1AJZA 4G56A 3GTHA 3NOEA 2V2DA 7ODCA 5G2WA 1Q6FA 4IISA 2J6SA 4CN4A 1REQA 1CYGA 2E5DA 4XK2A 1SFJA 2DZXA 2PGEA 4NILA 4MWAD 4I7UA 2X2YA 4HU4A 4JYFA 5DRIA 1DKWA 4DB7A 1OVDA 3PTMA 3WQVA 2ZWYA 4GZIA 3M9OB 4FB7A 3DG7A 1CENA 2FVLA 4LVAA 4B4FA 1JCLA 3S2MA 1EQPA 4ONVA 2YA2A 2J88A 4JIHA 2ZADA 4ZTYA 3N34A 2Y8UA 1UWAA 3AIUA 3WFAA 3CS2A 4RV3A 3S1WA 4UIOA 1K70A 1GVIA 2YDQA 4PYSA 1FHDA 5FL1A 5L6UA 4GH3A 3G0XA 1RD5A 1QPNA 5EMMA 1IM4A 3N6QA 3G1RA 1XIMA 3R0DA 3EDFA 4HA3A 4J2MA 3OYXA 2NV1A 3I4KA 1IIHA 5CKSA 2PLMA 1XBXA 2BOFX 3QR3A 3A6OA 1JIHA 4X0NA 4Z2JA 2QF8A 3GXPA 3ZJ8A 1IF2A 1SJBA 3NXFA 1QVBA 1XC4A 5M1TA 3NCOA 4ZQPA 1UWUA 4E2OA 1IXNA 2YBUA 4LAMA 1RQBA 3NPVA 1GW9A 2W6RA 1PSCA 3KVJA 5C2GA 3M6DA 3S1GA 3G8EA 4LC8A 3IV8A 4MF4A 4I9AA 2FPTA 5IM51 2CZ5A 2WMIA 1X6LA 3WQDA 3SRFA 3R2GA 3VNLA 4PUWA 1A5LC 3TMLA 3BLPX 3W38A 1P7TB 3PUDA 3AICA 1BQGA 1XYBA 2VGIA 2WNZA 3JRKA 2FMOA 4QSFA 3BV4A 3BMWA 3QOKA 3AMLA 1YNPA 2FGLA 2QR6A 1RV8A 3VTRA 2GGGA 2W79A 5C54A 5L9XA 4ECYA 1K7FA 2XINA 3AXKA 3URBA 3UXKA 1HL9A 5DQGA 4QS6A 3VOCA 4ZQMA 3QTGA 1R3YA 1F4AA 4K6AA 3I68A 3PW7A 5AHLA 2YFOA 4GVHA 3A3WA 3OVRA 4GVFA 5BROA 3LXAA 3AHTA 1K7EA 3GG8A 3MMUA 1XQKA 1ADDA 3PR4A 1KCXA 4INFA 4Q8FA 1JI2A 2J6XA 3N15A 2Q71A 3Q65A 3OB8A 3SRKA 1UOKA 2X42A 4JTGA 3BLLA 4Q45A 3HQ1A 1IWAA 2AAAA 3SSJA 2OYLA 1I2QA 3ZYZA 4DWSB 2OSXA 1CXEA 1HNYA 3FN9A 3OHBA 3PZUA 1DYSA 4M3PA 4ZB2A 5JU6A 4Q7IA 1BF6A 4OJYA 3AHYA 4NQ1A 4WJEA 4XB3A 5EY5A 4KEUA 1J2WA 2FPYA 4HYKA 1U2YA 3UGVA 3H23A 4CU8A 4ORIA 2X1UA 1G94A 4DBEA 1O5QA 4JFUA 4AG0A 3E74A 2PDGA 3KP1A 2VM8A 3AS2A 4MUZA 1MQPA 4DM2A 1KV5A 5I24A 3IANA 3MDUA 1K3UA 2J9XA 1KFEA 1Q13A 1UCWA 4ZOEA 3C0LA 3PZMA 1DE5A 2YCKX 1W3JA 5ABFB 3NQFA 3LHUA 3W07A 3Q8RB 4ZO6A 2GJLA 3SCUA 1SZNA 3FW6A 4JIRA 3NEHA 1BQCA 2XSBA 4DO4A 3D5HA 2CXGA 4G7EA 4H8VA 5DCBA 2GVYA 1DJWA 2W67A 3OA3A 1I45A 5DGAA 1Z44A 3EXTA 3LQGA 1JGMA 4ZE5A 3MCNA 2Y61A 2Z6IA 3PHAA 4GZEA 4QROA 4Q3MA 1E0WA 1GYNA 5L1IA 2C19A 2GVLA 2D22A 1QO2A 1NY1A 1KFBA 1B4EA 1PXGA 3NSNA 3HGOA 4QISA 4DWSD 4WHBA 1PE1A 1EUAA 1YTKA 1LWJA 1B54A 5A6KA 3EPOA 4W5ZA 3N29A 1W5NA 3KZSA 3H40A 4NHVA 3TV8A 1TWZA 1J0IA 3N17A 3UESA 4Q4PA 3STCA 2P50A 2FTPA 3WIJA 3EEZA 1GVQA 5DLCA 3EPMA 2WPGA 3TX9A 1QK2A 3ZWSA 2ATSA 1ZCCA 4MB1A 3SGUA 1PEZA 5HNNA 3H2FA 4WY0F 2J7BA 3P74A 3LRKA 3UD6A 2DVXA 2PD9A 1Q5MA 3BMXA 4M6UA 3RLVA 4TQRA 3L2LA 4IIFA 5FL0A 4W84A 5F2MA 2ZTJA 3UWWA 5I03A 3PSVA 3GNNA 3T2QA 4ACYA 5KFZA 4BWLA 4IFKB 1DJIA 1JPHA 3Q8QB 1H0IA 3WH6A 4FIQA 1KQZA 3O6DA 3QZ7A 3CUZA 4UCGA 1S3HA 2YW4A 3I10A 1DXIA 4Y9MA 3TZNA 5HINA 3LCHA 1G5AA 1MXDA 2P8BA 2QW5A 2DZSA 4DJFD 1I4NA 3CZKA 4ATDA 1FA2A 1ME8A 2G41A 1N8FA 4MWAE 2QJGA 4C6PA 5FAGA 1US3A 2YCJA 3GDMA 2HK0A 4RNOA 4JL2A 1WOBA 2DUAA 3TKFA 1L2QA 1UR0A 1Q8AA 3PTQA 3LCIA 3LZ3A 1AZ1A 4PUKA 2WW5A 3M0KA 3ZT7A 4JXCA 1KM5A 3G6LA 2X0YA 3PZOA 3IEBA 3PSWA 5KG3A 5EA9A 2PS2A 3FYOA 1H41A 1XDJA 3EMQA 2ISFA 3GDKA 4DWDA 2ALZA 3VMNA 3N2CA 2PLKA 5I78A 2ZZ4A 2OELA 5D2VA 2XVLA 2WNQA 3WDIA 1AMYA 4H8NA 1YE6A 3C5QA 4KRZA 3VIIA 3B9OA 4RX0A 2VC7A 1RPKA 2HRWA 2FDSA 3AYVA 1VPQA 3JS3A 4RK8A 1TV4A 3V75A 3STFA 4AYGA 1C7SA 4JOMA 1HXJA 4LBRA 4O50A 3AWNA 2Z1BA 5C2CA 2D2OA 5JQ9A 3UJFA 2C6QA 4R7WA 3W7NA 3TSDA 3QYSA 1VEMA 4PCPA 4KKXA 2MANA 3N4FA 2BY0A 1UD5A 3R25A 1OX6A 4DYEA 3OP2A 1O5XA 3AJ7A 4HHPA 4I5XA 5LSMA 4GIAA 3Q45A 1H11A 1V3MA 5LNUA 1UKPA 3RB0A 1LBMA 1YRRA 1E70M 1RBLA 3BVJA 3SUSA 1Q6EA 1JGIA 4GO8A 3TLQA 5CZTA 4XZNX 2I57A 3W82A 4QWBA 5FJRA 1ITUA 1XC6A 4WKHA 4CNNA 1T94A 2NVCA 2Y5JA 2XG9A 2PWVA 3A4WA 2PP1A 2DU2A 3ANYA 1EPXA 1BXCA 4CNUA 2DZWA 1CNVA 3VABA 2WOQA 4UC5A 3RJYA 5KFEA 5FESA 2YX0A 4L4OA 2QGYA 4XSMA 4PMRA 3KRUA 3V4BA 2PSNA 5I3HA 3L2IA 4G1NA 4RZ6A 4UQAA 1WA3A 2R6OA 2XN0A 3S2LA 5LKYA 1BLIA 3R11A 1QI3A 1PVNA 1DP0A 1IT0A 1VR6A 2NWRA 4Y2WA 1CTNA 5AC7A 3S9YA 1CBGA 1R5YA 5CZJA 4P8UA 4GQBA 4KESA 1IT7A 3WQOA 4XVDA 2NQZA 3N2BA 1U1JA 2QS8A 1EBGA 1WZLA 4I6KA 4WIWA 3PNZA 1AQFA 1R3QA 3CLWA 1BPLB 1IZCA 4HQVA 3T1GA 3G0SA 1HKWA 3W2KA 4G5DA 3LCXA 4GCXA 4F0MA 2FQIA 5I23A 4S2BA 4DO5A 1SUXA 3GR4A 2J8GA 3HTWA 3U2ZA 3V5CA 4PL1A 4F66A 1KXQA 2R1LA 3TOYA 4DAFA 3LD5A 9XIAA 2BXZA 3KW3A 2WBKA 2VQUA 2OZ8A 3K2GA 2PP0A 4PRRA 2E28A 2PDUA 5FEXA 4GOAA 3BG5A 4W7WA 5D2WA 4UXDA 3DG3A 3SN1A 1QRQA 3Q94A 4E8GA 3T4CA 1ITQA 1E55A 3FGCA 3GZ3A 3LPFA 2OYMA 5H6HA 2Y7GA 2F61A 1OT1A 3IGUA 2WTFA 2NUWA 4AHQA 2C71A 3IIOA 4Z42C 4GC6A 3B8WA 2O4MA 1A5SA 3MWAA 2DSZA 3W2NA 5CBIA 1SW0A 3BWWA 1QBBA 3R8GA 6CGTA 1JCNA 2HWGA 2GSHA 4F4YA 1H49A 3TN3A 1JXKA 1MEWA 5I09A 5HANA 5EWEA 1ONEA 5DCEA 4C6FA 5KZMA 3BAIA 2J78A 1B4KA 1O7AA 3QN3A 4DXKA 1BWKA 4XWUA 5EWGA 4D1JA 4WJ8A 4NYYA 3KOZA 1VGAA 2BHYA 1QNSA 3N3MA 1LZOA 3KBNA 4AIEA 5KG4A 5D38A 2C15A 3W7EA 1TRIA 4WX2A 3TA6A 4WGXA 2HDJA 1RLCL 2QCDA 5CPTA 5L1LA 3O05A 1XPGA 3EKLA 1TPEA 4DL2A 3EB2A 2TODA 2W9BA 2E68A 5D2XA 4C1LA 5AYIA 3VD4A 3M9NB 6XIAA 4DBWA 3KCLA 4P8WA 4J9PA 1H51A 3EX1A 4K1WA 4IX2A 2C1HA 1I9CB 4IQLA 2BP1A 1B3OA 1HGYA 3W22A 1JUBA 3GDBA 1PAMA 4ED2A 3WF4A 2WAGA 3K8KA 2C2DA 3TQPA 3VI2A 3OGSA 4FX8A 5B7YA 1BTCA 1JD9A 4DZIA 2H90A 2EPMX 3M46A 3DENA 3EX4A 4MGGA 1VJZA 5IBXC 4UTKA 4MLRA 4N9CA 1IE7C 3NQEA 1CGUA 1WCGA 3R94A 3ARWA 4DF0A 3PW2A 4FXJA 3VDGA 1IEWA 1E5NA 1OFEA 2CKRA 3NQAA 3TQ1A 3UXIA 2DSVA 4JIIX 4KGLA 3RNDA 1D2KA 3PY2A 3WD2A 1VP5A 2NVDA 2C0AA 1SR0A 1UA7A 3B3DA 1A4MA 4M29A 4CQ8A 3VNDA 2QNEA 1POKA 3M0JA 4S23A 2WWCA 4GQ0A 2AGOA 4Z0JA 1OCJA 4PMQA 3PBYA 3LENA 4QWAA 1WDWA 4AC7C 3MR5A 1J9YA 5KFTA 2A1YA 3MHGA 4JTEA 2XH2A 2PP3A 1JEZA 1Y5VA 4N6EA 1IGSA 2BVDA 4JHMA 3IGSA 5E0FA 2WCSA 5C9ZA 1VYSX 1I1WA 4W8AA 1CX9A 5CGTA 1TX2A 3MO7A 5LA1A 5I02A 3BG9A 3DZ1A 4QBXA 4I9TA 1JDAA 4S3FA 2CW6A 1VENA 3HG3A 3WLKX 3TC6A 3RIKA 2WMGA 3G1FA 3V1HA 2Y24A 2WVSA 1V7YA 2J8TA 3ES7A 1BTMA 3W02A 4J3UA 4WOQA 1R9ZA 2E9LA 4DEFA 2JEPA 4PULA 4A29A 2IXUA 1B0IA 3IGHX 5D9OA 5BRPA 1GOWA 3NPXA 1MQQA 3SECA 3H24A 1TV8A 3LN3A 2GJXB 3SI8A 5F1VA 1WOAA 1YPXA 3NL2A 4DM1A 1HKKA 1JQVA 4UMBA 2C13A 4DAIA 1S0OA 2DQXA 3Q8PB 3AXMA 3GRIA 2VFFA 1IEXA 1KWGA 4H9UA 7REQB 1KFLA 9CGTA 3FSTA 1IZJA 1W5PA 4GY7A 5HWJA 1H0GA 4XAPA 4JHZA 2D3NA 3FFSA 2OT1A 3TYEA 4AY1A 4HZ6A 3J7HA 3L2MA 3LMZA 4S3JA 4HMCA 2V0TA 3DAQA 4AQLA 4ZQCA 4AWSA 5A6LA 4HU3A 1V02A 3H21A 1A50A 2WVVA 2HSAA 1R0MA 5U7SA 3KUMA 4B9YA 1S2VA 1XGEA 5A8PA 1DOSA 1RA5A 4Q4MA 4QGCA 1US2A 3M5ZA 3WNOA 2WMFA 1QO5A 1ZPTA 3CYJA 1YYAA 3DGBA 1YDOA 2I16A 4IMDA 5CGQA 3LU2A 4XAYA 3MSRA 3AMKA 4TUFA 3GNPA 1GVSA 2ZZ5A 4L4LA 4R9XA 3JU2A 2CZDA 4WDWA 2OG9A 4CCZA 2OO6A 1RALA 1V51A 2V9DA 4C60A 4F3HA 2V5BA 1G7VA 1UKTA 3CB3A 4NG3A 3GUWA 3QEZA 4OWGA 3D47A 3V35A 1A5OC 5GJNA 1V0NA 2NX1A 4RKAA 2XH0A 3R1ZA 3W72A 5DLFA 1TZ9A 1E6XM 4AZIA 3GZAA 4XZBA 3GVVA 1GQIA 2WB5A 2X05A 3O63A 1YMYA 1TWSA 4KWVA 2X0SA 4JHOA 3I6RA 3PZ9A 1NP2A 1POJA 4YTTA 4B92A 3W81A 3JVAA 3S47A 3WF3A 4S3CA 1S0NA 2JF7A 2WC3A 3GG0A 1TWDA 3MUCA 2V5LA 2QDGA 4R88A 5ABEA 4I90A 3L68A 2DFAA 4K1GA 2XN1A 2I5QA 4AUBA 2CLKA 1UWRA 5JH1A 2W8LA 5KT2A 4QDMA 1ISVA 3OLEA 2OCZA 2FVKA 1HW6A 4PUNA 3SN0A 4K39A 4KT2A 3T42A 1XFBA 3BL3A 1YDYA 3WSUA 1L2UA 4OOUA 1EA9C 2BMBA 3UF9A 1BYAA 3G6VA 3CWNA 4XQ6A 4U3CA 3QZ6A 1MZHA 4K8GA 3POHA 3W74A 4PUUA 3THAA 1ME7A 3BGGA 3B0VC 3NM3A 3MQTA 2WZEA 3PBUA 1XWYA 3TXVA 5FJUA 1P5BA 3POCA 3IJ7A 2QULA 1OK4A 4M6PA 3M7SA 3PJTA 3S1UA 1MXGA 4I5RA 1CXFA 3BW3A 4MM1A 1IEVA 2CWXA 4ZFCA 3U5YA 5BXRA 3WF2A 3CUGA 1EDGA 3QW3A 3C2EA 1KGUA 1GJPA 2HBVA 4WR3A 3WLIA 1HP5A 4NZFA 1GG1A 3JZUA 4UNLA 1UH4A 2ZX5A 1JZ2A 4UQDA 1XM3A 1JUEA 1GZ1A 4Z17A 2BV9A 3PN8A 4NRRA 4ERIA 4PE8A 1L6FA 3FDSA 2RJGA 3U2EA 1JNEA 2Z7KA 4W89A 4W8BA 2X7WA 4L4MA 1WAUA 5BNKA 1EQCA 4WDXA 4UR7A 4KEZA 3S5NA 5PTDA 4YQWA 2F6KA 3W23A 4FLQA 4H7ZA 3WDPP 2P5NA 3LHWA 5FEPA 4DUXA 4HOZA 3MO4A 1M9HA 1UMLA 2RUSA 3BK0A 1AQ0A 4BY3A 1EO7A 3NDOA 1EJSC 1TFVA 2GQ9A 1CEOA 4RPPA 3WH7A 4WF7A 2VNCA 4AX6A 4BEQA 1CW2A 4AIBA 4X3ZA 2HCVA 4DL3A 1NDVA 4O4VA 4U33A 1M03A 3VGHA 5EL1A 4C6IA 1TPWA 3NQ7A 1PO9A 2WHMA 5JUVA 3E0LA 5KFMA 3ARQA 1TIWA 3FEMA 4F40A 4N2YA 2W0UA 5KZ6A 4UTWA 4F0RA 1AW5A 3MW7A 3QSTA 1XFCA 3ARPA 1GQJA 1J0ZA 4MY9A 1JRBA 4CCCA 3HN3A 3NXLA 4Q7BA 4YTSA 3W71A 1Q7QA 1S2CA 5BOEA 3CBWA 1W5QA 1RH9A 1YXYA 3V6JA 1W8SA 2PDIA 5DBUA 5D32A 5HATA 3FEQA 3W1NA 1WXYA 2PDYA 1XD0A 4MY8A 1H2JA 4UMCA 4PMOA 2IXVA 3M0XA 1OYCA 2FDMA 2CU0A 2DPIA 4YU1A 4NZJA 1EJRC 5EYWA 1ML1A 2ESCA 3W26A 3S4TA 4Q8TA 3EOUA 2YBVA 4HCDA 2ZXQA 3A23A 5D9NA 1CGWA 4O12A 1KRCC 2J7HA 4QFUA 2I5IA 1EC9A 4UOJA 4OKDA 5G4WA 1XIEA 1R8LA 4WJXA 4PB5A 3VDHA 1OF6A 4H41A 2CKSA 2VEGA 1EF2A 5C55A 3KM8A 1BEUA 4URIA 2E4TA 4CNSA 5G4EA 4Y9NA 1PL9A 1R9XA 2C3ZA 4GIRA 4PCSA 1TTQA 2FJKA 4M5PA 3IV3A 5KZDA 5E9XA 1FWGC 2HXUA 3WQ5A 2WVUA 4K36A 2H3DA 3MR6A 1ZUAX 3KL5A 3P14A 4LUIA 3SO7A 2VP8A 1G01A 5EBAA 3SI9A 2ZZ7A 3SY8A 1PBGA 1L8NA 1I0DA 1NTHA 5A6BA 2XM1A 3OZYA 3BJTA 1KTCA 3KDOA 1TTJA 1XRFA 2VVNA 4DO7A 1M7JA 2E6FA 4AZCA 1I1XA 4W8LA 1W5MA 1F3TA 1UPPA 1ZBCA 1DORA 2GQAA 2PA6A 4LB3A 1J01A 3GG7A 1SU5A 2V3GA 4IIGA 1BKSA 2CBUA 5DELA 2RDIA 3GHSA 3THDA 4BF7A 1PKYA 1B3VA 3KXQA 1RYSA 2J47A 3XINA 4Z1AA 4CD8A 1BRLA 4XAZA 2XGIA 2OX1A 4HD5A 2Z2AA 1DWGM 3S5SA 4MFEA 1WX0A 1Z6KA 3R12A 4DJEC 4E4FA 2CZFA 1VLIA 4CNPA 1ZETA 5F4XA 3TW7A 4YTUA 4H8UA 1MRAA 3W28A 3DFOA 4IIHA 1VFTA 5LA2A 4PSRA 2G3JA 3KBVA 2D0FA 3B06A 4AXKA 2VHLA 3UCQA 3HO8A 2OSWA 2NUXA 1GQLA 3QR0A 3ZQ9A 4UZUA 3RAXA 3W7LA 1IXPA 1KCLA 3LBMA 3V0UA 4DUVA 5LA0A 2VD8A 1O6IA 4NAEA 4CU6A 4CN1A 1FCQA 2HK1A 2UY4A 3MANA 4PMUA 3D0CA 2BY2A 1QI5A 1SGJA 5K9XA 1A0DA 3SJ3A 3B0UX 4IPNB 3A21A 3AMDA 2VZUA 4DLMA 4YP3A 4FNRA 1B9ZA 2KZHA 1N55A 2MNRA 3RR1A 2A7NA 1XW8A 1BYCA 4M24A 2GQ3A 2VOTA 3EWWA 2FZNA 4GBDA 2RDTA 4EEYA 1G4EA 1V6TA 5TBOA 3W86A 2ZUNA 1V77A 3G3MA 3P2VA 2YIHA 4IGMA 4Y8FA 1GORA 1ZJAA 1T0OA 2FJUB 2G3IA 2DVUA 3BLEA 4H6RA 2HJPA 2PDBA 1QNQA 3NEVA 4TV5A 3ZFHA 1I8JA 1PX3A 4O4WA 2F7FA 2IKIA 3M9YA 2GYIA 3UR2A 3VUSA 3T8LA 3EDDA 1WE5A 5DMNA 1F7BA 3NURA 3VIFA 5E70A 1O5KA 1Y5WA 4KIRA 4C7DA 1UA3A 3BGJA 1U5JA 3MHUA 2CIPA 3UPMA 1GZGA 1R7AA 3LTPA 4LRTA 5JUMA 1DWAM 2AMGA 1G4TA 4QIUA 4C91A 3GY1A 3W24A 1KRAC 2Z1VA 3F5LA 2ZUMA 5FF3A 2CBJA 4KRUA 2CWNA 2R8JA 1QDSA 2X30A 3TCEA 1TR1A 1E9LA 5M5DA 2OH2A 1UQZA 2W4XA 3CZLA 3QPEA 2XSXA 4PMDA 2JKEA 4IPPA 1EP2A 3CK5A 2O9PA 1P48A 2XC9A 3KWXA 5D2TA 2EPOA 3NUKA 1C3FA 4PCTA 3AU6A 2UVWA 4X63A 1BWLA 3ABXA 4JTAA 3VCNA 4QR6A 4PMYA 4JV0A 4A22A 3OOQA 1PKNA 3HQOA 4Y9PA 5IRPA 1E9YB 1VF8A 1TQXA 2VJXA 5IDZA 1SW7A 3OVPA 2BR0A 1AA1B 3EAUA 3F2CA 1RR2A 5D9MA 3C56A 3HB9A 2PMQA 3HGSA 1J18A 3WBXA 4X2PA 5LNWA 1UKQA 3VD5A 2I56A 1HKIA 4JIQA 1YXDA 4IXXA 3I6TA 1UZDA 5HWNA 4JGDA 3KE0A 3W6YA 4JY9A 4MTVA 3PG9A 2A3EA 3TQKA 5D02A 2NSXA 5A2AA 1U30A 3W87A 3GTFA 4HNUA 2X0HA 1T40A 4D1IA 4ZFMA 1XPYA 3RCYA 3RUBL 5CXPA 3WJWA 3EMZA 2QT3A 4QCFA 3ALGA 4IMGA 3SUUA 1QHPA 1GOKA 3ZJKA 4AU0A 2FGZA 4GUIA 3ITGA 1WDDA 5KG2A 2C2EA 2PI6A 1SO6A 3NL5A 1YX1A 3EOSA 3EZ4A 3F2DA 1FCUA 3TMQA 1RJPA 5EB8A 1DBTA 2ZRXA 1YHTA 3HV9A 3GIKA 3RBDA 3QR1A 4EPEC 1Q6OA 3AIVA 4MZ1A 1OJXA 3E5BA 1JJKA 5XIAA 1OB0A 3HFTA 2AL2B 3KDNA 3UPBA 3BJYA 2VC9A 2GK1B 3M0HA 1T3NA 1TJ2A 6A3HA 4MOZA 1UWSA 4GYKA 1KBIA 5BU6A 3TWAA 2CLLA 4LSBA 4NUWA 2NUYA 3AHVA 2JEQA 1W1B1 3PTKA 2PDNA 3VINA 2PDKA 3MV01 1WUEA 1W2VA 2ZCGA 2YL8A 5JBFA 3C8FA 3LOTA 2J6VA 4L4PA 1L6YA 2R1PA 2V2CA 3M16A 4XD3A 1AJ2A 3QC3A 4CQDA 4FP1A 2ACRA 2E0PA 1UMYA 2H8ZA 4LBUA 4G9PA 2W9CB 1JYNA 4RDVA 3TNBA 3W2UA 4O3QA 1XLBA 4KFNA 3IVTA 3VKBA 4ZE4A 1GVYA 2ZZ6A 1ZALA 2Y63A 2ZA3A 1BKHA 4Y9OA 3S5YA 3SN4A 3KHLA 4A8IA 1QU4A 3CUHA 4UR9A 4DBSA 3GU2A 3THQA 1SR9A 2JFEX 4C5YA 3MP4A 4CU7A 3T5LA 4LJ3A 4M56A 5F4SA 4YS1A 1V6VA 3ES8A 3EPIA 1LWHA 4FNSA 1OK6A 2E1DA 3AQUA 3MZ2A 1TV7A 4UFHA 3QLLA 1L6WA 3RDKA 3APTA 1A49A 3E5PA 3FK4A 3GXNA 3SFKA 2E09A 2OLAA 3FAXA 1FH7A 4Q8UA 4OFCA 4ZSTA 4ZSUA 4ECXA 3ITVA 3PZIA 3ELFA 2ZZ3A 3VDCA 4HYRA 1OIFA 1T99A 3QW4B 4IP5A 2YCEA 2PWEA 1ODZA 3F03K 3UEQA 3SIZA 2I17A 3BCFA 1O66A 4YR2A 2V5DA 3M0ZA 4Y9AA 3IAPA 2V4RA 4W87A 4DJED 1UC5A 3V36A 1ZZMA 3NPUA 3TTQA 5A8QA 1RQEA 1XLGA 3W73A 1BF2A 4P2VA 4QE5A 3WELA 4YLWA 2VR2A 1XH0A 4JTRA 4GNJA 2YKKA 1FFQA 1HIZA 3LPPA 4E4UA 4ICCX 3B9DA 3DC8A 1ITCA 2C16A 1AJ0A 1P6WA 1JX4A 4FMVA 2DP3A 2VZVA 4S2CA 4CNTA 3QV9A 4N0RA 3C52A 3LCWA 3H7VA 3URAA 3L0GA 4MPKA 4B5VA 1IHIA 4ML4A 4R33A 1GYMA 1XIBA 4OU1A 3B03A 5KEZA 3W1PA 4JYDA 1ITXA 4NAFA 1SO3A 1PV8A 1OYAA 5HBFA 4HJFA 3BQ6A 2E7FA 4FOUA 3UA4A 2CPUA 3LK6A 3CUIA 4W85A 4XBSA 4ZB0A 2KX9A 3L5MA 2BOGX 1D8CA 1E0TA 3SCOA 2HV5A 4IMAA 1HP4A 1E40A 3P6LA 2OR2A 4O28A 1LTDA 1DHKA 1DV7A 5DN1A 2YGYA 3PBMA 3CZ8A 1QPOA 4J9OA 4UTTA 4IRDA 2H9AB 2V38A 4C1KA 4JZ5A 2R8KA 4WKAA 4Q4SA 2NXIA 2UBPC 3FV9A 3CPRA 4AWEA 4H2HA 1HJUA 3FX4A 3BLFA 3ZJ6A 2QCNA 4AEFA 3LLFA 4ACZA 5DQHA 3AI0A 1BXBA 3QF0A 1XSJA 4Z2HA 1TTIA 4CN6A 3T0DA 4IR1A 2Z1XA 4O19A 5A6TC 5KFJA 1GQKA 3IVUA 4AVNA 4DEZA 4IGNA 5TD4A 2WKJA 4J9SA 4O54A 3T0BA 1L6SA 1RJRA 3C4UA 2V30A 1YDNA 4QJ3B 3EB4A 3AIQA 1BGAA 3E0WA 2OB3A 2WBGA 3GXFA 4GNKB 4X60A 4UFKA 2O55A 1MNZA 4GBUA 1TR9A 3WLLA 1H1YA 3SUTA 1L6GA 1LBLA 1Q45A 3RK8A 2B7QA 2HTMA 4PZVA 2PLJA 3T0CA 1VFUA 3KVMA 3IJQA 1TMLA 3NO3A 1LUCB 1UPMB 3IGXA 3WEOA 5I77A 1GOOA 2OTDA 3GUGA 2BY3A 1OX4B 1NOFA 3G6YA 1NM9A 4L9XA 5DFAA 4GWEA 2J66A 2XYLA 2UV8G 3CYVA 3RO6A 3PPCA 3GX9A 1OGBA 1LP6A 3STEA 3E2RA 1XLDA 1GYLA 1KGXA 1FKWA 1PZ2A 3OJGA 1VZWA 2XVKA 3EA1A 1SMDA 2XZ7A 3CO4A 4XUYA 2XIMA 4GUHA 4S3BA 4F4WA 4XO7A 3CT7A 5EBUA 1WKFA 3DHDA 3TYDA 3E0IA 4YHGA 4Q8EA 2DSUA 1E6PA 4ZVJA 2ZUUA 1S2WA 1JAKA 1A5MC 3GG1A 3S2CA 3QY7A 4NXSA 3W29A 2QAFA 4J28A 1G0CA 3KEHA 3S0CA 3LB0A 1NH6A 2J6TA 4IT1A 2QUVA 5KMYA 2RGLA 3MHFA 4PBFA 1M7OA 2FLLA 1P4CA 2E77A 3KWSA 4JN6A 3C0QA 4JTQA 4MKNA 2VMFA 5ECUA 4HNTA 2AMXA 2A79A 3F4WA 4C6BA 3O9NA 3SB0A 3F4DA 4F4XA 5GPRA 2YPIA 2EG6A 3K4DA 3MUIA 3RLUA 2XWDA 3IK4A 1XJBA 2E5BA 1B3WA 3E38A 1UJQA 2V5JA 3NZPA 2WSPA 3DHPA 2OFJA 1VH7A 1Z7AA 3R13A 2PRHA 5HR6A 4PBEA 5JIPA 5AHFA 4AD2A 2OWCA 3HJZA 4EF8A 1UG6A 1FX6A 2HEJA 3HBLA 3C0JA 3LLDA 4KFOA 3G1HA 1MRQA 5KFRA 1VBRA 2B7OA 1XR2A 1OZQA 3G1YA 1CXLA 4QG6A 4A3UA 4IG2B 3LHVA 2JF6A 2JGYA 4LUTA 5HXMA 1MO0A 3B0YA 2J4GA 4HK7A 4ILSA 4C1NA 2VA2A 5KT7A 3AS3A 1JCJA 2W91A 3R0KA 3OQ8A 1RQHA 4G8TA 3U3HA 1LYXA 1XLEA 2OMAA 3HPAA 1LQ2A 4XSLA 3U4AA 4LB4A 1FWRA 3LYEA 3MTWA 4HA1A 4J4KA 4LVDA 1XCFA 1Q85A 3UA3A 3UCCA 4XD6A 4A8LA 4F79A 4FOJA 3C61A 4OZOA 1JZ5A 4Z1BA 2D1ZA 3VKDA 3WMCA 1K6WA 1KV8A 1TJ0A 1G69A 3AYTA 3NZ1A 1JIBA 1X97A 3CV2A 5I7GA 4P5UA 2Y70A 1P43A 3AUJA 1V8EA 3QH2A 1OY0A 1WZAA 4C6CA 1XCXA 2O7SA 3FA4A 1X38A 3DFSA 4EE9A 2EAWA 2PDXA 1LQAA 3T44A 1HJXA 2DZBA 2XGBA 3ABQA 3MUAA 2EXOA 3Q58A 3ARZA 4YNGA 2INFA 5AYBA 1ZJHA 2WHKA 1TWIA 4ADSA 3VU2A 2WXDM 3FDKA 1UUQA 4GG9A 4O1AA 2YDRA 2VGBA 4HYVA 1E0UA 1TE6A 3E6EA 2P88A 3NQ6A 5CC5A 1ZNNA 3TZFA 4EP8C 3V0SA 5LNVA 4M8UA 2QCFA 3LZ5A 3GVQA 3WH9A 3PAOA 3FYPA 2Y7DA 5ABHA 3LQLA 2A6LA 3LPGA 3MYPA 3HGRA 3VNYA 3QGAC 1KTBA 2C1GA 3KBJA 4LAUA 2XIIA 2XH7A 1UD4A 3R4IA 1GK8A 3WQ8A 4ED1A 2OZ0A 2WV8A 2HE5A 2VZSA 4J9QA 2REQB 3BXWA 1XD1A 2A3BA 3RJXA 5BCAA 3L0KA 1OFQA 4LNCA 4ZR8A 1XIDA 3RAOA 2C18A 4GC3A 5GNYA 3VFLA 3LCFA 3BGAA 2ACUA 3RFAA 2V68A 3APGA 3DFNA 3ZVIA 3H4BA 1NELA 1S0MA 2PURA 2Y0FA 1REQB 1VHNA 2GDQA 4LV4A 4C5ZA 4D6HA 4GZJA 1LRNA 4BR1A 1CLKA 3PUGA 1EFZA 2OOGA 3IJLA 3OODA 1JD7A 3OU8A 3OIHA 4Z2GA 1GJWA 1W1YA 2NT0A 3A4AA 2QXWA 4FALA 3V16A 3G1XA 1MUCA 3O0FA 3W7OA 4IGSA 3UWQA 4EIVA 1RCQA 1OQFA 2PDJA 2WMKA 5BU9A 1V03A 3EPNA 4WQ6A 2EG8A 1XGZA 3O3RA 3WJXA 1XIFA 3HM7A 4NNAA 2OLSA 3BOLA 3IUDA 5KFBA 2AGPA 1IWPA 1M1BA 3QGVA 2ZXAA 4RUBA 1RUSA 3C8NA 4BWLC 2XFWA 1X1ZA 3UR7A 2W3ZA 3GIMA 5HNUA 2CLHA 4LGXA 1W31A 3N04A 2BY1A 2OU4A 2V2HA 2QUTA 1RXOB 2WMJA 3S46A 3LRLA 3NQBA 3WX7A 1YNQA 2WSQA 3W7QA 3P60A 1T6MA 2DSWA 3GD6A 3OGVA 3UU0A 1QHOA 3OLIA 1EGZA 4M7TA 3BQ2A 2NV2A 4O53A 1G4PA 3BLIA 2OT0A 2ABAA 3GSMA 4PUJA 4XBJA 4GKLA 3B0XA 4GI9A 3T5KA 3UYIA 1BD0A 4PGLA 5LGZA 3MJYA 1L9WA 2V8ZA 3A5VA 2D69A 1Y7VA 1C8YA 1W9UA 4XIAA 1DJYA 1QI0A 1UJPA 4U4MA 4L5ZA 4PBGA 2GVJA 1OYBA 2XU2A 1WBJA 3P3BA 1KBLA 5T26A 3SR7A 2WMIB 4FO4A 3SY5A 3B8SA 3PS7A 4ECWA 2RDXA 4M51A 4QWEA 3ZXWA 4CUCA 4GVGA 5KFFA 3ANUA 3DCPA 2WJZA 4US5A 3W88A 3KBMA 2VT0A 5CPQA 4BQ3A 4H7VA 5IHRA 3WEMA 3P81A 4KGJA 4AXNA 4AW7A 4K68A 2WNWA 2ZUWA 1CLVA 1H7OA 4OECA 4X61A 4L1WA 4LBSA 5EMYA 4A35A 4RZ5A 4AF0A 1IXOA 1P6BA 4X9SA 4I9JA 3GNXA 2DZUA 3GK0A 4OOZA 5DG7A 2NQJA 2I5GA 2JEFA 1UBPC 2X41A 4E2VA 1E9ZB 3H2OA 5KFVA 1F9CA 3MWCA 1JYWA 2XGZA 3WQEA 4TVCA 3GH7A 3CQKA 2YW3A 3L66A 3AJXA 3C6CA 2TYSA 5A69A 2VENA 5AHMA 5DEZA 3DI0A 3WUFA 1EIBA 1XLLA 3ZOAA 1BG4A 1WO2A 4LC6A 3SUWA 3AIRA 3QZEA 4MB4A 1GJUA 2GUBA 3WBYA 1AQMA 1H3GA 4AZBA 4B5TA 3RO8A 1CLXA 4NVTA 3FJ4A 2CNCA 4V1XA 4IRCA 4F8XA 5KFXA 8A3HA 3KTXA 4HMDA 2Q09A 4ZO8A 3CPGA 4HNVA 1ZJBA 2XM2A 5FF2A 4MYXA 4GE8A 5A2CA 1RP8A 2EJ1A 2ZZ1A 4RU9A 2OQHA 4KH2A 4DL5A 1LLOA 1UP2A 1AUSL 2FMNA 1VB9A 4ED6A 1G7UA 1K77A 4HN8A 1BFNA 4G7EB 3AHZA 2VELA 1H7RA 3GQYA 1F8MA 2ZWZA 2QLYA 1N82A 2I9UA 3DG6A 4GO9A 1JF5A 2GWGA 2XH4A 3GNRA 2B31A 2WSRA 4LUYA 1I6NA 1KBJA 4IPJA 3N9SA 5T8GA 1P0NA 1O4UA 5LIKX 2PLCA 1XCWA 3ORWA 3QXBA 1W6TA 3CLMA 2VZOA 5KT4A 1N2VA 3IS4A 4IFOA 3MKKA 2PDQA 2XPKA 3O07A 3RILA 4QLKA 4D6GA 1NARA 4D6CA 4ZXOA 5KFOA 1MW3A 3ITYA 4Q4RA 4FX6M 2NLIA 2PFHA 1KLZA 1WKDA 2WCAA 4UTUA 3FA3A 1D3HA 1E43A 3GU1A 3SCSA 5AHNA 5A5WA 2FHCA 5REQB 4XKYA 4AVFA 1VIZA 5L1KA 1VFMA 3AIEA 3VE7A 4HNCA 3ZSSA 3DHUA 1RBOB 1VBGA 3KP0A 5C0QA 4D6IA 5CJMA 1HUVA 4CVWA 1EIXA 1KTNA 1VCGA 4HPNA 5CCZA 1OC6A 1VFOA 1BXNA 4Y8EA 3S42A 5HMEA 4H9YA 3I65A 1S2UA 1F6YA 3M0VA 2Q6ZA 3IUIA 2G96A 1X6NA 5I07A 3EDKA 4F2UA 3M43A 4EWND 4OHQA 4IX0A 4WDUA 4W4QA 2VUYA 5FSEC 1Q7MA 2JKAA 2Y4SA 3RLHA 4HPXA 2YB4A 3WD4A 3E96A 2XIBA 1RP9A 2YXGA 2AKMA 4IP7A 5KFCA 1GEQA 3ZVHB 4KQNA 3URQA 4P7QA 5FIPA 3KCOA 1XF0A 5L1JA 3TK7A 2XVGA 4W88A 1YTDA 1OFOA 2GGEA 5A8OA 2GUUA 5I3JA 4GKTA 1JZ7A 4IJRA 1GPWA 1C92A 2VURA 4S3GA 3SQSA 3N25A 1J5SA 5BZAA 1XSKA 3H7RA 1XYCA 3C3NA 1W9XA 1YQ2A 3NNTA 3EDJA 1SJCA 4POCA 4RW5A 2D73A 3VMOA 1GNXA 3H26A 4Q43A 3AOFA 2GPTA 1WBHA 1KKRA 4O15A 2BXYA 3MVTA 1TPC1 1E15A 3EX3A 4Z2IA 5DX7A 1ISXA 3W7IA 4NY2A 2ASJA 4O1FA 3T09A 4S3KA 4HA4A 4FX7A 3KTCA 5DY2A 1H61A 3B9AA 3VKCA 2Z1SA 5BMWA 4IZGA 2R1MA 4YR3A 1RHCA 1XIJA 2QV5A 1C8VA 1TB3A 4ZO9A 5C7VA 3E49A 3WJZA 3IARA 1QT1A 4FNPA 1BVZA 3VYLA 3DFQA 1R30A 3ONBA 3M1ZA 2ZA2A 4YJ5A 2YXOA 3C2OA 2CITA 1VEPA 4H83A 3WKZA 1UQYA 2FPVA 2DIKA 1O94A 2J74A 3L9CA 4BJHA 3VNMA 3N18A 2VC5A 1GPFA 4REQA 3W1TA 2ICSA 3BCDA 1MFVA 4LTSA 3MC5A 3A4JA 3WLPA 5EWFA 4RZ4A 3MFIA 1EUNA 1FP8A 3VKJA 3CB8A 4EBCA 2J7DA 3ARYA 2ZVRA 4IMEA 3FJNA 3QOMA 2G5WA 1V08A 1NOWA 3F5JA 2RDJA 3LSBA 3GR7A 1NQKA 2PWUA 3W76A 4B3ZA 3MT1A 5M3WA 3LBOA 1VPYA 2DH2A 1L8PA 2X1IA 1Q65A 4LX4A 2CETA 1OCQA 1TWWA 3IIXA 4NZCA 2H6RA 4PC8A 1PPIA 3W7RA 1V6XA 3G1DA 1H1NA 1GG0A 4JTUA 4YXGA 1ZSXA 1R3SA 1KFCA 2FKPA 3GV5B 4L9ZA 1M3UA 4MNLA 4U2ZA 3IAQA 3M6YA 7PTDA 3HU7A 1DJHA 1GZJA 3L7RA 4DJDA 1J11A 1XKJA 3ABOA 1RPXA 1F3EA 2GLKA 1QPKA 4HMNA 2YB1A 4Q32A 3B8DA 3N1AA 2FH8A 5FA5A 5KFSA 3K8MA 3ZLGA 5LNSA 5E5CA 2ZX6A 5KT6A 2GJRA 2YBTA 4GPNA 2AL1A 1ZP4A 4B3KA 2QCEA 2EO7A 3H7UA 3FYYA 5BOOA 1K03A 5K4ZA 1T96A 4OTKA 2B0MA 4QG8A 3E2QA 2WMHA 5BWFA 2F6XA 3H70A 4KS0A 2XDFA 3N2XA 5A8MA 1OGGA 4LRSA 3U2CA 5K9DA 1A5CA 1IYXA 5F1UA 1RCOB 1QNOA 4NNBA 3QQWA 2X1RA 4XZIA 3RCNA 2BGQA 4H6EA 4WEVX 3CZEA 5IHSA 3UVAA 3FXGA 4G1KA 1R3WA 3L4TA 1M6JA 2FGBA 2PZNA 2OZ3A 4NRSA 3R79A 1KXVA 4W7VA 3A22A 1HT6A 4JTHA 1JDCA 4GZ7A 1LROA 6TAAA 5I00A 1JFXA 1QOPA 1SPQA 3BCJA 3UXLA 3WO8A 1OX5A 3VC5A 3SFWA 3WBAA 1KM3A 2YCIX 1NU5A 3FGCB 3MKCA 4HYWA 3TYAA 4A6GA 3OSNA 3GB6A 5CPLA 3BZGA 2PDLA 3LLXA 2CLOA 4JIEA 1BVWA 3EYPA 3QTPA 3L4YA 3V0TA 3WF1A 3UJRA 5E0KA 4N4QA 3W7JA 5C6MA 3C2YA 5KFNA 2YA1A 2GVEA 1LRTA 2WZMA 3COTA 9RUBA 4UNIA 1PS9A 3NQ8A 4KCTA 3MYOA 3WUEA 3EWUA 4XUGA 1MW0A 1HQTA 3IJDA 1B3XA 1EP3A 2ZXBA 2FLIA 1UIOA 4AWTA 1R2TA 3KRSA 4U7CA 4TMCA 3UWUA 2Q3OA 4LS0A 2WC7A 2E67A 2CBVA 1HL8A 1JR1A 1F61A 4V27A 4NI8A 1NFGA 1IIGA 2QVNA 2IMWP 3TYUA 5EFFA 5KFUA 4PMVA 2VKZG 4HP5A 5T91A 2VXNA 3S2JA 3HMCA 3WNMA 2QDHA 2QCDB 1FDZA 4MNJA 3H4XA 3CEUA 3SCQA 1GVFA 2HNEA 5KITA 3T2OA 3BQ1A 2W9BB 2FHBA 3HOJA 3P80A 1NP0A 1DJNA 4CCDA 4YVPA 1EO5A 3TN5A 3U0HA 4ZOBA 3T05A 1A80A 2ZQ0A 2QGHA 3LBCA 4N9EA 3FJ6A 2Q02A 1B90A 1HO4A 4M82A 4FEZA 4YYCA 4HSOA 2QPSA 4Q33A 2JBMA 3MR2A 3CV6A 4GQRA 1OGSA 1MW2A 1ZU8A 1HGWA 4IMFA 3RGTA 4HN4A 1JQXA 2POZA 3S6TA 1RAKA 5A8GA 3RMJA 2PTDA 2J62A 3AIWA 3GTNA 2DVTA 4GQQA 2IQ0A 2V5KA 1J10A 3RB4A 5CAHA 3G24A 2QCCA 2ZRUA 1ME9A 3ITTA 3OG2A 2CZVA 2LLEA 5FKYA 2XFFA 4AD5A 4QW9A 2NT1A 1XYZA 3CMGA 1CECA 1VLWA 3WY1A 5G1MA 3B4YA 3W1MA 5I3DA 4P7LA 4LANA 2VI0A 1K1QA 2ASHA 1M01A 3TJXA 6ALDA 4O3RA 1Q6RA 4D6JA 3F4NA 3P84A 4LQ1A 3K4WA 1W1A1 1VIWA 1IV8A 1OC5A 4JBRA 4GY1A 3DKLA 3PVFA 2VRQA 3OLGA 4OIFA 3E1F1 2IKGA 5CPOA 2C0HA 2NWSA 2BWGA 1ONRA 3LCGA 1VJSA 3RX3A 1QW7A 3MSYA 1CGXA 3KHDA 2C14A 4Q22A 2PCQA 5KFPA 2OSYA 4FBTA 3SIMA 2XIOA 3W27A 3T8QA 1K7XA 5CH9A 1UWIA 1J2BA 3TA9A 2VC6A 1CB2A 1RJQA 3QLDA 4NX0A 2Z27A 5D37A 4HU8A 3UXAA 1IEQA 3VNJA 4M0XA 2HQAA 1S46A 1WDSA 3IJIA 5CSRA 2OVLA 5XIMA 1V79A 1LT7A 1FWJC 4RCXA 1JVNA 1YEYA 2OEJA 2OEMA 3B8TA 3TONA 2WKLA 4P8XA 5KFKA 1RZMA 3OLDA 4DL6A 3I7RA 4GC7A 1QWGA 3S1XA 3QRHA 3GTXA 2Z00A 4GCAA 4ZODA 1E72M 4B15A 3G3DA 4BQ5A 1FRBA 2QEZA 5REQA 3W2MA 2R8HA 2VQTA 1LLZA 2A3LA 3CHCA 2GWNA 5ECVA 3TAOA 3ID7A 3AHXA 4LEQA 4HMEA 3PANA 2NV9A 2C22A 4ATWA 2UY2A 5MKGA 5T9BG 1IT8A 1HJVA 5D9PA 2UZ9A 5CGMA 1WV2A 2ZX8A 5AC6A 5H8PA 1GOIA 3EWXA 4HOWA 3BAXA 2BVYA 2PTYA 2D2JA 2G8ZA 4RE4A 1K8CA 2TSYA 2A0NA 3UPWA 2WVVB 1QI4A 3S6DA 2WKGA 4O10A 4AIUA 3QGKC 2EPHA 5A1AA 3ZVHA 3RBEA 3LA4A 2B7NA 3BG3A 3RX2A 3WK2A 4R8UA 3MY9A 6ENLA 2FZBA 1I2NA 2W63A 2J25A 4I7VA 4QX4A 3IPWA 2IQTA 4Q8QA 3FHAA 4RZRA 4PA8A 1W1PA 2X8RA 4DUWA 4QNEA 1TREA 5KETA 4OVXA 7TAAA 3W7HA 4ZXLA 3WDHA 4AD0A 4C6LA 2L5HA 2INZA 4HCHA 2IPWA 4HT3A 3DKJA 1JPIA 2GGIA 3EWCA 2P53A 5JXQA 2BGNE 4KCWA 4R53A 5KSWA 3SDOA 4ED7A 3SCPA 1UD6A 3TFCA 2YL6A 3S5OA 1SSGA 2VD9A 3W70A 3PZVA 3A3XA 3WQGA 1UW9A 3PFRA 3VUPA 3GH5A 2CLIA 1J0YA 2PDPA 2G37A 3NIYA 3PFMA 4L56A 4QLJA 3KLLA 3ZM8A 2E8ZA 5J5RA 1SFTA 4O0QA 3W6MA 3GQCA 3F2BA 4HIBA 2H8XA 3TIMA 1QMLA 3QMRA 1A47A 2O7QA 1V3LA 4LT9A 1W3LA 1LL7A 3ZIZA 1WDQA 4K38A 1X8CA 4OBSA 1TV2A 2WCGA 1J93A 1ZBVA 4V33A 5A3HA 5BXSA 4OQVA 2ZC1A 4B91A 5A95A 4H9VA 1JDEA 1N56A 2AQWA 1NDZA 4BEUA 4EWJA 2QCHA 2V3EA 1RSCA 2DT0A 4MMWA 3P93A 4MJMA 4J2PA 1CCWB 4RNJA 2QQ6A 3V5FA 1K9DA 5CBBA 2VDGA 1EHAA 1EHNA 5G1TA 1CWYA 1GUVA 3N14A 2AQ4A 3W2JA 3UJ2A 4IF2A 3AXHA 3QJAA 4PCFA 4FK9A 3REQA 2UY5A 4Q6XA 3ZLHA 2QDDA 1ZBWA 3U7BA 3CL6A 2P0IA 1FWIC 3G0UA 2NQLA 5BOFA 3WLTA 2Z0IA 1EDQA 1FHUA 2QV4A 3M5YA 4CGTA 3OTRA 4ZMGA 2RDWA 3C2VA 7ENLA 3PK7A 5HAOA 1UIPA 4AY8A 3KVKA 3BAJA 1QFEA 3BSGA 3CO8A 4F4ZA 4A2RA 4ZCWA 1SO5A 3T08A 1FHLA 2QIWA 3WLSA 3SJNA 1UROA 4NZ1A 3MCOA 2YSWA 2W66A 1R9YA 3R5EA 5AYXA 1QPRA 3LSCA 3BLKA 3RXZA 2G95A 3KS6A 5FD0A 1F3WA 4ED0A 4L6OA 1PDYA 3AYSA 4ECZA 2OPJA 3PZTA 4H04A 1GHRA 4H9XA 2QIIA 3CHDA 4US6A 3M41A 1E6SM 2DDXA 4UBPC 1XXXA 1W1IE 2XUCA 1UR2A 2R82A 3N2TA 4GI6A 4JTFA 3L4ZA 5AVHA 3SCTA 3FXYA 4H8HA 1A5NC 4Q8WA 3W0KA 1HVQA 3H2EA 4AAJA 3LGGA 4PB3A 1V3JA 3ECQA 1US0A 3GE7A 4L6HA 4Z1DA 1BHGA 1PX8A 4B2DD 4PCNA 2V9WA 2XN2A 3FSUA 1MXSA 3DECA 1JPMA 4PMJA 1WZKA 5A2BA 3LHTA 3WK1A 1ZS2A 4LUSA 3VOHA 2P3ZA 1E3XA 4MVAA 4ECUA 1E4LA 3A9BA 1RY8A 2CXEA 2BQRA 1YXCA 3QZAA 2PTWA 3LTSA 2HROA 3RCMA 1N7KA 2G97A 4HK6A 4C7FA 4R27A 3LPOA 2DV0A 1F8IA 4UOZA 3BLOA 1V3IA 1LL4A 3BPWA 1BYBA 3ARUA 2DIEA 5F4WA 1LL6A 4MJ4A 1H50A 4F4RA 1ESWA 2FTWA 5BMXA 4JCLA 1AL8A 4O17A 3B40A 5LYRA 3QZ8A 3UNDA 4CQAA 1HTIA 3VXGA 4AISA 1TVPA 4YWIA 4KETA 3LY0A 5D2YA 4IUGA 3PTDA 5I3KA 4DPQA 5EPDA 3FNDA 3PR2A 4MIMA 3ZT6A 4GYPA 3WL1A 3QFEA 5K4XA 1TJRA 2VGGA 3P67A 3ABSA 3B9NA 3EKZA 1A5BA 2PDMA 4JTSA 4N6FA 1O1HA 3MI2A 4QWDA 1TA3A 2P76A 4L1GA 3H6OA 4ZO7A 4U5KA 2YFNA 4FS2A 1DWIM 3VVGA 2J27A 4UTJA 2YXXA 3M44A 4XBKA 1XRVA 3RF9A 4IIDA 3TSBA 1AW2A 3I7QA 3GC4A 3LHZA 1OFDA 4XISA 4AZCB 4AB4A 1TMQA 8XIMA 1TELA 1WAWA 3BAYA 2AGKA 3THUA 1WNOA 2VOMA 4HOXA 3O6CA 3UQNA 3OPSA 2PU0A 3GDTA 2QJHA 2OYKA 1S3TC 3BAKA 3MA8A 3UXDA 3GAKA 1EX1A 3CZGA 3TEVA 3W6LA 1GTEA 5KINA 4Y90A 3DX5A 1BRLB 3OEXA 2IW0A 3OHMB 1YDVA 5J5DA 3VGFA 1FWSA 2J7GA 4FR1A 3ME3A 4RZBA 4JEJA 3MDWA 3DU0A 2DT1A 5JH2A 3USZA 1XLKA 5BYWA 1UWQA 2FB2A 4RW3A 4C7GA 4O8RA 4YVXA 2BVTA 1WB0A 1TX0A 2Y5SA 3QQ1A 5IOBA 1LWIA 3K1DA 1X8FA 2GUYA 2Z2BA 3M0LA 3GKFA 3WNLA 1B1YA 4IM4A 4KRTA 1JXLA 1XX1A 4LW7A 3V5OA 3RB6A 2VDHA 3S9IA 2VEMA 1E56A 4QE4A 1PHWA 3L5AA 4NAEB 2E9MA 4RJEA 3CU2A 4HPHA 1FCBA 4PEEA 1AD4A 4FF5A 2VDIA 1OEPA 1TVLA 1JZ4A 1F05A 3II1A 2GSEA 1K1SA 4ROQA 2VEPA 1H63A 4HB7A 1SQ7A 1WYIA 1NWUA 1SJDA 3CUXA 2CLMA 3BSMA 3SQMA 1XLIA 1ICSA 3AU2A 1E1FA 4V2XA 2F9RA 1JPKA 3T55A 3TJ4A 1J0HA 4XKMA 4L1XA 3CQHA 1JXJA 2QUMA 1G1YA 5HULA 2J9ZA 2DIJA 1BSIA 4H2CA 4GX8A 4O1BA 3VDBA 1FWCC 2CBIA 1Z8AA 3ITCA 3RR4A 2BSLA 3RRXA 1N48A 3TTEA 3QM3A 4CEXC 3T5JA 5CEWA 3WQ6A 5IXEA 4WDTA 1C8QA 5GJMA 4AZHA 3CPUA 4G2DA 1C90A 4KWWA 3LXCA 4HU0A 3R7MA 5CJ5A 1M41A 2Q8LA 3EXRA 2X16A 4R3UA 4ED3A 4C6NA 3W9ZA 3CQ0A 4JS3A 2Z1WA 4IUOA 1XKYA 3FIGA 3UZ5A 4RE2A 3BW2A 2CHNA 5XINA 4D8ZA 1I2OA 2Y5EA 5JBDA 2XZ9A 3GILA 2DJLA 4TO8A 1TUXA 4MNKA 3LMYA 1J6PA 1QK0A 1HF6A 4JX5A 5FF7A 1D7KA 3R58A 4MUPA 3TH6A 4B5SA 5LHFA 1K4GA 4KWSA 4AD4A 4DBDA 2DT3A 4I3GA 4XTIA 2AAMA 4PODA 1XYAA 1QATA 4AIOA 2ZC8A 3L21A 2Z2UA 1R46A 3MVIA 4C6MA 1DEDA 3NTYA 3RAQA 3WD1A 3W75A 2FB3A 4NYUA 3WMSA 2ACSA 3IK2A 4KEMA 3VNZA 4DL7A 3RG6A 5FJJA 3WDRA 1S5VA 4UTTC 2XWEA 1NOUA 5GQBA 4ADUA 3OZOA 2I7GA 1ISWA 1PKLA 5HR7A 1MZRA 1J0JA 5FJIA 3LTYA 5LXEA 4GNVA 3G1VA 2CHRA 4KPLA 1MVYA 3B05A 1SZEA 4DLFA 4FLSA 1OFAA 1W5OA 2WM0A 1K9FA 5FJOA 4GA8A 5HJYA 5HMFA 4I9MA 3TU9A 4RV8A 3K1GA 4JAWA 5DMMA 1XH1A 1Q6GA 4FXSA 3W83A 4QM1A 1JCYA 3STGA 5F9NA 3EWBX 4GFSA 4PFHA 3C86A 1M7XA 2P3EA 4IQEA 4R5EA 3V6KA 4J7RA 3UZZA 1MYRA 3WH8A 2X2GA 1VBJA 4Q8MA 2F6UA 1EC8A 2PE4A 4LY8A 4FA3A 1XSIA 2PC8A 2GDVA 4J3WA 3NFUA 1DTNA 4PMXA 1RA0A 1PX4A 3UWEA 3S8HA 2PWGA 2X7VA 4MLJA 3G1AA 5KT3A 2PBOA 1ZHAA 5ABGA 3H2MA 3W25A 3CL8A 3TR2A 1OM0A 4IQJA 4O1CA 4NI3A 2V3FA 1VRXA 5DQPA 3UZXA 5I2UA 1QTWA 3WQFA 2FLPA 3N2OA 2DY3A 2VRJA 4CNOA 3OA5A 1X6UA 4CLMA 4BA0A 5AOUA 1EL3A 2HISA 5H1WA 3VD7A 1TJ1A 3LERA 2PRLA 2DZVA 3L5LA 1YNYA 2J24A 3VX1A 1B31A 2ZBTA 3H2AA 1NF7A 2YCLA 2OXNA 2IA6A 3ALFA 3FKRA 1VCFA 5KTLA 1FWNA 1QI2A 1DWHM 1H7WA 4ECRA 3GIJA 3F1QA 3LX9A 2V82A 1OADA 4R9OA 4OUIA 2EKCA 5T14A 1HJQA 3GV7B 3UZWA 3GIPA 1PTDA 2UWFA 2PC4A 2BB0A 1JNDA 4QRNA 4AD1A 4LYKA 4PTVA 1TMHA 5HNTA 1DQWA 4HCLA 4M7SA 1ZCOA 6REQA 2XIJA 3WQPA 1E6ZA 2Y62A 4H01A 4L9YA 1MQRA 4P7RA 1TPB1 1VFLA 4WKFA 4NLGA 2ZOXA 2VR5A 1TV5A 4F9JA 3MBDA 2QJIA 4GJ1A 1OBAA 4ADTA 2J77A 4XIMA 5KFIA 4WVXA 5M2FX 4UWMA 1DTUA 3W7KA 1UC4A 8TIMA 1E1CA 3BMVA 2W7OA 3WUBA 4TX8A 1EX5A 1GOMA 1ALDA 1RBAA 2BS9A 1HX0A 4GISA 4WOZA 2A7RA 1GKPA 4YYFA 4D71A 4C6QA 4XZMX 1E6RA 3EWZA 4IWWA 2J7FA 1Z9AA 3ZR6A 2BVWA 4GINA 1UOZA 1VRDA 4GK8A 3F5KA 5HK4A 4O8AA 4JEQA 4UFJA 3P0XA 2HZGA 5A8NA 4X0VA 1VBUA 5LIYX 3O8AA 1YPFA 4MNMA 1ZLPA 3KHJA 1ZJIA 3JZEA 5CSUA 1NSJA 3WNKA 3AXIA 3W1XA 1EJUC 4DYJA 1C93A 1XGDA 5E9AA 3ISIX 3G22A 2Z24A 4TU1A 3RU8X 3M0MA 4DF1A 1BAGA 3OZMA 4Q8VA 4KMQA 2J7EA 4NAFB 2VEFA 2BDQA 4DO6A 3VKAA 4R85A 5KFLA 3NGJA 4AMAA 1UD2A 5ABTA 4JICA 4JR5A 2J8FA 4NKCA 3O15A 5LIUX 4E0CA 5TAOA 5C5YA 3V3WA 2J6UA 3UWZA 1GTHA 2ZE0A 1LORA 4NX5A 1MUMA 4ECSA 1KBBA 4D6EA 3SRHA 1FH9A 3W01A 1Y8BA 5E6YA 3LV5A 3VGBA 4EVZA 5CSSA 2ALDA 2BZNA 2W61A 1D3GA 4JFVA 1W1TA 3ITLA 4QLLA 2HPMA 3WK0A 4F0SA 1UZ4A 1QCWA 3UR8A 3H2CA 4Z1YA 4ACZB 4MAVA 3EXSA 4HJWA 4MADA 3CWHA 3PUEA 3CWOX 3G18A 2VFGA 5FCZA 4N4PA 4KIEA 3RPDA 1BG9A 1V3HA 1HZYA 3BANA 1K4HA 4HHMA 5GJPA 2O9TA 1Q2RA 2A3CA 3CAQA 3A9IA 3GS6A 4C65A 3TVAA 2RAGA 1XYMA 3W7DA 4NJJA 1KXTA 5AECA 3W37A 4A3HA 1EYEA 4UZSA 3NOYA 1UASA 1A5AA 3GLCA 4QHRA 4ZL1A 2WSKA 3PBVA 3UFYA 2E9BA 1TPUA 2R94A 3MS8A 4FNTA 2E40A 1THFD 3EWYA 4KBXA 4NF7A 4ASTA 1ECEA 2IBKA 3MP5A 5DXYA 4I6VA 1V4YA 4FNQA 3BAWA 3LGEA 4B90A 3KHHA 4MDOA 4J9MA 2RGMA 4UQCA 2DZTA 4K7VA 3OW1A 5M03A 5AYZA 3SGZA 1LOQA 4QW8A 1YTEA 1PTAA 4MKVA 1OD8A 4ZENA 1QW9A 5DGBA 5CLWA 5AY7A 4OUEA 2WK2A 3SQLA 4UNKA 3A24A 4GFIA 1FFRA 3NJ3A 4J1OA 3UG8A 4HZ8A 3W00A 4IOTA 5EFDA 4TOQA 5KFGA 1K02A 1N8IA 3VCRA 5C5JA 2YA0A 1H1ZA 1UKOA 4FIRA 5FEZA 1DL3A 3NVDA 4B9ZA 3VILA 3FHQA 1EYWA 4JYEA 1CGYA 1AH3A 4BI5A 2V6AA 4JTDA 4O14A 4O3NA 3TAKA 1CPUA 1SO4A 1TCMA 4JN7A 4Q8NA 4MSSA 3RB3A 2VVSA 1ODUA 3MUZ1 5DG8A 4EPBC 1VQTA 3CH0A 4JX4A 1PTGA 4D2JA 4DX3A 3MU7A 1ISZA 1XS2A 3VOFA 4BFAA 4HHHA 1KB3A 2OKOA 3TYCA 4F0HA 4RUCA 2ISSA 1TPH1 3KRZA 3WNNA 3PBGA 3FVDA 3GFZA 1EA0A 4HVXA 1UZ1A 1ZRQA 2PGWA 2PAJA 2ISWA 1UZHA 3P0WA 3S9ZA 2ZA1A 4A3QA 4H6KA 4FNUA 3TW9A 1UD8A 1IEIA 2EF9A 5DANA 2V67A 2HS8A 1TE1A 2DPJA 4DYKA 1AL7A 1Z48A 4LUTB 4BKNA 3RM9A 3HG5A 4S3AA 4JV1A 1IR1A 4C1NB 3LEPA 1J0KA 1EDTA 3VIPA 3VOGA 1YPIA 1XH2A 2ZRWA 4TXEA 4E38A 2YYTA 3V6HA 2PWFA 3PF3A 1BVNP 1NWTA 2UVUA 2VRKA 3ZZ1A 4HPJA 1JCTA 3WF0A 1LF1A 4JKLA 5L9FA 3IACA 3NGFA 2AGQA 3M5VA 2GOKA 4CQCA 2ONEA 3OVGA 5F9LA 4U31A 5CPNA 4V28A 3UW6A 3NVTA 3NZRA 3A64A 2QPXA 2E6DA 2WQPA 5FACA 3GXTA 1GQNA 3M0YA 3PWIA 3GVWA 3ARRA 1GVEA 4S1FA 4C90A 3DN5A 3MB9A 3P7YA 1UR3M 5T9CE 1UR8A 3I6EA 1XLAA 4Y6GA 3EMCA 1ZP3A 3MMTA 2EQDA 1O5RA 1FDJA 4TR9A 1BSLA 4DY1A 2EKGA 2X09A 1K9EA 2IQDA 1R7OA 1Y5XA 2AU0A 4XD5A 1P0KA 1ZENA 2A6NA 4PUDA 2F2HA 4OV4A 4LU0A 1NFBA 3VK5A 1B30A 3I3BA 2XGPA 2ADAA 3NPWA 2OQYA 5G5IA 4K8HA 3ATZA 3E9AA 3E3HA 1V5XA 3N6HA 4WY0A 4CKQA 1Q63A 3K4AA 2P10A 1DJXA 1KW1A 2PGRA 5LXXA 3HJEA 4F48A 4QG9A 7CGTA 2QCMA 2PZ0A 1PZ1A 5AVNA 4K37A 3CHVA 4F9DA 1R38A 5KG6A 3PUOA 1PWLA 5CLTA 1QNVA 3ZSTA 3UETA 2BXVA 1CDGA 3GBDA 4QE1A 3R10A 5EKYA 1SZRA 2PWDA 3QPZA 4MWAA 1XLFA 4PTDA 1CGVA 4ZA0A 8XIAA 4JDYA 1LM1A 4HNOA 1W9DM 2JGQA 4UB9A 2E5CA 4ED8A 2QUNA 3VAVA 1W9BM 3FLUA 4LUJA 4Q8OA 3MKVA 2AKZA 5F2LA 3VNKA 3CMJA 3N4EA 3TC3A 1EZ2A 4MB3A 4ATLA 5EU9A 4PTNA 2XCAA 4GACA 3TR9A 5RUBA 4TTGA 4UTHA 4NJIA 3ICJA 2OQLA 3SRDA 3TLLA 4EOUA 1C9DA 5HPCA 1HKVA 1CI1A 4OBRA 1PYFA 1XQLA 1XV8A 3N73A 2NXGA 3E02A 3KCJA 3IRDA 1K8YA 1X7FA 3AROA 1Q6QA 4YL2A 2C79A 3S83A 5TIMA 3MZNA 2P9BA 2PD5A 1B5TA 3W7MA 1XBYA 4YCOA 4JQ2A 3GDLA 1R87A 3W2LA 4Q6JA 1HL2A 1YLVA 3RYSA 3KHGA 1XIHA 3JW7A 3VD9A 3E2VA 1S2AA 4IXHA 3QBUA 3GXIA 1Q7ZA 1B3ZA 3KL0A 1Y0EA 1QOXA 4JNZA 4PTWA 1QW8A 3RM8A 2GL5A 3T07A 5C9XA 4IQDA 5J04A 1S5WA 3DFTA 3G6MA 4ECVA 4CQ9A 3AS1A 2A4AA 3RRAA 2J79A 1W54A 3QV6A 1ONWA 3USBA 4QXIA 1PDZA 2NVAA 1J5TA 3FA5A 3QV7A 4K2SA 4FZIA 1D8WA 2FZMA 1V93A 3TE9A 5HUPA 1E51A 3HGJA 1DJZA 2W7PA 2VL4A 3R8RA 2VR4A 5AB3A 3M9MB 1XLCA 2NZLA 1EKOA 2Y2WA 3K46A 2WLZA 4JQ4A 4E2BA 3HPFA 2V4QA 1XLJA 1V6WA 2HE8A 2VEIA 1SYTA 1Z89A 3BJSA 4AF0B 1YW1A 3UZJA 1T7LA 4Q7NA 2E3ZA 3GV8B 2G3NA 2CLPA 3VZYA 1GEHA 3MUXA 1YBQB 4QTGA 2BNJA 5FF4A 1ICPA 1GWJA 2FZ9A 4TX6A 1KD0A 1W9VA 5DG9A 2VUNA 3IIZA 5DRCA 1Q66A 2FFCA 3WQ4A 1HKMA 4GUFA 1KCZA 4QAIA 3UNTA 2A3HA 4EXQA 5C9WA 4W5UA 3DC0A 2D2GA 2FVMA 4GGHA 5D8ZA 4GIEA 1I0BA 3OBEA 5KZEA 1SFSA 3ANVA 1Q6LA 1P0BA 4AHOA 5B80A 1W2PA 4EBDA 1JULA 4HA0A 3VE9A 1ISYA 3WD3A 1JZ6A 4JNMA 2G4FA 3GC5A 1NWSA 2CLEA 1KGWA 1X39A 5K9CA 4A05A 4WCJA 4MPQA 4AX7A 2FIQA 5DCDA 4KCVA 1P7TA 2QUUA 3ABZA 4GJIA 4US5D 3P5ZA 4X2RA 3W53A 3TN6A 2NQ9A 3DBPA 5D03A 3LUTA 2B81A 3U8GA 3M64A 3BUVA 5LIXX 2JIEA 3BOXA 2P0OA 3T7VA 1EPVA 4XX6A 3VDAA 3B8VA 2B4GA 3IJ6A 5BXPA 3EOLA 4D8AA 4BZYA 1XG4A 1PUDA 3W1UA 3Q37A 4J3SA 2HBXA 4PR4A 1LRQA 4DJDC 1WKEA 3V18A 4NZ5A 4RLIA 1XG3A 2Q8ZA 1X1NA 4EKJA 2BODX 3VIHA 1FXQA 3R6IA 1SSDA 3G6XA 3UCDA 3BLDA 1PKMA 4L7ZA 3T81A 5E09A 3SCVA 2WHJA 4EYIB 4LF2A 4XD4A 1O1ZA 3PC0A 4DWSA 1KM4A 5C71A 1UWTA 3FJLA 3HG2A 5DMYA 1S9FA 1S1PA 5LZLA 4ZQOA 1OINA 1RVKA 3HF3A 1S5NA 3HFYA 1UB3A 1PZ0A 3C2RA 2YDAA 2FFIA 3PVXA 2EGZA 5BRQA 2ZUVA 3EX2A 3UVIA 1KBKA 5AKQA 3TC7A 1EXBA 3IRSA 2DW7A 1CXKA 2BLEA 1TZ7A 3BOFA 3YPIA 3D6NA 2VX6A 3QC0A 1XIIA 5LHEA 5JBEA 2ZDSA 2DQWA 4XKYB 1HJSA 2GSJA 3XISA 3NO1A 5FSDC 2ISDA 3W4RA 3UJSA 5ABFA 2BGSA 5DQIA 3LI0A 3AC0A 1ZGDA 1W1VA 4K7YA 3VIGA 4PH6A 2O92A 4GUGA 2TMDA 1KWKA 4R34A 3P61A 1UP0A 1QBAA 3WBWA 1VKFA 3WJSA 1W9PA 3P8JA 5AC5A 3NGDA 5I79A 1QUMA 1VPXA 4TQSA 3EB3A 4C6JA 3CM4A 3K30A 2R1KA 4H1ZA 3GYCA 1MEHA 1R47A 3VA8A 3SZ8A 4DJFA 4D8LA 2BG5A 1Q2SA 2NX9A 2GJPA 1VHCA 2ZDRA 2NSOA 1R86A 2XGQA 3GTIA 1JZ3A 4A2SA 1ELSA 2XISA 5IFPA 4UQBA 4B5XA 5EMJA 5CSYA 1U5HA 1V6YA 3NA8A 3PZPA 5D05A 4AZ5A 4YIWA 4B4HA 3TJLA 5DF0A 1FWTA 4QJ1A 4WXZA 2PU1A 3PR5B 2OKTA 2UVVA 2C2RA 4X22A 4H19A 4E6MA 3E0VA 5F7UA 2PTZA 3CTLA 2D20A 1OWQA 4O13A 1LJYA 5G1YA 4D6FA 1M5WA 1ZFJA 1N8WA 2X1SA 4PTMA 4ZQRA 2QAPA 4ECQA 4AEEA 4QEHA 4O0ZA 4UFLA 3GU9A 1XICA 4IIBA 1NAL1 4IL2A 4IFKA 3APYA 3NQVA 5EMKA 1H7XA 1FCVA 2CERA 4IP4A 4GLEA 3OBAA 1LG1A 4JTIA 3OZPA 3MR3A 2DEPA 4UTFA 5I3IA 2YL5A 4U6PA 2G0WA 2FH6A 3DGRA 5D33A 1GT8A 2JEJA 3SCNA 4XG1A 1OFBA 3SAZA 3BTNA 1E3ZA 4CD6A 3NDZA 1GOXA 2Z7GA 3L65A 3VX0A 3ZWTA 4AMCA 1MDRA 4EANA 1RD6A 4REQB 3AIBA 3B0PA 3UR5A 3M5XA 1HN1A 1NVMA 4RR4A 3DFYA 1OC7A 3B8UA 3TUUA 2XSAA 2INEA 1H62A 3QPYA 1A0EA 4IRKA 1C8XA 3KHRA 1JUKA 4ERGA 3ITOA