4CQDA

The reaction mechanism of the n-isopropylammelide isopropylaminohydrolase atzc: insights from structural and mutagenesis studies
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
401
structure length
401
Chain Sequence
KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSAAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE
publication title X-Ray Structure and Mutagenesis Studies of the N-Isopropylammelide Isopropylaminohydrolase, Atzc
pubmed doi rcsb
source organism Pseudomonas sp. adp
molecule tags Hydrolase
total genus 161
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 4cqdA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4cqdA02
1KRMA 2WJDA 5HMFA 2ANUA 4HJWA 4C6MA 1RK6A 1WXYA 3RHGA 4G7EA 4ERAA 4DI8A 4L6DA 4NP7A 1I0DA 4XD5A 1W1IE 4AQLA 4R88A 1NFGA 2PUZA 4EPEC 1XWYA 2QPXA 4CNSA 1RJPA 1RA5A 2Z2AA 4HK5A 2HQAA 1A4LA 1FWGC 4C6NA 1RJRA 1BF6A 1NDVA 4G7EB 2R1PA 1YIXA 1QXLA 3QGKC 1JGMA 1EZ2A 3S4TA 1KRBC 2R1KA 1EF2A 4H9TA 4IG2B 4LANA 4C6FA 3IGHX 1ITQA 1DPMA 4DI9A 4QROA 3KM8A 4PCPA 4ZSUA 3LA4A 4LCSA 2R1NA 3WZ0E 4C6KA 4IFOA 4LAKA 3TN5A 1O12A 4GBDA 2WJFA 2HPMA 4GOAA 3TN3A 4H9MA 1UIOA 4H01A 2HBXA 3OQEA 3S2MA 3CJPA 1UIPA 4XAGA 2ZC1A 3AU6A 1RAKA 2Z24A 1PB0A 4J5NA 3IACA 1EYWA 2PGRA 4WGXA 3QY7A 1J79A 4R85A 4LEFA 3UF9A 1RK5A 1ONWA 1XRTA 3MKVA 1EJTC 4IFKA 5LXXA 1FKWA 3B0XA 1EJUC 1FWDC 2IMRA 1EJRC 2A3LA 3GTXA 3RN6A 2VM8A 2D2HA 2HPIA 3E74A 3T8LA 4NG3A 1V79A 4KQNA 2VR2A 2Y1HA 1NDYA 4DLFA 1VFLA 3NURA 3GIPA 4C6LA 4CEXC 3QY6A 4UB9A 3GU2A 4DZIA 1RA0A 4IFRA 2FVKA 2I5GA 3K4WA 3GTIA 4UBPC 4RDVA 4F0SA 3RCMA 1YBQA 1R9YA 2QS8A 4DO7A 2Z00A 2Z28A 4H00A 3LU2A 4BJHA 2KAUC 2Q01A 3FEQA 3ISIX 4PBFA 3PNUA 4PCNA 1FWJC 1M7JA 3OVGA 4ICMA 3MDUA 1ONXA 4C6DA 4QRNA 2P50A 1K70A 1FWBC 1POKA 4GK8A 4C6OA 3LGGA 3PNZA 1QW7A 1EJWC 1XGEA 1KRCC 3HTWA 4DLMA 1YMYA 3R0DA 4C5YA 3LY0A 3MJMA 3GU9A 4H9XA 2DVTA 3DCPA 3S2LA 4IGNA 3IPWA 3JZEA 3B0YA 3EWCA 3OOQA 2FTYA 3GIQA 4XD3A 4XAZA 4F0RA 2BB0A 3PAOA 2GWNA 3EGJA 5E5CA 2HNHA 3SO7A 4WVXA 3FDGA 4XD6A 2O4MA 4LAMA 3TN6A 3ITCA 2WJEA 1XRFA 2E25A 4NI8A 5HMDA 3DC8A 4QS5A 3K5XA 4GX9A 4J35A 4H9UA 1A5MC 4GY1A 4IQJA 4PE8A 3URQA 2GZXA 4C6JA 3E3HA 4CEUC 4LCRA 2Z26A 4I6KA 1FKXA 3FDKA 4RE0A 2P9BA 3SFWA 3S2NA 3DUGA 4EPDC 3F2BA 4C6BA 3O7UA 2OB3A 5G4HC 2FVMA 4YIWA 3F2CA 1K6WA 4ZSTA 4EPKA 3MSRA 2VC5A 4RDZA 3IRSA 3GUWA 3CAKA 2VUNA 3GU1A 3UPMA 2E1WA 4C65A 3E0LA 4CQDA 1PTAA 4KEVA 4RDYA 3MVTA 4GY0A 4IH3A 2BGNE 1GKRA 4IFKB 2D2JA 4B91A 3LGDA 3GG7A 1YRRA 4HK7A 3F2DA 3CS2A 1PO9A 3URAA 4BY3A 4KESA 4P5UA 1E9ZB 4JOMA 1WXZA 4B3ZA 3LSBA 4QSFA 1R9ZA 4C6EA 2W9MA 2UZ9A 5FSEC 1FWEC 3UR2A 3E38A 1J5SA 2OGJA 3G77A 4CQCA 1YBQB 4RDWA 1A5NC 2RAGA 2FTWA 3F4DA 4QTGA 4KEZA 1A5LC 4DZHA 4V1YA 1KCXA 3IARA 4XAYA 1P1MA 2PGFA 4ERIA 4I6VA 3N2CA 4L9XA 3MPGA 3GRIA 4WHBA 2AQVA 4LALA 1ADDA 2GSEA 2Z25A 2O4QA 3A3XA 4M51A 2HBVA 3OODA 4KF1A 4INFA 3RYSA 4GXWA 2YB1A 1A5OC 2UBPC 3E0FA 5A6TC 2VC7A 2DVXA 4IGMA 3LS9A 1NDWA 4EP8C 3S2JA 5FSDC 2Z2BA 4GYFA 1IE7C 1S3TC 1P6BA 1E9YB 2G3FA 3OJGA 1V7AA 3GTFA 2GOKA 3C86A 4CNUA 4BKNA 1ITUA 2D2GA 3A3WA 4H9VA 4IG2A 3F4CA 3T81A 3IV8A 3V7PA 2CZVA 4F0LA 1J6OA 4RZBA 4TQTA 3K2GA 4XD4A 4DIAA 1NDZA 2QVNA 4ERGA 2PLMA 1EJVC 3NEHA 4G2DA 4LAOA 1P6CA 4DNMA 1M65A 4C6PA 3GGMA 2OQLA 2ADAA 2EG6A 4EPBC 4HA0A 3A4JA 2OOFA 3HM7A 3AUOA 2R1LA 2YXOA 1FWFC 2FFIA 4C6CA 3TN4A 2VHLA 3UR5A 4H9YA 3LNPA 5CH9A 2AMXA 1V77A 4CQBA 3AU2A 4MUPA 5AKQA 3URNA 1FWIC 2Z7GA 2YB4A 3PANA 1UMLA 1ZZMA 1PSCA 4GZ7A 3NQBA 4C5ZA 3D6NA 3EWDA 2F6KA 1J6PA 3HPAA 1EJSC 3E2VA 3WYZA 2QT3A 3URBA 4D8LA 3LSCA 1GKPA 5HMEA 3O0FA 3OU8A 3MDWA 3QY8A 3UBPC 4GC3A 4GX8A 2Z4GA 1RJQA 2WM1A 4LCQA 4CNTA 4DYKA 1M68A 2DVUA 1FWCC 3PBMA 4LFYA 4HK6A 1GKQA 4XAFA 3QGAC 2GWGA 4E3TA 1KRAC 1I0BA 4OFCA 4C6IA 4J2MA 2EG7A 1EJXC 4AC7C 3ID7A 4R7WA 2Q09A 3B40A 3MTWA 1A4MA 4V1XA 2P53A 2XIOA 3ORWA 4IF2A 3WMLA 4H9ZA 1A5KC 4KERA 4KETA 4GY7A 4B90A 3ICJA 2R1MA 4C6QA 2PAJA 4C60A 1UBPC 2I9UA 2ICSA 1O5RA 1FWAC 2OODA 4LH8A 1HZYA 1V4YA 1YNYA 4QS6A 2AQOA 3IJ6A 2Z27A 1K1DA 2Z29A 2YZ5A 3GTHA 4KIRA 4KEUA 1V51A 1R9XA 3MVIA 4Z42C 3BE7A 2EG8A 1FWHC 4PBEA 1POJA 3TNBA 3T1GA 4B92A
chains in the Genus database with same CATH superfamily
2V9WA 4Q8WA 2WSKA 5LIUX 2FH8A 1HL8A 1B90A 1W1IE 4AQLA 1JX4A 2PDBA 1UQYA 5A5WA 3VKCA 3QVQA 4E2OA 1QBAA 2Z2AA 1A4LA 3BJFA 3DG7A 3ARUA 4QW8A 4G7EB 3SIMA 2V38A 2F61A 1RQBA 2OKOA 2BGQA 3S4TA 3W7PA 1E51A 1KXTA 3VIKA 4QGCA 4IG2B 1IT7A 3RM4A 2R1NA 3ELFA 4KFNA 5HAOA 2H8XA 4YP3A 4GUJA 3EOSA 3SCVA 4F0HA 4XVDA 1IGSA 3VIPA 1JAKA 3AIVA 4ECLA 1UW9A 2GSHA 1JDFA 3BK0A 1I75A 3B4UA 4ZQRA 1AQHA 2VT0A 3ZJ7A 1DWHM 4O16A 2QLYA 4LEFA 1EJTC 1B3YA 4RXFA 1K7EA 1SO5A 5CG7A 1JUEA 1DJGA 4M1RA 3WLPA 1XJBA 4KCTA 4ED2A 2A85A 2QDGA 4B9YA 3T0DA 1B30A 4IQDA 4MDOA 4CU7A 1Q63A 2WZHA 3VCCA 3BMVA 2R24A 4A22A 1PIIA 1OADA 1EHNA 4IIEA 3R2GA 3NPXA 1VPQA 4AIOA 4JTTA 1W32A 3GVGA 4DJDC 4HHHA 4AY7A 3VCNA 2E6DA 2D0GA 4O1AA 5FKYA 4CQAA 3EWXA 3UERA 3MUAA 4GVFA 2VEPA 2BX7A 1WKYA 4JTAA 1M7XA 3PK7A 2QGHA 3W82A 4MUZA 4XX6A 1FFQA 2DZSA 2GJXA 4XZ9A 4EYIB 1LRQA 3IUDA 4QFUA 3B03A 4TU1A 5CGMA 5AFDA 1OFQA 4IMDA 3BLLA 4AC1X 4QG9A 4R5EA 3WDQA 1E4IA 1RBOB 2XUCA 1V0NA 4Q6XA 3F03K 3W83A 3EPIA 4D2JA 2RGMA 3MZNA 3QR0A 4OJYA 4TVUA 2VKZG 3TEVA 4KIEA 3W1RA 1VBJA 4QQUA 4S3AA 4IGNA 4DELA 5C5JA 1B9ZA 3MY9A 3B0YA 2YLAA 1FBAA 2YDQA 3W7MA 2BLEA 4C1NB 3ZR6A 5I0DA 4GXMA 2VD9A 3SO7A 3VE9A 4O3QA 2A7PA 1J0IA 5F1VA 6PTDA 3NQFA 2WJEA 4S3FA 4RK8A 1F3XA 3N14A 1XYZA 3VMPA 2NUWA 3W38A 3LV6A 1OSEA 1KV5A 4PULA 1D7KA 5CZJA 5I06A 4FPSA 4CD7A 4XZIA 2WXDM 1TG7A 3CUZA 3HURA 2OB3A 5DANA 1LRTA 4ZSTA 2QCFA 2EJ1A 4KCWA 1SJAA 2AGTA 1E4NA 3V6JA 4EIVA 1XYMA 3S1GA 3S6OA 3ZOAA 3UP8A 4RDYA 1OCJA 3AMDA 5CEWA 3TW7A 4IH3A 3H12A 1OABA 1P0EA 3MMTA 3V5CA 3LEPA 4IPNB 1FXPA 3VD3A 1S0MA 3LHYA 3TJXA 4D8AA 1PAMA 1PX8A 3G0XA 5LSMA 2VMFA 1JDEA 2BVDA 3LRMA 3PZ9A 1OFAA 1Q7MA 3M1ZA 5F2LA 3B9NA 4JL1A 5LNRA 4OUEA 5AYXA 3NL3A 2ZX7A 3BH4A 1ISZA 1BXNA 1WUEA 2WMFA 5EA9A 3NA8A 3PR5B 1RP9A 2B81A 2FZBA 4H6QA 4V1YA 1KCXA 1KTCA 3KBJA 1UYQA 3GHUA 4OE7A 3KTSA 1VHCA 3CO8A 4I5UA 5AHLA 1LUCB 1HF6A 1VPXA 4NHVA 5JIPA 5G1TA 1E55A 1EGMA 3H54A 2R8HA 3PZVA 5L1IA 1VBUA 4DNHA 1Q8AA 4ACZA 5HXMA 5A6TC 3WNMA 5H2ZA 2C0AA 3S5YA 1NDWA 3S2JA 2WCGA 1SYTA 3WLSA 4TX8A 1MUMA 1P6BA 3GK0A 1WA3A 4U5IA 1CGWA 3ARTA 3LNMA 4XQ6A 2HXTA 1DWJM 1XG3A 4JTDA 1YKWA 3WK2A 3ENLA 3QC0A 4F0LA 1KB3A 3II1A 4RZ4A 1SZFA 5AB3A 4TMCA 2CESA 4ORMA 2PLMA 1XIEA 4PUMA 4LAOA 4UZUA 2OQLA 4ADTA 4EX4A 2FVLA 3ZS4A 2ADAA 2EG6A 3NVTA 3KCOA 5A94A 2R94A 4KCUA 4ICCX 1FWFC 3HV8A 1CNVA 4JGDA 3LCWA 1MW2A 3MUZ1 4D9PA 1XUZA 4QIUA 5C2XA 2BODX 1FCVA 3BOLA 3VIOA 4K7YA 3C52A 3R6IA 3JS3A 1B31A 5I3KA 1KTNA 2WJZA 1FHVA 2O9OA 1Q85A 4BEUA 3N3TA 3H2EA 5EDWA 3N6QA 3QW4B 5A2BA 2JKAA 3LG3A 4CN4A 3B06A 3VKBA 5K4XA 3RNDA 1Q6LA 4RXGA 5FL1A 3INPA 4FNTA 3ARSA 4CNTA 4LFYA 3NDOA 4I3GA 5DCEA 3RLHA 3K13A 1I0BA 3ZM8A 4AC7C 1YE4A 4PRTA 1A4MA 4DL4A 2A6LA 4H9ZA 5CPMA 3RDKA 1E6QM 3AOFA 4US5D 5TNVA 2XPKA 3SY5A 3SCSA 3VZXA 3LHUA 4O0QA 2JQXA 1V3HA 2DQXA 3G6MA 2OODA 3U2ZA 4RL3A 3M47A 1HZYA 3UESA 4H8UA 2AQOA 3U4AA 3IJ6A 3TLLA 3OGSA 4KEMA 2Y7EA 3UZ5A 3SECA 1K1DA 1E6ZA 4KEUA 5A2AA 3GV7B 4BS0A 2W7PA 2A0NA 3MSDA 1CGXA 1ZL1A 3S46A 1QUMA 4U7CA 3GDRA 4GH1A 4M3PA 4RNNA 3UR8A 4L4MA 4ERAA 4L6DA 3KCJA 4MYAA 5I7GA 2XVGA 2ACQA 5MF5A 3ZFHA 4ZQPA 3DG3A 3H40A 1OD8A 1AA1B 1QJWA 3WFZA 4MPQA 1FWGC 5H8PA 4OUIA 1NDVA 3OG2A 1UD6A 1LBLA 4G6CA 2QNEA 2Y8KA 1EB3A 3W2UA 3QGKC 1EZ2A 1ZBKA 4E2VA 8A3HA 1EIXA 3P5YA 3VIMA 3QTPA 4ZSUA 4L9ZA 4ENLA 2Y2WA 1FRBA 1QVBA 1IIHA 2GDUA 3NTYA 4LAKA 4GISA 4PH6A 3HJEA 2WJFA 3NGFA 4LAUA 1DQWA 2HK1A 2XVPA 5I03A 5T9BG 4GKLA 4ZL1A 1IEIA 5I23A 3NUKA 3CJPA 3EDDA 4D6EA 2V69A 1OFRA 1C9WA 1UR3M 3W1QA 2WBGA 3NGJA 2QDDA 3DFSA 3E0WA 3GDKA 4TTUA 3SJ3A 4N9EA 1X8FA 1LOLA 3U4FA 2BOFX 1C7SA 1UUQA 2WZTA 3UG5A 1M7OA 1TTJA 2WSPA 1W5NA 5J5RA 4YR0A 1KM2A 1Z41A 2PP0A 3KLLA 4NZ1A 5DT5A 4C6LA 5FJOA 4Z1BA 4ZOAA 4DYJA 1JNDA 2X1TA 1ESWA 3VNLA 4Q8OA 4V15A 1D8WA 1JD7A 3K8LA 1YBQA 2HCVA 1YE6A 3SCRA 3GO2A 1EDTA 3CYVA 3BCJA 3EDEA 3R1ZA 1XBYA 1BG9A 2GQ9A 2WANA 4RUBA 2FLLA 4PBFA 3HMCA 3Q4DA 2PBOA 1KM1A 1ONXA 2PWHA 4C6DA 1EQCA 1CEOA 1FWBC 4DJDA 1EUAA 3DOPA 1KXHA 4REQB 4FO4A 4WJXA 1YMYA 3CUIA 4E0CA 3W87A 1XUUA 3UNTA 2QQ6A 4AWSA 4PCFA 3DCPA 4LAZA 2XC9A 2FHCA 1CXIA 5FF2A 5MHBA 1OC6A 4XZNX 4F0RA 1Z7AA 3BSMA 3GC2A 4W7WA 4AZHA 5DF0A 4EAYA 4M19A 2ZVRA 2H9AA 2L5HA 1GZJA 2G41A 3C2FA 3BOXA 4MY9A 5TIMA 3WMCA 4AEFA 3MP5A 3ITCA 1UH3A 3BJYA 2O9RA 2JGYA 2PCEA 3DC8A 1J12A 4O0KA 4CCDA 1P5BA 4G8TA 3GAYA 2FLPA 3GBEA 1K8YA 3H4BA 1JDAA 3I68A 3QBUA 4PMVA 4B4HA 3F2CA 1K6WA 2G4JA 4HU0A 2BFGA 4O8AA 4WX2A 1Q8JA 2X1UA 4KMQA 2P3ZA 3HFTA 3MU7A 1BRLA 2Z0IA 2XGPA 2DZTA 4YWIA 1X98A 4B2DA 4WDXA 1GW1A 4PFMA 2PURA 3AO0A 2D2JA 3K46A 4LBUA 1F3TA 3GIJA 4AB4A 2VZUA 1R2RA 1L6WA 4DWSB 3F2DA 1GYMA 3BOFA 4X3ZA 2FZMA 2I16A 3EWYA 4HT3A 5FEPA 3EX4A 5BOOA 4W93A 3IWPA 3VINA 3MO4A 4YHGA 1RCQA 1GPFA 2V5KA 2X30A 2R8JA 4CCEA 2C0HA 4L6OA 3U9IA 3E0VA 1YNQA 3E38A 1HVXA 5KZ6A 5BMXA 5AYIA 4LYRA 1JZ7A 1P6WA 3NL5A 1E73M 2NXIA 2Y61A 1TELA 2ZXQA 3RFAA 4ERIA 4L9XA 3CZ8A 2J7EA 1SO4A 2YR1A 4AXKA 1ADDA 1CGTA 4LALA 4MZ1A 2Z25A 2CLOA 2O4QA 3OODA 3LI0A 2V67A 4S3JA 4TX9A 1QPOA 3O6CA 1J0HA 6XIAA 3DZ1A 4QWAA 3B9EA 4KW2A 1AD4A 5AC5A 3PUGA 1IE7C 5EFFA 1UMYA 4XV0A 3WQWA 3TV8A 4QAIA 2OT1A 1CI1A 3SUVA 1SO3A 3L4TA 3ARPA 3T81A 4JKMA 3LHTA 3EA2A 5AYYA 2EKCA 1J0JA 3WMSA 2C2RA 3K2GA 4LXFA 1BSLA 5G5IA 1DEDA 2W67A 3HV9A 1HKJA 5CGQA 4C6PA 3NQ8A 3H2OA 2J9XA 1CGYA 4Q4RA 4LVFA 4I5XA 3IVTA 1H7NA 2XH4A 4W89A 2YZRA 1W9XA 2Q3OA 1C8VA 4HCLA 3WBWA 4GC6A 2HRWA 4O12A 4MUPA 1NU5A 4P8WA 3Q37A 5LYRA 1LROA 3WK0A 1TX2A 3ZJ6A 3D6NA 1IWPA 1EC7A 4N9DA 2HISA 2O9TA 1E6XM 2AGPA 4D8LA 5E0FA 1O60A 1JPDX 3G6XA 4FLOA 4J9LA 1P48A 3W23A 1RJQA 1OYAA 2C22A 3RK8A 5LA0A 2ASJA 2DVUA 3EOEA 1XRVA 5CSSA 5GNXA 4ZENA 3GNDA 5F2GA 4JICA 3MTWA 1PX3A 3QZ6A 4N6EA 1ITXA 1F8MA 4XIAA 2ISDA 2PLKA 4CD6A 4J9JA 2G50A 1A0CA 4WXYA 3UFYA 3GFZA 3IUHA 4QJ3B 3PW0A 3UJEA 4AH7A 3CYJA 2GDQA 4UWMA 3BPWA 1EJ7L 4MLRA 1V51A 3MS8A 3WJZA 5H8UA 4JR5A 5HJYA 3TNBA 3T1GA 4IP7A 1AH0A 3QF0A 5BWAA 4HJWA 1EHAA 3PBWA 4WUIA 1ZPTA 4ACZB 4S2CA 4IM4A 3LUTA 4H83A 1NFGA 1JCLA 1TJRA 2F6XA 5JVLA 3OG3A 3CAQA 1YQ2A 3EB4A 3ITTA 5HUPA 4B16A 4P7LA 3CM4A 4MNMA 1DORA 3FXGA 4H9TA 1VFUA 1HJSA 3EOUA 3NYDA 3KUMA 2VEGA 2OWXA 3W1AA 3RPDA 1Z6KA 4HPJA 1CT5A 2WCAA 1FHUA 3PG8A 1I1WA 1R3VA 4Q7BA 3PAJA 4I9AA 3W22A 1QI2A 4BA0A 2B7QA 1MZRA 3W7OA 2X1SA 3VPLA 1NSJA 4H01A 4Z1CA 3UEQA 4Z0JA 4ZVJA 4MKSA 5LHFA 3P84A 4GQRA 4NILA 3WEZA 4E4PA 4JV0A 4J5NA 2PGRA 4XWUA 3UW6A 5C9RA 1H1NA 4H7CA 4DF1A 5RUBA 4LF2A 4GZEA 5KFFA 4DZ5A 1FWDC 5CJNA 3PW4A 2R14A 4XG1A 4S3DA 5GJMA 1WZLA 2XN1A 3WK3A 3QRHA 1GOWA 1B3OA 2PDKA 3HIJA 5DG7A 1G0CA 2X7WA 3CIWA 3DENA 3Q65A 5D2YA 1XYLA 1XIJA 2V2HA 5FJJA 4UB9A 5L9XA 4GO8A 4BHYA 3HPFA 5EY5A 5BXSA 2E67A 4AY8A 1TTIA 2OO0A 4UFLA 4WD0A 2BOGX 1E1EA 3TZNA 1RBLA 2DFAA 4XBSA 1NM9A 3LD5A 4DM2A 2WBKA 3H4DA 2DIJA 1MRAA 1ZJAA 4Q8TA 2VOMA 3VU2A 1D3HA 3TA9A 3CB3A 1IM4A 2C15A 3N15A 4P2VA 5GJPA 4JFSA 3V18A 3LI1A 4BFAA 3S5ZA 9XIAA 4RZ5A 3E5PA 4MKVA 5BYWA 5A8GA 3KOYA 1UG6A 1NFBA 1QPNA 2OU4A 4LBSA 4CVUA 5I6SA 1Z89A 1WNOA 2VR4A 1TPFA 2PZNA 5F9NA 2VFHA 3GDMA 5E70A 1YTKA 3RMJA 4UOZA 1FH7A 3WUFA 5CC5A 3BARA 3PBVA 5IDZA 3UY7A 4H3DA 1H63A 2A3BA 3SZ8A 3GIYA 3OP2A 3WUBA 5A6BD 3L9CA 1PKNA 5KZEA 3E2RA 3URQA 3KRUA 3P62A 2GZXA 2XH7A 2GLKA 3NZQA 1PJ9A 1XLEA 4XZHA 3K8MA 5G4EA 5BMWA 1CXLA 1F5ZA 3PN8A 3DFQA 3TR2A 5M2FX 1LL6A 3LB0A 4CQ8A 2TAAA 2VWTA 3UY8A 4KRTA 3HPSA 4O57A 5AVHA 3B05A 3B8VA 3IRSA 4JTEA 1I2NA 4BQ5A 4K39A 3MR5A 1RR2A 3DFTA 1GZGA 2A6NA 1UR8A 3HU7A 3OIHA 2VL4A 1PTAA 4CQ9A 4FA3A 2VFEA 1XLBA 3UZZA 4MWAC 3S1WA 3B9DA 3H7UA 4PRRA 3EMZA 1BGGA 4UTLA 3S5OA 3EDJA 2J8GA 3CS2A 4DBWA 2XSBA 1Y65A 2OLHA 2OTDA 2W9MA 2IXVA 1SFSA 3CQIA 4CQCA 4AWUA 1YBQB 1JCXA 2RDWA 2BNJA 2FQIA 5F2IA 5EKYA 4WKFA 1EPXA 2YL5A 3SCNA 2GJPA 2AQVA 1OIMA 2ZUNA 4DJED 4ZXOA 2DW6A 2XVLA 2QUNA 2D20A 3OTRA 3TYAA 4UTJA 4AX6A 3B9AA 3A64A 1OCBA 5FIPA 1CTNA 2WWDA 2WHKA 3AXKA 2VO5A 3V1HA 2BVTA 3CUGA 1HN1A 5BW6A 3T42A 2GGHA 4IIDA 2Z2BA 2J77A 2WVTA 1A3WA 3KBSA 3WH8A 2NQ9A 1ZUAX 2Q6ZA 1RPKA 4OKDA 1KLYA 2IUZA 3OGRA 3G1YA 3TCSA 3GH4A 4UTWC 4DAIA 5D37A 3IJ7A 2PWVA 4RZBA 2PTWA 2QVNA 4N0RA 4PMZA 4DIAA 2H9AB 1MW0A 7A3HA 2CLKA 3N6JA 3GR7A 4NX5A 2QCNA 4R8UB 2Z1KA 1KBBA 3C3UA 2W79A 7TAAA 2WSRA 2Z2UA 2XJ7A 4IHCA 2FFIA 4GCAA 5C2GA 5BOFA 1SSDA 1QOPA 3PZOA 2FZDA 4R7OA 2QUUA 3S9ZA 3NPWA 3SN0A 3UPWA 1TQJA 3T78A 4JFVA 2CC0A 2CKRA 2VELA 4B5SA 5LIWX 2HMCA 4E2DA 2GVGA 1MQRA 4DBUA 2QMKA 4GZ7A 1R87A 3PTKA 3HOJA 2ZBTA 4D8ZA 4D6GA 7TIMA 3L2LA 1HJXA 5U7SA 4UOQA 4ZO7A 3IIZA 1VRXA 2Z4GA 1S5TA 1Q6EA 3W76A 4LCQA 3MANA 2P3EA 1U1HA 5D33A 2CFFA 3QOKA 4GO9A 3AYSA 3R0UA 4HYRA 2AAAA 2GWGA 3WK1A 4IX2A 4NUWA 1Q6RA 1C8QA 3R5EA 4A05A 4WOQA 3W7KA 1WAWA 5FACA 1KGUA 5FF4A 4BI7A 2HTMA 2PE4A 3IJLA 4Y2WA 3M46A 2RUSA 1YXCA 3RO8A 1T41A 3OB8A 1S2CA 4FXSA 2CLIA 1ZJIA 2YZ5A 2WMGA 4LVBA 1S39A 2V82A 1R9XA 2QZRA 5LNSA 3FY1A 1QBBA 1N56A 1R3QA 3F5JA 3RCNA 4ZO9A 3ZR4A 3WNPA 2BHZA 1HW6A 4YJ5A 2UV8G 1GOXA 1DWAM 4E5TA 2OSYA 4X2PA 3MMUA 2EHHA 4BK9A 1KC7A 2NQZA 1HJVA 1KNWA 3M4HA 4KRUA 2C18A 3BURA 3WLLA 2O0TA 1EF2A 1JVNA 1XCFA 2BVWA 3C8FA 2ONEA 5DMNA 3TJ4A 4MPKA 4XK2A 1W54A 4JIHA 4UQCA 3W72A 5GNYA 5EBAA 1TO3A 5DY2A 5AZ0A 3K1GA 4K7VA 5F4WA 5B80A 3PPGA 4ZTYA 4U31A 2NSXA 1E56A 1DL3A 1H61A 5A6KA 4BI6A 3AS3A 1O6IA 1LP6A 2NWSA 3ES8A 2VCAA 3TYCA 1YPIA 1VP5A 2V8ZA 4D6HA 4WGXA 4ECXA 3TFXA 2BZNA 5B7YA 3CUFA 5XIAA 1AQFA 3VVGA 5DXXA 3WD0A 1C91A 4JFTA 5KEZA 5DO8A 2J24A 3W29A 1W9UA 5A2CA 1F9CA 5D2VA 5KFDA 2OT0A 2WQDA 1ISWA 4Q8MA 3G1FA 1EP2A 3OSPA 2KZHA 1J01A 4A3QA 4O1BA 6TAAA 1WDRA 2G0WA 1NEYA 2VXNA 1TR1A 2VGGA 4DZIA 3EPGA 2DJXA 3I6RA 1E0WA 3GTIA 1OB0A 1JCJA 3W85A 3IGXA 4MNLA 4HZ7A 4RDVA 2XCPA 3CGTA 3NYZA 1FWNA 4XZLX 1J2BA 2FLNA 3BSGA 1GOQA 3PUEA 2AMGA 1NQ6A 1UUMA 3WL0A 2Y8VA 1LWHA 3FEQA 4Q8NA 2ASLA 4OWGA 1UC4A 3H21A 3SEPA 4QLKA 4LNYA 4DF0A 4QRNA 3DKLA 2H90A 5CPNA 1MRQA 3PY2A 1POKA 2BGSA 3PNZA 1LZOA 4WSKA 3W7EA 2VP8A 1ZSXA 3MJMA 2WNZA 4LGXA 1E4MM 1RYRA 4UTHA 1FQ0A 5DGAA 5I5RA 1OZMA 1FDJA 3UA4A 1QAPA 1QNVA 1TMQA 3O6DA 3UCDA 4HVXA 2J78A 3N29A 4J28A 3OVPA 2RFGA 1A80A 4F3HA 3ZVIA 3GXIA 3RX2A 1Q4WA 4JTIA 1H1YA 3T05A 4GY1A 1IZCA 4P7NA 2NZLA 2PFHA 2WVVA 3ARVA 4IUOA 3I7RA 4MAZA 1XLFA 3V5OA 4FF7A 1H62A 1VQTA 2P9BA 3UGVA 4MM1A 3TTOA 3W7CA 1VYSX 3H22A 2PC8A 3GXFA 2Y88A 1QOQA 4GUGA 1R85A 2HNEA 2WZEA 4PMOA 2E1WA 3IAQA 3SR7A 3D3FA 1UD8A 2RJGA 1LQAA 3H8AA 1TRIA 1W56A 3LCIA 1SR0A 1VYRA 1WBJA 2V3EA 2VQUA 3KTXA 4JQ4A 1PV8A 3TOYA 3SM0A 1E1CA 3HGOA 2FH6A 2DIKA 4X63A 1YRRA 3WQCA 3RX3A 2J25A 3MT1A 2XM1A 3PSVA 1I45A 1P7TA 3KAOA 1JRBA 3JU2A 3CAVA 3LSBA 5KZMA 5LA1A 5C6MA 3SIZA 5FSEC 4DL3A 4H4IA 4A21A 4QLJA 4TMBA 2YDSA 1H5VA 2CZ5A 2E5DA 4LUSB 4MWAA 1T8QA 3N3MA 1A5LC 4FBUA 1NFPA 4NX0A 2PGFA 1R3SA 2DZXA 2FZ9A 1MFUA 1IZJA 2P0OA 1XPGA 3W1UA 3VNDA 3RR4A 2O7SA 3F4NA 1MNSA 1JYNA 2BQRA 5TBOA 4UMAA 1W17A 1R38A 4IZGA 3W1LA 4R9OA 4AIUA 2G4FA 4RPQA 3QM3A 1UJQA 3G8EA 2P8CA 1NIUA 3KP1A 3L2IA 3O8AA 4DUWA 1K3UA 4P8VA 1XLCA 3MI6A 4FZIA 4WDUA 3MWAA 1DJNA 5BROA 1SW7A 2ZADA 2WKLA 3THQA 4EE9A 2FHBA 2VENA 3MC5A 4EPBC 5LKYA 5FJTA 2OOFA 1Z32X 1JXJA 4YXGA 5C9WA 4D6FA 5KFGA 2QAFA 1A5AA 1YDNA 4C6CA 1J5TA 4F4ZA 2VHLA 1SJDA 4LV9A 2YKKA 2AMXA 4MFDA 2J6VA 4YR2A 1NF7A 4ZCWA 1V8EA 2Y63A 2SFPA 1IZKA 3KVMA 3BG3A 2WHMA 1UMLA 1TV8A 4Y8FA 4WGHA 1SVDA 3SQLA 1AJ2A 4N7QA 1OG6A 5D03A 5G2WA 1EX5A 4EANA 2IXUA 5KFWA 4Q7NA 1UZ1A 4LJ3A 1SJBA 2QT3A 3IGSA 3AXHA 1GT8A 3RITA 3HG3A 2QIWA 2ESCA 2BY0A 4LEQA 1UD2A 4IL2A 4F48A 2ZA2A 4DYKA 2YA1A 1UR0A 5BRPA 4HCDA 2VDIA 5FD0A 4XAFA 4RZ6A 4J2MA 4GACA 2XGZA 1H0IA 1KM0A 2X0SA 3LENA 1W2VA 3MFHA 3WD3A 2I9UA 1TMHA 2OG9A 3HG2A 2A3AA 1DJIA 1RY8A 2CHRA 3QN3A 1TV7A 3ZSSA 1UKPA 3QZAA 1LBMA 1DJXA 3N17A 4UTKA 5HBFA 3WSUA 2EKGA 3ONCA 4PBEA 1KRMA 3LTYA 2WJDA 4W84A 1CW2A 3BG5A 2UY3A 3DGBA 4JYDA 4R7JA 1I6NA 5CC3A 2B7NA 4UTIA 3VNMA 2DJLA 4HSOA 2J6XA 1S0OA 1XWYA 1YEYA 2QPXA 3VOCA 2XM2A 1VFHA 4Q44A 4C6NA 2VUYA 2ZZ7A 4ZTXA 3M9NB 3OYXA 3C0SA 2E28A 3TWAA 1F74A 3R58A 3S9YA 4PCPA 5DXYA 3ZT6A 1E4LA 1HO4A 1HGYA 1IHIA 3E5BA 1DYSA 1TRDA 3FX4A 3THUA 4I7VA 5I77A 3AS2A 5EMLA 4GA8A 3WLOA 1SW3A 1ZNNA 1YTDA 3S9IA 1UB3A 2OXNA 3GC4A 5KSWA 3CHEA 4CUCA 3PULA 4J9MA 3WUEA 1EYWA 3C2OA 3C56A 1G69A 2WB5A 3WX7A 2IMRA 1VCVA 1OYCA 6REQB 1TPUA 4XVEA 3G1HA 2YCLA 3CPGA 5DMYA 5D02A 2Y7FA 2EEXA 3E74A 4JIQA 3PZUA 3CHCA 2GFTA 5D8WA 3GHSA 1R2SA 1LT8A 3SCTA 2C1HA 3KEHA 4W9TA 3FVMA 4O3RA 2I5GA 2QHAA 3HPZA 4LTSA 3GLCA 4F0SA 4OV9A 4HHLA 9RUBA 1JR1A 1TPDA 2VX4A 3GQYA 2F7FA 2Q01A 4HB7A 4QDMA 3BGJA 4CU6A 2JF7A 4J9NA 5D09A 3QPYA 5E9AA 5HNTA 3A21A 3WN6A 2WNWA 1WZMA 3DU0A 5CC6A 2OSXA 4DL2A 2FYMA 4AD2A 3BLIA 1OBAA 3DXIA 3N04A 3GYCA 4W8AA 5ABFA 4KWUA 2CBJA 2F84A 4GI9A 1S0NA 3HG5A 3AI0A 4AMAA 1HUVA 4LS2A 2XSXA 4HYWA 3TMLA 3DFPA 3LCGA 1GVQA 2VURA 5HATA 3W1NA 3P0XA 4F0KA 5FOOA 1V7YA 1UR4A 4WVXA 2ASHA 4GUHA 1AVAA 1X6NA 3AROA 1DJHA 1GW9A 3TN6A 4JIRA 1GOKA 3GG1A 4G1KA 1XH0A 2OPJA 5IHSA 3QV9A 1XIFA 1VD6A 3QHOA 4HNOA 1JCMP 4IQJA 3JRKA 3QLDA 2WMHA 3SUSA 1BFNA 1QFEA 3QYSA 4LWWA 1TJ1A 2WC4A 5T9CE 4AVFA 4RE0A 1UD3A 1JRCA 4FOJA 4PYSA 4E3VA 1FWWA 4WIWA 3W0KA 5G4HC 1UH4A 1WDDA 3L5AA 1C3FA 4QDPA 4DYEA 3WQOA 4FHAA 2GVJA 1HL9A 1QPQA 3MSRA 2OCZA 5AC4A 2PSNA 4RCXA 2YL6A 3IVSA 2XZ7A 5L6UA 1QR7A 1JUKA 4HU4A 5FI8A 4XSLA 3L12A 3O06A 3S83A 1BHGA 4LYPA 5D8ZA 2KX9A 4HYVA 3B97A 1YPFA 3T5JA 5D05A 1P0NA 3QKEA 4EOUA 1S97A 4W4QA 4P5UA 4U4MA 1Q6OA 2UZ9A 4NAFA 4S2BA 1E40A 4A6GA 1XS2A 2FDMA 3LQGA 3AXMA 3BDKA 4O19A 1V6UA 2AKZA 4H7ZA 3WELA 2PWFA 1U30A 3N2TA 2V6AA 3DFHA 1X1ZA 3PTDA 3LMYA 5CAHA 4RLIA 3CL6A 1GYLA 4B4FA 4XB3A 4CN6A 1CIUA 4GXWA 2ZRVA 3MR6A 1KBIA 4DL6A 4DPQA 1R8LA 3EA3A 3BAXA 2YDAA 4ZMGA 1FH9A 2QKFA 5LA2A 4NYUA 2C16A 3WDIA 3R94A 1JFXA 4CCCA 3VOFA 4EWJA 3W1XA 4AD5A 3W7LA 4DJDD 4X60A 2HZGA 3L7RA 3BMXA 4JZ5A 3F4CA 3IV8A 4JCLA 4UFHA 3AAMA 4FS9A 3IJ9A 2V3DA 4Q43A 3BLPX 4LUYA 4W5ZA 1IWAA 3IS4A 3NEHA 2NLYA 4QM1A 3VM7A 1YX1A 2J88A 1FXQA 2AL2A 3P93A 1FFRA 3B8SA 3A4JA 3W7HA 1BYBA 3SFKA 4ZE4A 4GC7A 3NCOA 3I3EA 3UWUA 3C2YA 3VM5A 1GQNA 1W1YA 4YS1A 2FKPA 4WKAA 4NASA 2YGYA 1NP2A 3TYUA 1REQA 2VX5A 1I60A 3LPPA 4B5NA 3KDOA 1JF6A 3O07A 6ENLA 2NT0A 1TPB1 1GCYA 1TIWA 2YCIX 3BUVA 3C2VA 4Y90A 3TX9A 5C7HA 1BKSA 3O1NA 1KFLA 2Y4SA 3PSWA 1C9DA 2E7FA 1RCOB 4L61A 3VGHA 1CLXA 4IQEA 2ISFA 1E1CB 5EYWA 3QGAC 3IJQA 3THDA 1JCTA 1WQ5A 3W7DA 3KS5A 5IHRA 1MO0A 1EF3A 3GHRA 1W1A1 1KKRA 1JIBA 1V5XA 4B2DD 3GKFA 3IJDA 2E68A 4MY1A 1DIKA 3TK7A 2RH9A 3GXPA 2XU2A 1O5RA 2HSAA 3RLVA 2WCSA 2XHYA 4U2ZA 5T26A 1XQLA 3LXBA 4IT1A 4MJMA 1V4YA 1F8IA 1KTBA 1Y7VA 3DHDA 3EOOA 4MWAB 3USBA 3MV11 3NQEA 3TFCA 3TTSA 3MVIA 2ZZ5A 1JPIA 4F4XA 5EMJA 4DL5A 1EWEA 4CVWA 1PKYA 1PS9A 2P0IA 4W7UA 2EPKX 1W6TA 2F8QA 4RKAA 4RX0A 4JQAA 4R88A 2Y5EA 4ADUA 3PZIA 3OBAA 2ASDA 3FA3A 1RJRA 4D71A 4ZQCA 1QW8A 1JGMA 1E0XA 4IRCA 3TONA 1VF8A 1XH1A 4J9QA 3CUHA 2D73A 2F38A 4LANA 2VRKA 2QPUA 3GD6A 2BR0A 1NWTA 1V6VA 4DI9A 5G2IA 4FIQA 1LLZA 5G1MA 4LRSA 4FXRA 4KGLA 5C8BB 3P80A 1O12A 2HPMA 3AMLA 4LUJA 2RDTA 1HG3A 1V0KA 4A2RA 2E6FA 2YSWA 2WQPA 1UIOA 4C1LA 4AXNA 1M01A 5IDIA 3VFCA 1D2KA 4N42A 3UXAA 3OA5A 2P1FA 4QJ5B 3MYPA 4UFMA 3IACA 4DAFA 4J3UA 5EL1A 1UUOA 4UQBA 3UD6A 3W7IA 1DOSA 1RLDA 4ATDA 4ECSA 2NXGA 2JBMA 3FAWA 1FKWA 1EJUC 1F6YA 1EJRC 4KH2A 4GI6A 1TVNA 1AFSA 3M0VA 1FOBA 4HMNA 3VC6A 2Y1HA 1NDYA 5K9DA 4DLFA 2X2GA 3T08A 3ZT5A 5JBEA 3FJ4A 3NEVA 5GNZA 1ISVA 3F7JA 5CZKA 3SAZA 3VYLA 5KFHA 3A3HA 3TZFA 2QULA 4Q8UA 4H8NA 3NPVA 4ML4A 2HVOA 3TYDA 3UGRA 4AZ7A 3L66A 3M44A 3DYPA 2PDMA 3VOGA 3PNUA 1PVNA 5DEZA 4Q8VA 1HXJA 5KT7A 1OG0A 5DG8A 3FHAA 5C2CA 3IIVA 4O13A 3V0TA 4XKMA 3LV5A 3BV4A 7ENLA 1QW7A 5ABGA 3MMWA 1BYCA 1E6NA 3LY0A 1W8GA 3HB9A 1MNZA 1XCXA 1YDYA 5KFQA 3JZEA 3BSHA 3OOQA 4UQAA 3BC9A 4XD3A 3WJWA 2VJXA 1H4PA 1H2JA 1QPKA 4NZ3A 3J7HA 5KFSA 1UWAA 1MYRA 4AX7A 2O4MA 1KW1A 3NO5A 4AWTA 2ZYFA 4MWAE 3LTSA 4Y96A 1U1UA 3R13A 5CLWA 4Q45A 3CPUA 1C8XA 1Q4NX 3RLUA 4PUJA 4HYKA 5CAKA 3FK4A 4C6JA 1I2OA 3QSTA 1JQVA 4M6QA 3S2NA 4ZB2A 2J27A 4NZCA 3CHFA 3G22A 1EIBA 3HZ3A 1F07A 1B54A 1EZWA 2Z1XA 5GPRA 3ZIZA 1OGGA 4RDZA 4FX6M 3W73A 5DGBA 3GU1A 3ABQA 3KHJA 2QCCA 3WLQA 1MUWA 2PD9A 2CPUA 2DDXA 1G7UA 4YPJA 3CH9A 5FEZA 5DFAA 3T5KA 1GORA 1JL8A 2E8YA 2OMAA 3NPUA 3A5FA 4NAEA 4MZ8A 4E38A 4PUDA 2WVSA 2YCLB 2YBTA 4UXDA 1RYSA 4JFWA 4G3IA 3NFUA 1JEZA 3NQ7A 5K2ZA 4O11A 4IPJA 3N12A 4H41A 4S3BA 3W84A 1A0EA 1P1XA 1TMLA 1KWGA 1V08A 2QMJA 4FNPA 1L2UA 1J5SA 3WCZA 4HNLA 4RDWA 3TJIA 4KEZA 3QSRA 1JYWA 2QCGA 4LS1A 8TIMA 3QV7A 4QW9A 3NXLA 1TKKA 3UJRA 1EWDA 3S3GA 3NG3A 3CB8A 3CEPA 4KWOA 3TSBA 1Y5VA 2DZVA 2YB1A 3EZ4A 1K9EA 1NARA 3AISA 3TH6A 2DVXA 4IGMA 1W1VA 5E0KA 1JF5A 2GUYA 3NWRA 4HCHA 1FWRA 1E9YB 4PTDA 3MHGA 3RO6A 4CNUA 1XYFA 3K8KA 2OFJA 5ABFB 1XCWA 4LYKA 1U83A 1AW1A 1R0MA 4O1FA 3C0JA 1O66A 1JZ5A 3APYA 5KG6A 2YW3A 4AY1A 4RUAA 3NOYA 7PTDA 4RPPA 4ERGA 3R8RA 5HR7A 2ACRA 3IAPA 1QPRA 2FGZA 2QJGA 4OBSA 3UWWA 1Y5XA 5TD4A 3T0TA 3UA3A 1PCWA 2NVDA 3BLKA 3AUOA 3W37A 4N2YA 4EAMA 3C8NA 4UCGA 2QGYA 4WOZA 1WB0A 4J3SA 3NZ1A 1JZ6A 1TR9A 2C3ZA 3M5VA 3AU2A 1ENUA 3WDJA 1CB2A 3CV7A 1XRSA 2YB4A 3FW6A 2DSUA 3OGVA 2DPEA 3FGCA 5A6MA 3ANVA 2WC3A 2OZ3A 2BMBA 5KT5A 3C0QA 3UJSA 4HA4A 3TAKA 3GUGA 5IBXC 1IV8A 2PF8A 1IR1A 4K2SA 4LT9A 4ZQOA 1XLGA 3N4FA 3OZPA 3MI2A 3N19B 1P0KA 4MOZA 2HS6A 3UJFA 4YNGA 2NUYA 4L6HA 1AMKA 1SJCA 3ORWA 4IF2A 3G6LA 2B4GA 3R89A 2NX3A 1XIBA 2PD5A 4UTTA 1KM5A 4GYPA 4NAFB 3H4XA 1THFD 2JEQA 3WQ6A 3CU2A 3VI2A 3TE9A 3HQ1A 5DY3A 1PZ3A 5GJNA 1UZ4A 2PDHA 4JTSA 4F9DA 3OHAA 3BE7A 3LMZA 1OGBA 1Q2RA 4GQ0A 4XKYA 3A47A 3EYPA 5A8QA 2LLEA 2DT0A 1HKMA 3I6TA 4MB5A 4RU9A 4B9ZA 4CNSA 1VFTA 1GVEA 4MFEA 5DLCA 3CZEA 1OINA 1MEIA 5LNUA 3G1DA 2TPSA 4YR3A 3H4GA 3JW7A 4QJ1A 3NDZA 2AGKA 3MKKA 1ME7A 5M03A 3WF2A 4LCSA 4YTSA 1DHKA 3GDTA 4IFOA 3P61A 3RLGA 3TN5A 3UG4A 4GBDA 2FGBA 1MXGA 2AL2B 3PBGA 2CBIA 4ICNA 2D23A 1PL9A 4Z2JA 3H2FA 1WE5A 1EOMA 3VKDA 4J9OA 2YFNA 9CGTA 1EDGA 1I4NA 3QY7A 1DWFM 4S39A 5KFVA 4WCJA 1REQB 3ARQA 3UF9A 2GGGA 1XRTA 5CBIA 4ZB0A 1BQGA 2XIMA 3O0KA 3WH6A 2YJQA 3CL7A 4K38A 3A5VA 3AHVA 1OWQA 5KFXA 1TSIA 2CHNA 1VAHA 2YW4A 4JTQA 3PUDA 1AD1A 5EB8A 1A5UA 1XFCA 3QMTA 2W9BA 2P88A 3KL0A 3PJUA 4FSAA 2RJHA 3H2CA 4ZA0A 4W86A 4JNZA 3HFYA 3QXBA 5AC8A 2W27A 3ZLHA 4HPGA 4A4AA 4DO5A 1KCLA 5C9ZA 4JTCA 1G9HA 3N9KA 1KQZA 2Z00A 1M7PA 2Z28A 3SRFA 3IJ8A 3ZYZA 4DVOA 3DN5A 3ISIX 2VEMA 2OZTA 1BD0A 2VZSA 3CQJA 4L4PA 1FWJC 4QQ3A 1S38A 3OVGA 5K4ZA 1KBJA 4KGJA 2P50A 4NZ4A 2VDGA 1Q6GA 4GK8A 3EKGA 3IEBA 1GQKA 3CZLA 3HQOA 1XDJA 2IQDA 1ICSA 2Q3RA 4AYSA 3AWOA 3WLRA 2VFGA 1W5PA 4UR9A 5FF3A 3NR0A 3UWVA 1HNYA 5A8PA 3W75A 1JI2A 3KBWA 3EX2A 3EWCA 3GIQA 4O4VA 1DJYA 1UCWA 3KCLA 2YBVA 3EWUA 3EX1A 1JCNA 2OO6A 2G3JA 1JZ8A 2BG5A 2DSKA 4NI8A 2W92A 3RG6A 2E5CA 3ARZA 4GX9A 4J35A 1V3KA 3PZMA 1OFDA 1M9HA 2BXVA 3BW3A 3VUPA 1CGVA 2FMOA 2Z26A 4QWCA 4GFIA 4H2HA 4MKNA 1PWLA 3R43A 4W8BA 1QDSA 4ROPA 3WQ4A 2RKXA 1W9VA 2DT2A 3G3MA 4L80A 1JPMA 2PB1A 3GVRA 2PTXA 3WBYA 4NYYA 4BR1A 3GNNA 5K9CA 1ZAJA 3MVTA 5M3WA 2VI0A 1KGXA 3N2OA 3L0GA 4NXKA 3A23A 2Y0FA 1QI0A 1EBGA 1XIHA 5BZAA 3STFA 3FLUA 2CBUA 4FF5A 5IFPA 4V27A 1RV8A 3TQ1A 1D8CA 5HNNA 3GB6A 1U5HA 3M0JA 4A29A 1RXOB 1FUYA 3H70A 2PI6A 1VCGA 5HWMA 1VBHA 2OGJA 3BZJA 1U2YA 3DHFA 3MI3A 4ALDA 4I5RA 4QG8A 3W2JA 3ARRA 5D9PA 3KBVA 4X61A 2BDQA 3VIGA 3N4AA 1JNEA 2PGEA 4KF1A 4INFA 3KFTA 2ZKMX 2VC7A 3BLFA 4L1WA 5CSYA 1WYIA 3FDSA 3O6YX 5EMYA 1LWJA 3LRLA 1S3TC 2PWGA 5KG5A 2RDUA 3P60A 3DBPA 1QI4A 3P74A 3MCNA 2Y62A 4QWBA 2PTZA 2PF0A 1JQXA 5JQ9A 3SCUA 5U4NA 3H2NA 3SJNA 1XGDA 4QNEA 1ZENA 3S42A 1PYFA 4UNIA 6XIMA 3BAIA 1WZKA 2CLHA 2W0UA 3PF3A 1KFWA 2ZFAA 5CGTA 3CZJA 2PDJA 4J2PA 4O0ZA 4GCXA 5CH9A 1SUXA 4MTVA 2GK1A 2AGQA 3S1UA 4GBUA 3AHZA 4UQ9A 2XVKA 1MSSA 1OYBA 4Q4MA 4C7GA 1ZALA 3GC5A 4MZYA 5KG0A 2CNCA 3URBA 3BWWA 1E70M 4OBRA 3MDWA 5EWEA 2E4TA 5D2TA 2QV5A 1JAEA 4YQWA 3WLHA 1GPWA 3PG9A 3UQNA 4A3HA 2DUZA 4LVAA 4NAEB 2CWNA 3TC7A 3S1VA 1QCWA 3ID7A 1JPKA 4ECTA 5CZ0A 3V35A 3M0HA 1A5KC 3N2BA 5CBJA 3E2QA 4C60A 1UBPC 4DO4A 4KBXA 2C71A 3NZRA 5IBXA 1FCUA 1EBHA 4JQ1A 4TOQA 3OQ8A 3CXOA 3GNPA 5BU9A 3KHGA 4GI4A 3CV6A 1OEPA 4KIRA 4HNNA 3BW4A 3KVJA 5HWNA 3QHMA 1GVOA 5KT4A 1EL3A 3GSMA 3GZ3A 1RP8A 3CL8A 4C6MA 2E9BA 2YYTA 3WQ8A 3EDFA 4MWAD 4PZVA 3TC3A 2GVEA 3N1AA 1OD0A 5D9NA 1MW1A 1B0IA 5I3HA 2UVRA 3M5ZA 2D0HA 4ATLA 1EKOA 4M6UA 1VFOA 2RDXA 1F7BA 1EA0A 3OBKA 1W31A 4URIA 5HQEA 3O16A 1VEMA 1PXGA 4GYJA 3T4CA 3TTYA 1EP3A 3LA4A 4AD1A 3DFOA 4ED8A 1OCQA 3P3BA 4Z1DA 3H7VA 3O3RA 2Y7DA 1ECEA 1XLKA 1V6XA 4G5DA 3KHDA 1H1ZA 3OQEA 3GIMA 1KFBA 3PHAA 2ZRWA 2X0HA 1KR0A 3KOZA 4EF9A 1RK5A 4GIEA 4U33A 5G4WA 4CU8A 4NZ5A 2TODA 5KFLA 1DIOA 3EWZA 1VH7A 3KZSA 3SCOA 4M7TA 1F76A 3WQEA 4ZB5A 3N11A 2WOQA 4CGTA 4J1OA 3ABSA 3VABA 3M64A 5BXPA 7REQA 1XQKA 4AWEA 5HNUA 1M3UA 4JTUA 4J27A 1TPH1 5CKSA 3VOIA 1ONEA 5EGRA 1MVYA 3ZXWA 4DEFA 3T4WA 1E72M 5F1UA 1B2YA 1C8YA 3WJXA 4H00A 4QSHA 4FOKA 3NQVA 3KL5A 4ASTA 4M8UA 3LPGA 1H3GA 1K7FA 5LGXA 1GG1A 3WENA 1DXIA 1RZMA 4GQGA 3AHXA 3WD4A 1RSCA 3SUWA 3W88A 1DE6A 3A13A 4H19A 4JQ3A 3U5UA 3FCPA 2G96A 2ZUVA 1IR2A 4ZO8A 3AICA 4C5YA 4E8GA 3LRKA 1KM3A 4BF9A 4H9XA 1J4EA 2ZRZA 2ATSA 2WYSA 1JCYA 3DESA 4ILSA 4XKYB 1CGUA 4MHBA 4NZJA 2GGEA 4XBKA 2CZEA 1KWKA 4XAZA 1TFVA 2XFYA 2BB0A 4PTNA 3I4EA 3EGJA 4D6CA 2HNHA 3V0UA 3GWQA 2BXYA 1ZCCA 5CJ5A 3HG4A 4DQWA 1TVPA 2ZCGA 4QP0A 4O3SA 2VEKA 1JUBA 1UC5A 1VLWA 1YXDA 5FJIA 1M1BA 4FOUA 2WZIA 1CLKA 2I7GA 3T5HA 1A5MC 3T0CA 1R3RA 1Z42A 4ZFMA 1DHPA 1XLHA 1TIMA 2OELA 4QCFA 1LTDA 4C6BA 1GK8A 5C55A 1F73A 1BLIA 1DJWA 3P7YA 4JY9A 1R30A 3STCA 4LW7A 1LT7A 3N18A 2QVHA 4XZBA 1N48A 1VFSA 1L8PA 5KT6A 1DV7A 1C92A 2E3ZA 4KEVA 1XYBA 3L4YA 3SQSA 3W00A 4JHOA 4MJ2A 4EXAA 1TVLA 2X41A 3GR8A 1TPEA 4J3WA 4Q4QA 3TROA 3C2EA 4IP4A 1X97A 4J3ZA 5C71A 3WKZA 1A5CA 4PMYA 4DRSA 3URAA 1WX0A 1XBVA 1TV4A 2W9BB 4JOMA 1MUCA 3B9OA 4IJRA 4OVXA 4GABA 1WDQA 3LOTA 5EU9A 5FAJA 4A3RA 4O28A 1Y5WA 5BOEA 1TCMA 2XWEA 2GVYA 2FTWA 1J9YA 3IARA 3VIJA 2P8BA 3WG6A 1UZHA 1WXJA 4HU8A 3NDYA 1J96A 4HHMA 4WHBA 5F4XA 4DXXA 1Z69A 3HO8A 3I10A 1ZU8A 5ENLA 3GH7A 1TREA 3W4RA 1PKLA 3O9NA 2X2YA 3TYBA 2J6SA 2YDRA 2XIJA 3TKFA 3CZGA 3AS0A 3TQKA 2OZ8A 3ITLA 3JR2A 4CKQA 4GJIA 5A3HA 2CZVA 3UCCA 1LL4A 1J6OA 5DRCA 4IJCA 1KR1A 3L5MA 1S46A 4AIEA 1S2VA 3MYOA 2C79A 1E5JA 4G2DA 3W2MA 2OVLA 3SURA 2J7DA 2C6QA 1AW5A 5G1YA 1A0DA 4LS0A 2C28A 3V36A 1ZLPA 1RH9A 2XG9A 3TN4A 5DT7A 2QYGA 2VCCA 4JUZA 4RW5A 1XSKA 4W7VA 3UNDA 5DQPA 1KD0A 4FBTA 5LGZA 1ODUA 3EB3A 1ZZMA 2HK0A 2IA6A 4E2BA 4LPCA 1UJPA 1WKEA 2E40A 4V2XA 4B3KA 3EWDA 3VD5A 2ZA3A 3WNOA 5L1KA 2ABBA 3VGDA 2R82A 3WBXA 3GE7A 3LSCA 3BMWA 1YDOA 3BQ1A 2J74A 4A8RA 4TQSA 4H8VA 1UHVA 3BANA 2Z1SA 4PB5A 1V3JA 3VMOA 4PMQA 3WF4A 1HJQA 3L4UA 4E3TA 4WRHA 3TQVA 1EJXC 1QU4A 4YYFA 2OYMA 1ICQA 3G8RA 1YNPA 4B90A 3ICJA 4F4WA 4ZGYA 3GS6A 4O17A 1OT2A 4NJHA 3T9PA 4HTYA 3M7WA 5KG1A 1FWAC 3D46A 3REQA 3P0WA 4UTUA 3GZAA 1IXNA 1HTIA 1SFJA 2NQHA 2GOUA 4L5ZA 5EMMA 2TMDA 6CGTA 3L2MA 3KDNA 1VGAA 1N82A 4Z42C 3TP4A 1ZRQA 2CKSA 3ZMRA 1XV8A 2PRMA 4QWEA 4MB4A 5DMLA 2PLCA 1SFTA 1J11A 1M6JA 1BYDA 4G7EA 2EXOA 5C9UA 4DI8A 4XD5A 1IEQA 5I07A 1XYCA 1V0MA 4JTLA 4EPEC 4DUXA 2V3FA 3E9AA 3PS7A 3M43A 4F40A 3B8IA 1VBGA 3K4AA 3GDLA 4RE4A 2PDGA 2XFWA 3FSTA 2DY3A 2P76A 3NXFA 4AVOA 1Q7ZA 4TXEA 1SMAA 3M0MA 1KRBC 1MFVA 1E15A 1AW2A 4NKCA 4RV3A 3WLKX 1OGSA 4ZBCA 3TU9A 3W1MA 3QR1A 3R7MA 4ML9A 4X0VA 2J7GA 3RR1A 3RMEA 2NUXA 3Q8PB 4DZAA 2XYLA 3KHHA 1MWOA 4NXSA 4N9BA 1DTUA 1SGJA 4GGHA 4IIFA 2XIBA 1R7AA 1FCBA 5J5DA 5BNKA 3W02A 2X05A 2AAMA 4L1XA 1N55A 2INFA 3WD1A 4TTGA 2WV8A 2R8WA 2GK1B 5KFZA 4JV1A 2UVVA 2NX1A 1AQMA 5FL0A 3VC5A 3AHTA 3TSMA 5D32A 2D24A 3MUIA 2QV4A 1VRDA 3KRBA 6TIMA 4NG3A 3RCYA 3MA8A 4FLQA 1W1B1 5EBUA 2H8ZA 3GU2A 1PPIA 1RA0A 4IL0A 3LQLA 2BWGA 3W01A 3SB0A 1R9YA 3CIXA 3U8GA 3T0BA 2W9CA 1Q5MA 4DO7A 4UCFA 2G3IA 4B5XA 4ECQA 4U3CA 3MP3A 3NVDA 4Y9NA 1JZ2A 3GYEA 5DQIA 2GQAA 3LXAA 4U2YA 1DIDA 4O8RA 3C4UA 2E8ZA 3EX3A 4V33A 3EOLA 1JGIA 1JFHA 1KCKA 3LBOA 2GJXB 3ZLFA 1VB9A 3BGAA 4DEZA 4AD4A 2NLIA 5L9FA 4PMDA 3PW2A 3R0DA 2E5BA 4C1NA 1FP9A 1UA3A 1KA9F 4ZR8A 4ZOBA 3TTEA 1Q6QA 2WTFA 5DG9A 4M1BA 2FTYA 1ZQ5A 3B0PA 2AL1A 2XIIA 3P6LA 1TUXA 4HMDA 5KINA 1G4EA 1OK6A 5E5CA 4JAWA 4DBSA 2V63A 2I56A 2OLAA 2VYOA 4FLSA 4GHRA 1N2VA 1VEOA 3FSUA 3RX4A 4LAMA 3PUOA 3VOJA 3N9RA 3VIHA 3A22A 2QJNA 4PUEA 4IMEA 1XRFA 4CCZA 3OPSA 2ATMA 2QCMA 4H9UA 4DWSC 3EXTA 5EWFA 5REQA 3G0UA 4GI8A 3R8HA 3LCFA 4ATWA 1WKDA 4G9PA 4U28A 4HNUA 2Y6ZA 2XIQA 4IICA 4UC5A 1AUSL 2D1ZA 2XN2A 4XTIA 5DRIA 5KG4A 3E1F1 1QO2A 2AKMA 4FI4A 4I9TA 4CQDA 4QHRA 1UZDA 2AQ4A 1XDLA 4D72A 4K3ZA 3WQGA 1OFOA 4FS2A 3WIJA 5BCAA 4JX4A 5HWJA 3NIYA 4NI3A 4F2BA 1K4GA 3AMCA 3AYRA 1ZJHA 3KS6A 1VHNA 2NW0A 3MZ2A 5KFPA 4XUGA 4KESA 1EXPA 1XPYA 2ZUTA 3BICA 5A8OA 5LNWA 4HOXA 1T94A 4CD4A 3RXZA 4I7UA 2ZA1A 4CD8A 7REQB 1NWSA 4R33A 4LB4A 2WO5A 1MQQA 2DV0A 3D3AA 3GQCA 4K1WA 2RAGA 4QTGA 1V02A 2NQ5A 4HSHA 1S5NA 4P8XA 2FIQA 2J62A 1LCOA 1IEVA 3N2CA 3MPGA 2WVUA 3ZQ9A 1V6TA 1YTEA 3PJXA 4HNTA 2CHOA 3CQKA 3E0FA 1OHLA 2MUCA 2E9LA 1IWBA 3LS9A 1FH8A 4KFOA 1BYAA 5FSDC 4LUTA 3UVIA 2WLZA 4GYFA 3MHFA 3VDAA 1EOKA 2D2GA 1UWQA 3G2GA 3W7QA 3K30A 1CENA 3PPCA 1MXDA 1T96A 2ON3A 2IKJA 2UY5A 4IPPA 1IQ8A 2FJKA 5A69A 2ZWZA 5HMSA 1IIGA 3OHMB 4F79A 2DU2A 1W5MA 1XYAA 4HZ6A 3UR7A 3UYCA 1ZGDA 2DZBA 1SFLA 2R1LA 5KFRA 2QJHA 2FPVA 1XLAA 3PB0A 1GGOA 4C7FA 5JH2A 2YA0A 4IWWA 4LQ1A 3MCOA 1LQ0A 1R6WA 4DPPA 2IKGA 1HFBA 1HKIA 3UVAA 2YL9A 4Z2HA 3CH0A 2G95A 3L5LA 1NJJA 3LCLA 4GG9A 1F2JA 2WAGA 3WYZA 1GKPA 5DCBA 3CAWA 2ALDA 3COTA 3M07A 2OKTA 4PL2A 1PDYA 2WM1A 5CLTA 3FYOA 4Z0SA 3AHYA 4GNJA 1TCDA 4WF7A 3RRXA 2DEPA 3PBMA 5KFUA 4UZSA 3U0HA 1BF2A 2E9MA 3QEZA 2TRSA 3POHA 3S1XA 2P53A 3N13A 3USZA 1PZ2A 3VIIA 1JZ3A 2D3LA 5E93A 2QJIA 2XCAA 3Q2DA 1XINA 2Y85A 4NF7A 3CLMA 5LXEA 1KCZA 4LH8A 2JF6A 1ZETA 4BQ2A 5KZDA 3OVRA 4PEEA 1FDYA 1CPUA 2YFOA 2CW6A 3L65A 2YLLA 2VQTA 4B92A 3QLLA 1ECQA 2DPIA 3DYMA 3PVFA 4NP7A 3FEMA 1I0DA 1NWUA 1XC6A 2ZICA 3WEMA 2G97A 1CYGA 2AU0A 1HP4A 1LOQA 3MJYA 1XC4A 3E2SA 4TUFA 4UR7A 1B4EA 3WNLA 3VMNA 3PJWA 5FEXA 1DPMA 1LLOA 2QDHA 3VNYA 5JIWA 4FR6A 4YYCA 4O15A 3FVDA 2C19A 1XLJA 3RAXA 1HVQA 1S3HA 1UD4A 1DJZA 3UXDA 3SY8A 1BWKA 4JDBA 2ZUUA 1K8CA 1LBFA 3NQMA 3V4BA 4JTFA 1R47A 2JEPA 2TYSA 1TUFA 3V6KA 3LHWA 1UIPA 2IQ0A 1UWUA 3FOKA 3AZTA 1RVKA 3I65A 2PA6A 5HK4A 4BQ4A 4HSNA 3A9IA 5LXXA 3PZNA 2PDCA 3GTXA 2O92A 3RILA 5SWUA 2BS9A 1K9FA 2HPIA 4G1NA 3TXVA 1IEWA 3PBUA 2J4GA 2UWFA 5CJMA 2X09A 3OA3A 5EWGA 1TJPA 3CIVA 3QJAA 1FHLA 1OF8A 4KFPA 3RB4A 1XG4A 5KFYA 2UY4A 5A6JA 3C3NA 1V6WA 1I8JA 2V5CA 4RNHA 5KFNA 2PBGA 3KRSA 4JKKA 3AYTA 3VK5A 2KAUC 2G37A 4FX7A 3UXKA 1N8WA 1XD0A 3W53A 3REQB 1QNOA 3SSZA 2GUBA 4I90A 4I7WA 1K70A 2PU0A 1BTMA 4C6OA 3VD4A 2EPHA 3GFYA 3WMBA 5KG2A 1KFEA 2WMIA 1XGEA 3MV01 3CEUA 3ITOA 2W5FA 1KXQA 3GU9A 1ZP4A 2GGJA 1RPXA 5ECUA 4KCVA 1X6LA 4AHOA 3TYZA 3QV6A 4TR9A 3SW6A 3VILA 5H91A 1GVIA 3PFMA 3WQ5A 2IKHA 2ZZ4A 2J7FA 4Z2GA 3HQNA 3CTLA 1V03A 2VNCA 3H2MA 5FCZA 3ZWTA 1ZAIA 1CWYA 3GY1A 5BXTA 2UVWA 1J0YA 2IPGA 4PTMA 2ZTKA 2V5LA 1X96A 2FMNA 3QFWA 3AIQA 4Y8EA 2OLSA 3VX0A 1S2TA 4PE8A 2WKJA 3PWGA 4ECUA 1SZGA 4RNOA 1IXPA 2XTKA 4TV5A 1F3EA 4FMVA 3QR3A 1UR2A 4ED1A 1GQIA 4W85A 3SCQA 4OT7A 4Y6GA 2XDFA 3B8UA 3IUIA 1VJIA 2PRHA 1NWRA 3CAKA 4JXCA 2VGBA 1ZBWA 4BWLA 2W66A 2PTYA 1DWIM 4DWSA 5K3VA 3W25A 3ARWA 4FAMA 1BRLB 4IRKA 2PRLA 3AMKA 2ZDSA 3SI8A 4YL2A 2Q8LA 1P4CA 3KVKA 2A79A 4S3GA 1PO9A 3O15A 3A4XA 1GOMA 5KFBA 1EGVA 4AZCA 5I02A 3NQAA 5FF7A 3MUCA 3NO3A 2BY2A 5I78A 2JKPA 4AF0A 4PMJA 3VKAA 4HPNA 2W9CB 3W6MA 5LZLA 3SGZA 3W7JA 2BSLA 2INEA 4GIRA 4XBJA 3M6DA 4I6VA 3W7NA 1G01A 2Z6JA 4IX0A 3PZGA 4IR9A 1K77A 4F8XA 4GUFA 2J66A 3CMFA 2WNQA 4RW3A 3DH7A 4YLWA 4IGHA 1UR9A 1P43A 3BAYA 4DJFA 4S23A 3GV5B 3TAOA 1WOAA 3OJGA 3C86A 1TWWA 1TV3A 5CZTA 4H9VA 4Y9PA 5IM51 3BZGA 4FX8A 4QWDA 4WJEA 1E3XA 2IPJA 1EUNA 2R6OA 4Z08A 1O5XA 3APTA 1T0OA 3GVWA 3KOXA 4X2RA 2V3GA 4H2CA 1BG4A 3GH5A 1XBZA 4K37A 1EX1A 2NVAA 4HN8A 4NNBA 5A8MA 4ACYA 4LC8A 1FTXA 3PJTA 2CXGA 2V5DA 4Y7EA 3UR5A 4HZ8A 3BW2A 5REQB 1L2QA 1H09A 3VAVA 3I3BA 4CQBA 3TXZA 1KLZA 2PDFA 2ZZ3A 3IV3A 2VC9A 1E71M 3QTGA 1DXFA 3S5SA 2XVNA 2ZX5A 3B04A 3VDCA 5HPCA 1EJSC 1WDSA 3KWSA 2BVYA 1G6CA 3UBPC 4GC3A 4QXIA 3AJ7A 4GJJA 3T2PA 1MEHA 2Q02A 5HQMA 1GKQA 3VNKA 4G56A 3FN9A 1A3HA 5LHEA 5A1AA 3FA4A 4L64A 2NXHA 1H49A 1VPYA 1GEQA 1JDCA 5M5DA 1X1OA 5D9MA 2HVNA 4ZXLA 1TJ2A 5AC7A 3KOFA 4XISA 3OSNA 1NOWA 3DBNA 5TAOA 2BY3A 3APGA 4L65A 4HTBA 4W88A 1SMDA 3LM3A 1OQFA 4S3KA 3B8WA 1NH6A 3NNTA 4IISA 2PODA 4MSSA 5I3DA 3AALA 1YYAA 3BAJA 2EG8A 3GBDA 4D1IA 3KZPA 2ZUSA 4BF5A 4Q32A 3U3HA 4PUKA 3KVLA 4KRZA 4J9SA 4F50A 1XFBA 2ZRYA 4RNJA 5C54A 1U1JA 2CLPA 1K8XA 2PDUA 5AC6A 1S5VA 3T40A 5C0QA 2V2CA 4Y9OA 1CZ1A 4LUTB 2BY1A 3BLOA 3HGSA 1HJUA 3A4WA 2V5BA 4JHZA 1W91A 4AMCA 5CZSA 5KFTA 3GXMA 3ITGA 3P81A 4WQ6A 3KX6A 4ONVA 2OEMA 4XO7A 4MJ4A 4N6FA 3LYEA 3UZXA 1E0TA 4K68A 1B3VA 3DX5A 3H4WA 3EXRA 3ABOA 4LVGA 8RUCA 3W7GA 1X38A 2INZA 2ZQ0A 2Z1VA 1ZHAA 1MQPA 4GIAA 1M04A 5E9XA 1SPQA 1JPHA 2GSJA 1E9LA 3WQVA 2ZC1A 4QAWA 3TYEA 4DXKA 4ECVA 2FZ8A 3JVAA 1J79A 4JTKA 3CQ0A 3BO9A 1ONWA 4I8DA 4GINA 1W37A 4HA1A 4IFKA 3PR2A 5D2WA 3NZPA 3QC3A 2O7QA 4PUUA 2QF8A 5HANA 2VM8A 4J3TA 1HGWA 3G6VA 4ED0A 1GOIA 2D2HA 4D6IA 2DORA 3VGBA 1BWVA 4WDTA 4QEHA 3EPMA 1A49A 1M41A 3SN1A 4WDWA 4GPNA 3NURA 4HKPA 3R10A 2GUUA 4AZ6A 4B5UA 4IFRA 2FVKA 3WFLA 1RALA 3GXTA 1WDWA 4UBPC 3MCMA 1YXYA 3LXCA 5KFKA 5KT2A 1VYPX 4GMEA 1TYGA 1S2UA 2NT1A 4KWSA 2C2EA 2NQJA 4PODA 2W63A 1XP3A 4GXPA 3G1RA 4PCNA 4CNOA 3BXWA 4J9KA 3KRZA 2CLEA 1QNQA 4L56A 3LGGA 2R8IA 4HZMA 4RV8A 2FB3A 4OHQA 5GQBA 5HJXA 2EAWA 2C14A 2QCHA 1KM6A 1SZNA 3TDFA 1G4TA 3SGUA 1XXXA 4AW7A 4Q4PA 3M9MB 3KWXA 3YPIA 4AD3A 1QATA 1NOUA 1EC9A 3FHQA 3ANYA 2VEFA 3UYIA 4XD6A 1D3CA 4L9YA 4H6RA 2QF7A 1V02E 3CT2A 3ITVA 4DL7A 1BSIA 4D6JA 2JIEA 2EPMX 2PWDA 1V6YA 2CZFA 4O50A 3W2LA 4MMWA 4XO6A 1EDQA 1Q6DA 4WXZA 3UPBA 2ACUA 4O14A 3VGEA 3C6CA 4LCRA 2I9EA 3UWZA 2BBFA 1WO2A 5AHNA 1PTDA 2RHGA 1LOSA 2OQHA 3BG9A 3PTMA 1OX5A 3IRDA 2VUNA 1US3A 4EKJA 1I9CB 1T7LA 4H1ZA 1IT8A 2YOCA 4H04A 4JYFA 3M7SA 3VXGA 4M6PA 1JD9A 1GKRA 3CUXA 3CQHA 2BXZA 4B91A 2Q71A 3EB2A 4Y9AA 4M0XA 1F4AA 2EJAA 3AJXA 4DUOA 3F1QA 4AISA 2R8GA 5DX7A 4M82A 4QSFA 3T2OA 1S1RA 4PMNA 4EYHB 1FWEC 1LL7A 3W1PA 2GDVA 1UPPA 2A5HA 4JIPA 1OCNA 4RJEA 4NY2A 3STGA 3VNZA 4O3PA 3MSGA 5CPTA 4XAYA 1GNXA 3W2KA 4M80A 5KG3A 3AIWA 4A3YA 5DN1A 4LOCA 1H7RA 4M51A 1UP3A 1QI5A 4UFJA 4EWND 1XIDA 1UKTA 1A5OC 1OFPA 2PDNA 1HJWA 4Z2IA 1VS1A 3VDGA 4IRDA 2WMIB 3S47A 3S6DA 1GZ1A 1RD5A 3N2XA 4A2SA 4AVNA 1V7AA 3SN4A 2GOKA 1V3MA 3A12A 4HP5A 4R8UA 3WBAA 4AYGA 2CCRA 4EF8A 1Y8BA 1TPWA 3FKRA 3B0VC 1F6KA 3MR2A 4XD4A 5HINA 3E02A 2XGQA 3AIRA 2W6RA 1I1XA 2HE5A 3B8TA 2VRQA 3GGMA 1AODA 4R53A 3TNOA 2I5IA 3EDKA 5L1LA 3PZTA 2PP1A 3LZ5A 1HKWA 3WDHA 3LNPA 2Y89A 3TSDA 1FWTA 3BLEA 3MBDA 1V77A 1BEUA 3T44A 1TTQA 2Z7GA 2J8TA 2ZE0A 1WBHA 3HBLA 5FJPA 4LRTA 3RB3A 3PFRA 4L4OA 1S5MA 1MI3A 2F6KA 3WY1A 3OHIA 1J6PA 1E5NA 3Q94A 1XF0A 1SSGA 1W1TA 2HROA 3WF3A 3TWBA 5MKGA 1KRAC 4OFCA 4C6IA 2JEFA 3S6TA 4UUIA 1A5SA 4TV6A 1ZFJA 2ATLA 2JE8A 1MW3A 1DKWA 3CMJA 3BL3A 2VDHA 2FTPA 3V6HA 4UQDA 4AZCB 4OECA 1RBAA 2QJMA 1BQCA 3MWCA 3OEXA 4AF0B 3PVXA 2W4XA 3S8HA 2D69A 2J47A 4K1GA 1OX6A 2PTDA 3D0CA 1J0KA 2E0PA 4JTRA 2G5WA 4C1KA 3UJ2A 1E0VA 3TA6A 3G1AA 1VKFA 2J7HA 1W8SA 5HULA 2XFRA 5HMFA 1RK6A 1WXYA 3RHGA 3HJZA 4W5UA 1KO0A 4LNCA 1WOBA 3ZJ8A 1A47A 3ME3A 3BCFA 1RJPA 5T91A 5CCZA 2W8LA 1UWSA 4J9PA 2C1IA 3VUSA 4WK9A 4NJKA 4TIMA 1JG9A 4C6FA 3IGHX 7XIMA 1K1QA 3B8DA 1CB7B 3XINA 1ZTVA 1JYXA 1O1ZA 5CBBA 2CETA 3SBFA 3CUJA 2CYGA 2HXUA 2J79A 4Q33A 1R3YA 5A8NA 5AYBA 1OX4A 4MB1A 3V1PA 2PWEA 3RM9A 2NV1A 5AHMA 5KFOA 4DX3A 5LIXX 4ECRA 2Z1WA 2ALZA 4BQ3A 4PTWA 5CQ1A 4LX4A 4U3AA 2RDJA 4JCMA 3MKVA 2PC4A 3N9SA 1KBLA 3B0XA 3T7VA 2A3LA 1X7FA 4GVHA 4M81A 1WDPA 3CNYA 1V79A 1E43A 1R86A 4OV4A 2JGQA 4A8IA 3RUBL 3VDBA 3B3DA 1A5BA 3QY6A 3K4WA 5AECA 3MFIA 3ANUA 5JBDA 5FEWA 2VGFA 4QX4A 2E09A 3UG8A 5HDRA 3U2CA 3UU0A 5HA7A 1G4PA 2OZ0A 1CXFA 5E6YA 4O54A 1GVRA 4P7RA 2O55A 3ZLGA 4N4PA 1UOKA 1VR6A 3V0SA 5HQLA 5J04A 3HGRA 1ZS2A 4KWVA 3AC0A 5IOBA 2CXEA 2EF9A 2C91A 2X0YA 4L7ZA 5DBTA 3PC0A 3WF1A 2PP3A 1UOZA 3GHTA 3MSYA 3UZYA 3VZZA 1QASA 3GILA 4AZGA 5FJUA 3HTWA 4Q8PA 3VD7A 1UWRA 3IK2A 3VNIA 3FYPA 1SO6A 2DZAA 2VRJA 2YPIA 3RM8A 1O5KA 3IPWA 1K7XA 3VO0A 4AEOA 1SZRA 4YTUA 2C1GA 1KV8A 2BOEX 4RNIA 3EMCA 3PAOA 4AAJA 3VCRA 1XX1A 1D7FA 4GLEA 2I1OA 1Y0EA 3RB0A 1D3GA 3VDHA 3MQTA 1QHZA 2NV2A 4JEJA 2DZWA 4W8LA 4JKLA 2E6YA 3WFAA 4BI5A 4PSRA 1GWJA 3EEZA 4F66A 4CEUC 3DKJA 4I6KA 3FDKA 4EACA 4NQ1A 3W3OA 5DLFA 5T14A 4IQLA 2CBVA 4OTKA 3RF9A 1EYEA 2WVVB 3BVJA 3LLFA 4QEEA 4R9XA 4H7VA 2VC5A 5DBUA 1QOXA 3E0LA 3DGRA 1AG1O 1ME8A 2QUVA 5F4SA 8XIMA 2EPOA 4UTMA 4H8HA 2BGNE 4IFKB 3NL2A 3G1XA 2NX9A 3LGDA 4UTTC 4OZOA 4GYPC 3S2CA 3EKZA 3U7VA 1TPC1 2I57A 4CD5A 4LUSA 1RVGA 1M03A 1E9ZB 4PN2A 1WXZA 1R9ZA 2H3BA 2QCDA 4GNVA 2A3HA 3ONBA 2ISSA 3G77A 4HN4A 3V3WA 3DYOA 1P7TB 1OVDA 1AQ0A 2CWXA 1S1PA 1LF1A 4WJ8A 4NZFA 2Y7GA 4YN5A 3R12A 5HUOA 3GRIA 3FJ6A 2QDEA 3AMGA 4LYQA 2GSEA 2QPSA 5CC7A 4IPIA 3SGGA 5I2UA 3ALGA 1O95A 4O3NA 3HF3A 1LDCA 2A7RA 3FJLA 3HPXA 2G3FA 3Q8SB 1B3WA 3GDBA 3QQ0A 4JNYA 4P7QA 1ITUA 3A3WA 5DQGA 3MUXA 5EPDA 4UNKA 1PEZA 3TW9A 3WEOA 3LN3A 2F9RA 3CWHA 3HN3A 4JTHA 4EBEA 1NDZA 3G18A 1H7WA 3I6EA 4PSPA 1EJVC 1Q6CA 1ZJBA 1PKMA 1P6CA 3P2VA 1KKOA 4Z17A 4E8CA 2G3MA 5HPOA 1KFKA 2IS7A 5CXPA 5BXRA 2Z7KA 4O52A 2OH2A 4ED6A 3LDVA 1IYXA 2EPLX 4JX6A 1EGZA 5I3JA 5CSUA 4EVZA 1V3LA 2YA2A 1S2AA 4H9YA 2ZOXA 3HQPA 3LBMA 4TX6A 5D38A 1QNRA 1RD6A 3M5XA 3URNA 3UT0A 3AYVA 1PHQA 5AN7A 2QIIA 3QMSA 5I00A 3WQDA 4ZODA 3KLKA 3O0FA 3C61A 3OU8A 1LG1A 3IIOA 2PS2A 1TV2A 3IK4A 3O63A 5AZ1A 3SCPA 3ABZA 1H7XA 1M68A 1FWCC 2ZIDA 4PTVA 1UPMB 4NJGA 3VFLA 2JEGA 1AJ0A 1QHOA 1SU5A 2EG7A 2ZX8A 3CC1A 2QXWA 4PEKA 3W26A 3DFYA 4V1XA 4PL1A 3WMLA 4FB7A 2OWCA 1VEPA 4XSMA 4NNAA 4Q8EA 4K8EA 2ICSA 2I17A 1G4SA 4M24A 3B0UX 1QT1A 4QS6A 4V28A 2WK2A 2WHLA 2W91A 3WBEA 4O3OA 3GTHA 1G67A 2QR6A 2FB2A 4XZMX 1FWHC 1QHPA 1BXCA 5A6LA 4ED3A 3THCA 5HOSA 1Q66A 1VIZA 4EBDA 2AOSA 3ITXA 1Z48A 5BRQA 3G24A 2IW0A 3MBFA 2VZOA 3TIMA 4HJFA 2CIPA 3U5YA 3STEA 1BKHA 4PMXA 1E3ZA 2HQAA 2G8ZA 4PCSA 1UR1A 2Y5JA 4I9JA 4UFIA 1HKVA 2R1KA 3M9YA 4DUVA 1YADA 1IGWA 4IMFA 3OZYA 4O4WA 3WNKA 2WZMA 4RE2A 3SCWA 3FFSA 3FA5A 3LGEA 4AUBA 3T5LA 1AK5A 3BLDA 3QZ8A 3G0SA 2ZZ2A 1L0PA 3DAQA 3NM3A 2Y24A 4CN1A 3TN3A 1QNSA 2BTMA 4H9MA 1W3LA 1UKSA 3DDMA 5KFJA 1IEXA 3QHNA 3NQCA 5M17A 3H53A 3S0CA 2HBXA 4AG0A 6REQA 1JYVA 2W8KA 1XLDA 1F05A 3VKJA 4GVGA 4AIBA 1VENA 1VIWA 1QTWA 2POZA 2HS8A 4RUCA 4CLMA 2ZC8A 4IIBA 4HMCA 3RAOA 3R79A 3TW6A 3AIUA 2XFFA 1TWZA 3C0LA 1RHCA 3AXXA 5TQLA 2VR2A 1BVZA 4JIIX 4E8DA 1L8NA 1VFLA 2C7FA 3TUUA 3L68A 4WZHA 3EEGA 3NJ3A 5MKGB 3G6YA 4A8LA 3ZJKA 3QFEA 3T09A 1C7TA 3LU2A 2ZXAA 1TE6A 3O05A 4A35A 3AXIA 4P7OA 3RJXA 3LBCA 1K8ZA 4MY8A 3MO7A 2ZZ6A 2GJNA 2D2OA 1M7JA 3DERA 1V0LA 4QR6A 2OYKA 1BVNP 1YPXA 2V2DA 4IPLA 4GD0A 2FDSA 1L6SA 3BAKA 3O2LA 3U2EA 1HL2A 4R27A 2R8KA 4DLMA 2IBKA 4HQVA 2YCEA 1W9DM 3PWIA 4KT2A 2OEJA 3EPOA 3CMGA 2IMWP 3G3DA 2EBNA 2J9ZA 3S5NA 2GWNA 1PIGA 2GGIA 2Q8ZA 3FS2A 3PPFA 1Z3NA 2WKGA 2Q8XA 1FP8A 2WLYA 2X16A 3RU6A 1CLVA 1I2QA 1X39A 2HV5A 3AS1A 4QS5A 3ECQA 1E6RA 3RB6A 4JQ2A 1WUFA 3E3HA 4ZQNA 3MP4A 3TOPA 2C13A 4GZIA 3SFWA 3DUGA 3F2BA 1PWMA 3O7UA 1OX4B 3VOHA 3IANA 1VC4A 4NRSA 3KE0A 2VA3A 4ZZ9A 2DT1A 2ABAA 3GUWA 3P67A 3FJNA 1P0DA 4C65A 2ZX6A 1K6AA 2PDXA 1PX4A 2NWRA 3FAXA 3V75A 1M53A 1US0A 5T8GA 1T99A 4GY0A 4IR1A 1KFJA 4WEVX 4U10A 1GHRA 1PDZA 1E6PA 2IQTA 4HK7A 4C7DA 2DP3A 4MVAA 1XDMA 3NQGA 1Q7QA 1R3TA 4FALA 4CNPA 4F4YA 3WLJA 3Q67A 3GNOA 4MGGA 4DY1A 4B3ZA 5CG0A 3KHLA 4QJ4B 1J2WA 1XH2A 4F4RA 1ZB5A 2WNNA 4J3XA 3UR2A 2CLFA 1WP6A 1EO5A 3DG6A 5JU6A 4HPHA 5L1JA 4IIGA 4O1CA 1NP0A 3W74A 4YTQA 3CLWA 1WAUA 3CBWA 3LPOA 4LSBA 4ZO6A 1H5YA 1DQXA 1W5OA 1VZWA 2PDIA 4QNWA 2W61A 2HVMA 1TWIA 3A3XA 2HBVA 2OYLA 3FV9A 2CLLA 3O6AA 1OC7A 4I8YA 1UH2A 1NAL1 1CDGA 3PR4A 2B31A 2OJPA 3M0YA 5CPLA 1L6GA 4FP1A 3QV8A 1W3JA 4JBRA 2FHFA 3UETA 3NSNA 4Q4KA 1EP1A 1F61A 1TTPA 2NQLA 1W3HA 2F2KA 3GG8A 2DZPA 5KFIA 3V7PA 1HIZA 4U5KA 2HJPA 3VIFA 3R25A 2JK2A 5DCDA 4TQTA 3NZGA 4DHGA 3GKAA 2PCQA 3N34A 3GW3A 4PB4A 4QLLA 1W9PA 2A1YA 3B4YA 2QW5A 2X1IA 1VJSA 3KOWA 1TV5A 3W1TA 4J7RA 2DQWA 3MW7A 3SI9A 4R34A 3OIXA 2GYIA 3WQFA 4M6VA 4PTXA 4P8UA 1H11A 3TC6A 5JUVA 1BPLB 1J0ZA 4HOZA 1ISYA 7ODCA 1FWIC 3PANA 3UWYA 3MMDA 3GIKA 4FR1A 4NVTA 2OGYA 4AHQA 5CPSA 2ODOA 4EK7A 3QKZA 3WJYA 1QNPA 4FS1A 5FF0A 5HMEA 3TCEA 4J9RA 1S2WA 1XICA 1UWIA 1EEXA 1W5QA 4GX8A 4FLRA 1W1ZA 4PBGA 4NNCA 4PFHA 2A3EA 1H0GA 3VNJA 5JMUA 2AGOA 4JS3A 3MHUA 1KGWA 4QE4A 4UNLA 4EXQA 4YCPA 4R7WA 2Q09A 3B40A 5LNVA 3WNNA 4ED7A 4DWSD 4KETA 4NT0A 2VA2A 1PZ1A 3R4IA 1YW1A 2BQUA 4I9MA 2ZE3A 1EO7A 2QCDB 1H60A 3RJYA 5JUMA 2VEIA 2REQA 1ODZA 1YNYA 3HGJA