1YRRA

Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
382
structure length
381
Chain Sequence
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVKKTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylglucosamine-6-phosphate deacetylase
publication title Structural analysis of N-acetylglucosamine-6-phosphate deacetylase apoenzyme from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 130
structure length 381
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.5.1.25: N-acetylglucosamine-6-phosphate deacetylase.
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1yrrA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1yrrA02
3F4DA 1POKA 3A4JA 2BB0A 1ADDA 2AQOA 3PAOA 1EJXC 3AUOA 2FTWA 2OOFA 2Z24A 3MJMA 4BKNA 2HPIA 4KESA 3IV8A 3MDWA 3ITCA 3IACA 1J79A 4RE0A 3WMLA 5HMFA 3UBPC 4XAFA 2EG6A 1EJSC 2RAGA 4C6NA 3B40A 3TN4A 3OJGA 1PB0A 1RJPA 2E1WA 1WXYA 1M65A 3EGJA 2Z27A 4C5ZA 1ITUA 3UPMA 4IFKA 2HBXA 4H9MA 4B92A 4R7WA 1KRAC 3URNA 2O4QA 4GYFA 4KQNA 1EF2A 4DI9A 2Z7GA 3IJ6A 4G7EB 4Z42C 3T81A 2PAJA 2Z00A 1WXZA 2QPXA 4LCSA 3WYZA 3MDUA 1XRFA 2Q01A 4G2DA 3LGGA 4LCRA 2W9MA 3LNPA 1IE7C 4IFKB 2R1KA 4C6LA 2PGRA 4C60A 4PE8A 2BGNE 4XD6A 1KRBC 1A5KC 4CEXC 3DCPA 4C6BA 3E0LA 5HMDA 5HMEA 4XAGA 3MKVA 3URQA 1A4MA 4GX9A 1V77A 5LXXA 4L9XA 1YNYA 5G4HC 4I6VA 4BJHA 1ONXA 4HK6A 2QT3A 3B0XA 4LH8A 4GY7A 4HA0A 2P50A 4HK7A 4F0RA 2CZVA 2R1MA 3PNUA 3K4WA 1K6WA 4J2MA 4CQDA 2A3LA 3OODA 1XRTA 3O7UA 4P5UA 3SO7A 3TN5A 2D2HA 4DIAA 4PBFA 4LAOA 2EG8A 3EWCA 1KCXA 2ADAA 2Z29A 3MVTA 3PANA 2P9BA 4XD5A 2YZ5A 2PLMA 3GTXA 3N2CA 3IRSA 4XAYA 1K1DA 1RJRA 4H9TA 2HPMA 1V4YA 2DVXA 2D2JA 4C6IA 1RJQA 3R0DA 4IG2B 4H00A 1FWAC 4GY1A 3TN3A 3B0YA 2HQAA 1EJUC 4I6KA 4CQCA 1V79A 3AU6A 5FSDC 1V51A 3A3WA 4QSFA 1PO9A 1UBPC 3DC8A 2R1LA 1A5OC 3GU2A 5AKQA 4B91A 2OODA 1RAKA 2WJEA 4BY3A 3K5XA 4WGXA 3AU2A 2YB4A 4CNSA 4C6DA 4CEUC 1S3TC 1EJWC 3QY6A 4H9UA 3GTIA 1UIOA 1QW7A 1DPMA 2ZC1A 2Z26A 4QS5A 4ERAA 2GWNA 1M68A 3MSRA 1R9YA 2GSEA 4ICMA 4G7EA 2VUNA 2EG7A 3UF9A 3S2MA 1YMYA 1YIXA 1NDYA 4IQJA 3S2LA 1HZYA 4LALA 5E5CA 1R9ZA 3TNBA 1YRRA 1A5NC 2YXOA 1XWYA 4DNMA 4PCNA 2YB1A 3OQEA 2WJDA 1ZZMA 4F0LA 4V1YA 4IFRA 3F4CA 1RA0A 4KEZA 2OQLA 4CNTA 2Z2AA 3GG7A 3F2BA 1E9YB 1YBQA 4LEFA 1FKXA 3D6NA 1KRMA 1W1IE 2D2GA 1P6BA 1KRCC 3OVGA 1QXLA 4LAMA 3MPGA 3LSBA 2KAUC 3HPAA 1FWDC 4ZSUA 2R1PA 3LY0A 4DLMA 4C6OA 1P1MA 2HBVA 4GK8A 4H9XA 4C6PA 3WZ0E 4EPKA 2G3FA 4C6FA 1FWHC 1YBQB 4OFCA 4C6JA 3G77A 2ANUA 3FDKA 1BF6A 3T1GA 2E25A 3ORWA 4NP7A 4ERIA 1J6PA 1A5LC 1GKPA 1I0DA 1GKQA 1A5MC 3S2JA 1E9ZB 2FTYA 1ITQA 4IGNA 3LA4A 4WHBA 4V1XA 4CQBA 4DZHA 1A4LA 3GGMA 1V7AA 3FEQA 3IGHX 4C65A 3KM8A 2DVUA 3V7PA 4KEVA 3QY7A 4DO7A 3NURA 4EPEC 4IG2A 4E3TA 4XD4A 4QRNA 3CAKA 2VC5A 3E0FA 4ZSTA 2I5GA 4QROA 3LGDA 4R88A 4UB9A 1JGMA 1GKRA 4PCPA 1NDWA 4XD3A 1I0BA 3SFWA 4IFOA 4C6EA 2PGFA 2F6KA 2O4MA 4IH3A 2AMXA 4L6DA 4PBEA 1EJTC 2GOKA 3MTWA 3S2NA 3RYSA 1FWIC 3HM7A 4XAZA 3O0FA 1RK6A 4ERGA 3GIQA 3IPWA 4TQTA 3URBA 2GZXA 4IF2A 4DZIA 3PNZA 4RDVA 2Z25A 4RZBA 1EZ2A 4KERA 3BE7A 4M51A 1POJA 4QTGA 3GTHA 4RDZA 2GWGA 4LAKA 1XGEA 3GU1A 2WJFA 4NG3A 3E2VA 1K70A 1R9XA 2OGJA 4H9ZA 1P6CA 1O5RA 3NEHA 4H01A 1FKWA 2I9UA 2VHLA 3OOQA 3S4TA 4EPDC 3LS9A 2Q09A 3E74A 3MVIA 1UMLA 2FVMA 4R85A 2FVKA 3OU8A 3GU9A 4GZ7A 3RHGA 4RDYA 4LFYA 2VR2A 4KF1A 2P53A 3K2GA 4J5NA 4C6MA 1RK5A 1UIPA 2ICSA 3LSCA 4KIRA 4IGMA 4NI8A 4GX8A 2AQVA 1FWJC 3QGAC 3C86A 2VM8A 3URAA 1PSCA 4GXWA 4JOMA 3RCMA 3UR2A 1RA5A 4J35A 4HK5A 3ISIX 3F2CA 1EYWA 4INFA 2QVNA 2FFIA 4LANA 3A3XA 3HTWA 4KETA 3GRIA 2UBPC 4HJWA 4C6QA 3QY8A 1FWBC 2UZ9A 3T8LA 3E38A 2IMRA 3F2DA 4GOAA 2XIOA 3CS2A 3GIPA 4WVXA 4H9VA 1ONWA 1FWGC 4AC7C 5FSEC 2Y1HA 4LCQA 4B90A 3GUWA 5A6TC 1EJVC 2WM1A 4B3ZA 4C6KA 2DVTA 2QS8A 1PTAA 2PUZA 2VC7A 4C6CA 2OB3A 3E3HA 1VFLA 3UR5A 4RDWA 1J6OA 4GC3A 2Z2BA 5CH9A 4DI8A 4MUPA 4GBDA 3GTFA 1NFGA 4C5YA 1J5SA 1FWCC 4DLFA 3ID7A 4EP8C 3TN6A 1NDVA 4DYKA 3JZEA 3PBMA 3QGKC 4YIWA 1M7JA 4GY0A 3EWDA 1EJRC 3DUGA 4AQLA 1FWFC 4F0SA 4EPBC 2Z28A 3CJPA 3RN6A 3ICJA 4H9YA 4QS6A 3FDGA 1O12A 4UBPC 3IARA 2HNHA 3LU2A 4CNUA 3NQBA 1FWEC 4KEUA 4D8LA 2Z4GA 2R1NA 1NDZA
chains in the Genus database with same CATH superfamily
2CNCA 4YL2A 3UNTA 5FI8A 4O15A 3IJDA 2Z1SA 5AFDA 4PA8A 3PR5B 5DF0A 4CD6A 4S3EA 3A24A 2Z24A 2ASJA 1TYGA 4HNOA 4TR9A 3GLCA 4ECZA 3OGRA 3BJTA 1YE6A 1VPXA 1OFBA 4UFLA 4E8GA 2VGGA 1FCBA 5I06A 5MHBA 4YR3A 1TV8A 3RDKA 1TTQA 3H24A 5GNYA 3T05A 2J66A 3W22A 3V5OA 5HQMA 1LQ0A 1MQPA 3RLUA 2J7HA 3NL2A 2FIQA 5M5DA 3VU2A 5DY3A 4J9QA 5AYBA 4BR1A 3B0UX 3MDUA 1XRFA 3Q67A 1QPOA 1W3LA 5D2YA 3BJFA 2FLNA 2DSVA 3UG5A 4P7OA 4MAVA 3L0NA 3T2OA 1JDAA 3TP4A 2R1KA 4LX4A 4E0CA 4C60A 3W37A 3AHTA 4KT2A 3TCEA 1JZ6A 1QHPA 4QQUA 2PWHA 3AI0A 5HMEA 4UOQA 5DCBA 4CU6A 5I79A 1W0MA 3B4UA 3SJNA 3IJIA 4R27A 3U2EA 4Z1DA 4ENLA 3MHFA 1QK2A 1Z89A 1WUEA 1QMLA 5C70A 4IPJA 3CUIA 4MSSA 3B0XA 4YS1A 3TYEA 4HU4A 3BG3A 4QG6A 5D37A 2WMGA 3PTMA 2VFFA 4TTUA 3O7UA 1JCJA 2ZA1A 3CYJA 3VIGA 4W84A 1S2AA 2HS6A 5FEPA 3TONA 4UOZA 1OYAA 5DLCA 4J3VA 4HSNA 3BLPX 3LXCA 1WDDA 3M9MB 1UA7A 3BICA 1BLIA 4P7RA 2XCAA 3VD5A 6ALDA 1PX3A 4AUBA 5K9CA 5FSDC 5D05A 4RNHA 4PL1A 3W1LA 2CZFA 4HJFA 2PDQA 1HVXA 4Z0JA 3TK7A 3NZGA 4RE4A 3GTIA 4A3YA 2CCRA 1E6PA 1KTBA 1S0OA 1XYZA 4KCUA 1E6QM 2YGYA 3NR0A 4YR0A 3DFOA 3CGTA 1TVLA 1ITXA 4G7EA 5FKYA 2DGAA 4MB4A 2VTFA 2RGLA 2HISA 1CPUA 1HZYA 3VX1A 1A5NC 3GG0A 1UZ4A 2W7OA 1DJHA 2WJDA 3DBPA 2OT1A 1SW7A 4IFRA 3ARTA 2YSWA 2INZA 1TMLA 2OQLA 2WHJA 4O18A 3SEPA 1OABA 1TO3A 2QUVA 2DUAA 2D2GA 1E5NA 1P0BA 4FOUA 1NTHA 1QXLA 5KFZA 1UUOA 1FWDC 1JDDA 5DMMA 2PWGA 1TWSA 4QDWA 4M81A 4PYSA 2PDWA 4GNKB 1PHQA 3S9YA 5T9BG 2DT3A 4RNNA 4W8LA 3FSUA 4HTYA 1R8LA 4XIAA 1XV8A 1OGSA 4JKKA 1PZ3A 3AO0A 2P0OA 4R7JA 5CSUA 1RY8A 1C29A 1E73M 2J25A 1P43A 8TIMA 4ASTA 1OFAA 4O12A 4NJHA 3PWGA 2PLCA 4WGHA 1ZJAA 1SSGA 4JNMA 4GO8A 5AHIA 3W1TA 3M9NB 2V82A 3C3UA 3R25A 2IBKA 3WN6A 1AD1A 3BQ5A 3WLPA 3GUGA 1XIFA 4DBEA 2WVVA 4LY4A 2X7VA 2YPIA 5HR7A 1B9BA 3PJUA 3LERA 4C6EA 5TBOA 3N4AA 2FB3A 3MMDA 1KQYA 3S2NA 1TV7A 3HBLA 3RXZA 3VMNA 2REQA 3ZM8A 1OX5A 2Z6JA 5EWGA 3CB3A 5D38A 5RUBA 4X61A 3IVTA 2WNWA 1C3FA 4HVXA 2CW6A 4JUZA 4TQSA 4XKYA 2DDXA 2R94A 4H8VA 3SBFA 3W2NA 2GWGA 4IICA 5DRCA 4U31A 3T0TA 3CUZA 3WQ5A 3RJYA 1KFLA 4H9ZA 2E6FA 3NUKA 4IHCA 3WH8A 3E0IA 3W7LA 3N14A 4DBUA 1UR2A 4EF8A 1ISXA 4B5UA 1J0HA 3C5QA 4UMBA 2OZ0A 4JTQA 4AYGA 4O0KA 1PYMA 4UTWC 1LWJA 3C2RA 3W6MA 4LF2A 1M7XA 4EX4A 1EP3A 1XHGA 1B5TA 1J4EA 1YYAA 4XBJA 1NF7A 4IJBA 2DEPA 3GIKA 3Q8SB 3T9PA 1VYPX 4L80A 4KIRA 3GHSA 4DJEC 5LIXX 3NL6A 4LOCA 3VD7A 4PFHA 2DQXA 3K4AA 3GC4A 3PJXA 5C2GA 3A22A 1C8VA 4MKSA 3G0SA 4Q8TA 5FD0A 1GOOA 4EXBA 3IIXA 5EFDA 4Z1YA 3W85A 3ZLGA 1GJWA 3SQLA 2HROA 2PODA 3HV9A 2F9RA 5A3HA 4JHMA 3OTRA 3RR4A 3NDOA 2UZ9A 3RCYA 3W1QA 1QK0A 3VC6A 1E9IA 4JIHA 3VI2A 1IXOA 3BAXA 3VFLA 4KH2A 3MZ2A 4O4WA 2WCGA 3WLIA 3ZR5A 1AQMA 4HOZA 3N2BA 4JD4A 1HW6A 4Q6JA 4RDWA 5DGBA 4IT1A 3SGGA 3BJYA 4N9EA 2Z2BA 2Z7KA 4WD0A 4W7VA 1R2TA 5B7ZA 2Y61A 1OF6A 3O15A 4NY2A 1AZ1A 1J5SA 1JDCA 1XF0A 3W26A 3BSHA 1UOKA 4DYKA 2E5CA 4DWSA 1RP9A 2W63A 4R8UB 1MQQA 3DUGA 1HJUA 4OE7A 3JUGA 1O12A 4UNKA 1UWSA 1VP5A 2AL1A 3CQKA 1WDQA 1XD1A 1R3SA 2VOTA 4BQ3A 3AMCA 5FL1A 2WKJA 2G41A 2Z4GA 1HKWA 4L56A 2PP1A 1YXYA 1JYVA 1POKA 3AYVA 1L6WA 4HMEA 1NM9A 4Z0SA 2BB0A 2EJAA 1XXXA 3PAOA 1EJXC 2ESCA 4BKNA 2JE8A 4KCTA 1NP2A 4WY0F 1WB0A 2XSBA 4Q7BA 2JEIA 3IGUA 5FACA 5KZEA 3EA3A 3P80A 2DT0A 1FOBA 4O28A 5DRIA 1ZENA 4MB5A 2F84A 5ABTA 4JTAA 4R3UA 3CIVA 4WJ8A 3WMCA 2E6AA 2WC3A 2ZZ3A 2CLPA 2F2HA 3FAWA 4MB1A 4RUAA 4FOKA 1H50A 3SQMA 3LCGA 4DJFC 3VDAA 1QPNA 4GQ0A 5KFAA 4K6AA 4QFUA 1TREA 3MUY1 5KG4A 4G6CA 1EPXA 4PC8A 4BI5A 4GUJA 3DCPA 3S47A 4O50A 3KXQA 1JNEA 3IWPA 2V5LA 4IUGA 1QPRA 3TJLA 2XTKA 4IIDA 3F5JA 4AY7A 2PS2A 1US2A 3CLWA 3IJ9A 3E02A 4JYDA 1WKYA 4O4VA 5T91A 3RRXA 1H1ZA 1ZSXA 4EBDA 4O17A 2J9ZA 1CI1A 2O7QA 4LU0A 5KETA 5E70A 2C0AA 3CTLA 2Z29A 2J8TA 2DZPA 3KOFA 4AHQA 5IHSA 4XAYA 3GDKA 3IJQA 1DTNA 2VURA 4HB7A 1U2YA 3CTTA 2VP8A 3H23A 4Y90A 3OIHA 4NILA 1OCNA 4DXXA 1RCXB 4J3TA 3KRBA 3R13A 2X2YA 4WCJA 1VFOA 1EOMA 1GW1A 1ZFJA 1OT2A 4WGXA 3NQAA 1F4AA 1ZB5A 2XGZA 1JI1A 4J9KA 3GNPA 3TW9A 1OCQA 3P8JA 4F4YA 2CKRA 3W71A 4OIFA 5D04C 4N42A 3BMVA 2GWNA 2OO0A 2Q3RA 1M68A 4PMNA 4XZLX 5A95A 1HGWA 5G2WA 4LYRA 2EG7A 1FHLA 1BKHA 4HYRA 3PVFA 4WUIA 3DHUA 4TV5A 3OEXA 5TQLA 4NJJA 4W85A 2VR4A 4S3GA 3F2BA 3L67A 2ZX9A 3WBAA 1IXPA 5L1LA 1XYFA 4JDBA 1IQ8A 2WXDM 2YW3A 4ZFCA 4ZBCA 1EEXA 4PTDA 5KZ6A 4AZCA 1XYCA 1PTGA 1HKVA 2QEZA 1P1MA 4QG8A 4HBKA 4BF7A 2PGWA 4D6IA 1S0MA 4BFAA 4RUCA 3CZGA 4JCLA 1U1JA 2DZVA 2CEQA 1A5LC 2GVLA 2ATLA 3WQOA 3NVTA 5HULA 3ZS4A 7PTDA 3DKJA 3KS6A 4WHBA 1NSJA 1OD8A 4AZCB 5DG8A 4P7QA 4DZHA 3BC9A 4AD4A 2WW5A 5JUMA 5L1JA 1ODUA 4Q7NA 1QT1A 2AKZA 1TMHA 4U10A 1W5OA 5KTLA 2Y7EA 1IYXA 1RXOB 2DZSA 4XD4A 4QXIA 2GFTA 3PR2A 2C28A 2YCJA 1Z8AA 2UY2A 4XBSA 1GZGA 3R11A 3E2RA 3QHNA 1T96A 4ED7A 4B9YA 3GXPA 2NSOA 1V02E 3EXRA 3U5UA 1K4GA 4O8AA 3AIUA 1Q7MA 1FWIC 1QVBA 4FIRA 3GIQA 5KG6A 1GK8A 4BF5A 3SN0A 3NYZA 2INEA 4ECQA 1XG4A 3QZ7A 2QCMA 1RP8A 1NOFA 3D3FA 1CW2A 1XLLA 1POJA 4JIRA 4TIMA 1OWQA 2C2DA 4XKMA 5DQIA 3SECA 3BPWA 4ECWA 2FTPA 5E9AA 1WP6A 3NO5A 3GXFA 1R9XA 4X0NA 3MSYA 3VZZA 3G0UA 3NEHA 5JUVA 1CTNA 5A5WA 2OQYA 1R47A 1DJQA 1UWIA 1FQ0A 1EHAA 4EPDC 1R38A 2BXZA 4K68A 1TCMA 2Q09A 3ITLA 4I3GA 3UERA 2AQWA 2F7FA 2VC6A 1NH6A 3RPMA 2WQPA 2X8RA 5D2VA 3O3RA 4GZ7A 4RDYA 2RDIA 3I10A 3K2GA 1D3HA 2NQ9A 3EPOA 4QW8A 3W72A 4PN2A 2W9BB 2C1GA 2X05A 3MO7A 3OYZA 4YTUA 2NVCA 5FCZA 4PODA 4CD5A 1BQGA 3APYA 1A49A 1LBMA 3GVGA 1LROA 2P8BA 4FAMA 4DBDA 5AZ0A 3WQEA 2ZIDA 3WJWA 1VPQA 1VJIA 2HK1A 2OXNA 5HQLA 3SFKA 4AC7C 4EF9A 5H6HA 3EMQA 5F7UA 2HDJA 1FXPA 2CERA 4C6KA 3QPYA 1VFLA 5HWNA 3W7PA 4XZHA 2GDVA 5D2XA 4YVXA 2RH9A 3UXKA 4DI8A 3SCNA 4E2DA 3CZKA 1E15A 4LEQA 4PUJA 4XUYA 3Q94A 5FF0A 5C2CA 4TMCA 4TOQA 3HQNA 2CWXA 4MHBA 3DFPA 5G1TA 1GPFA 3UXAA 3UG8A 1KNWA 3PBMA 1E9LA 1MMFA 1JZ3A 1P5BA 2PFHA 2QV4A 3G8EA 3RN6A 4WDTA 1GOKA 3EX1A 3KVMA 4OWGA 1KFBA 4MMWA 2BHUA 1RV8A 3LU2A 5KITA 4CNUA 4XK2A 1DJNA 1TJRA 1ADSA 2UVUA 4GWEA 4LT9A 2HJPA 3R94A 2FVLA 5BMXA 4DL7A 1BWVA 3PG9A 4WIWA 2AL2A 3IN5A 2V81A 2ZE0A 3MB9A 3QV6A 2YBTA 3AUOA 2PDMA 2ZUTA 3IACA 4RE0A 3QTGA 2J7CA 3UYIA 3IK4A 2RAGA 2AL2B 2BY2A 2VZUA 2PWDA 3KL3A 2BHZA 1RSCA 1X1NA 2PCEA 4ED1A 2WNZA 3FLUA 4U2ZA 4PFMA 2CWNA 1LWIA 2Z27A 1ITUA 3OVPA 4QEEA 9RUBA 3BOLA 1V6WA 1VCGA 1DHPA 3WFAA 2DV0A 2JEFA 1J10A 1VCVA 2IKHA 2IKIA 4Z42C 4GH1A 2FGZA 4GKLA 3E0VA 1E6NA 3BQ1A 1U30A 4IM4A 1MQRA 1R3YA 5LZLA 1CLKA 1RY0A 3TC3A 4D6JA 1SYTA 1DXEA 4HNCA 3VOHA 3BO9A 1F9CA 1B1YA 3BH4A 3N3MA 5LKYA 5BZAA 3SQSA 1BXCA 2G3MA 4GYPC 5EBUA 2BXYA 2FPYA 4S3FA 3KOYA 1XLFA 3GG1A 1PWMA 1E4MM 4MWAE 1WCGA 1QI0A 5BRQA 1NP0A 2QJGA 3G6VA 3T5LA 3FJNA 4WJEA 4QISA 3DXIA 2ATSA 2R8KA 3H4WA 4O1CA 4JPGA 3AUJA 1W37A 3LZ5A 1ZAJA 4NNBA 2DZUA 1W32A 2EG8A 2PTXA 3OLEA 4D6GA 3NPVA 2XH7A 2Q02A 2W62A 1LOSA 2PCQA 5JH2A 1YPIA 3QFWA 2DJXA 4IG2B 1WZKA 4AF0B 3GW3A 1I1XA 2WHMA 3BAKA 3FCPA 4BHYA 2HS8A 1PO9A 3BAJA 2R1LA 1LM1A 4M7SA 4X2RA 4BY3A 1RCQA 2JF6A 1CXKA 4PSPA 3VOFA 2ISFA 1S3TC 3BTNA 4F9DA 1P0DA 2OX1A 3K1GA 3DFTA 2CBIA 4ERAA 4X60A 3TSMA 2I57A 5F2GA 4AW7A 2ZWZA 4AVOA 3CXOA 2F2KA 4O0QA 1UG6A 4ZB2A 1UH3A 3UZYA 3ECQA 4PCNA 4IQLA 3MO4A 4DEFA 2BTMA 4PEEA 4CNTA 4MFDA 1ZLPA 3H26A 3ELFA 3V0SA 1DXIA 1BF2A 5HPOA 3AWOA 3GIMA 3L5LA 3S46A 1GVQA 3W00A 3O8AA 6PTDA 2Q6ZA 3UWUA 2XCPA 2VC9A 4JQ3A 4XISA 3PG8A 2J78A 3L4ZA 1YNQA 2ANUA 2A79A 4OT7A 4YTSA 5CBJA 1EIXA 1B0IA 3VINA 1IEWA 3T2PA 2YL9A 4XZIA 4LWWA 4NXKA 1UBSA 1GVSA 2OEMA 5F9NA 4I9MA 4XO6A 6A3HA 1A4LA 2FZ9A 1JCXA 1KM3A 3POHA 3PW5A 4WY0B 1XC4A 5D9PA 3RB4A 1RBAA 2WWDA 2E5DA 3ZSTA 1K9DA 1GKRA 3GKFA 1NAL1 1F3WA 5BOEA 2NXIA 1TJPA 3S1GA 4BQ2A 1PJ9A 4H2HA 2PWVA 4U4MA 3F03K 4JBRA 3Q65A 1EJTC 4RXGA 2VENA 4MM1A 1XQLA 4RE2A 4GLEA 2QCGA 3IPWA 5DY2A 4E2OA 2RJHA 5IFTA 2ZXAA 2QUTA 3STGA 1Q6QA 2V9WA 3VNMA 3CV6A 4AEFA 4LS2A 3VVGA 1FCVA 1I2QA 5AC8A 4KRUA 1XGEA 5JIWA 1S2UA 3UCCA 1E6XM 3HB9A 1H7NA 3IK2A 3ARYA 3O06A 5KFIA 2ZX8A 3EBVA 5A8MA 1EF3A 5XINA 2I9UA 2PF8A 1VLWA 1JRBA 3EB3A 1SSDA 2Y85A 1TR1A 3R6IA 4B5XA 4E4PA 4A4AA 1UMLA 3WDRA 1FTXA 3GR8A 4HA4A 2X09A 4WOQA 2VR2A 4LC6A 4PMRA 3GD6A 1W54A 4OV9A 5LHFA 3OB8A 1X1OA 2WVUA 1JD9A 4NI8A 4JYEA 3WLRA 3C86A 3PZ9A 3VNDA 7TIMA 1JULA 4HD5A 3OHIA 4WDWA 2O9OA 1RH9A 5AHNA 2FLPA 1E1FA 4J35A 3NXFA 1EYWA 3LG3A 2Y8VA 1I45A 1R7AA 3QZ6A 1XH0A 1IGSA 1Q8AA 1TX2A 4EIVA 4C6QA 1ZBVA 4GZJA 4Q8UA 1PXGA 3SUUA 1EUAA 3KDOA 4FXSA 5DXXA 4GIAA 4FB7A 4B3ZA 1W2PA 2QS8A 1O66A 3QTPA 4U33A 3GV8B 3SSJA 2FMNA 3UR5A 2V67A 4H6KA 5CPTA 2VEMA 3Q4DA 4LUYA 3G0XA 5FEXA 1V6YA 5I24A 4Z2HA 5LNUA 3LI1A 2HVMA 1VF8A 1TSIA 1TIMA 2ZBTA 3A64A 4EP8C 4RV8A 3DHFA 1NDVA 4MB3A 2PDLA 1QO5A 4N9BA 5AHLA 3EWDA 5I3DA 3B97A 4B16A 1BGGA 4MNKA 2DH3A 2VVNA 1MFUA 1VBRA 3MI6A 5CQ1A 5EMKA 1FDJA 3EEZA 2OT0A 3TA6A 5EL1A 4UQBA 2XN0A 1V3MA 3C4UA 4XVDA 2PDCA 1SJAA 1VHNA 3A4JA 3A21A 1FX6A 2MUCA 1MXGA 5KFPA 1W1PA 1J9YA 2JALA 4X63A 1L6SA 3ME3A 3W7IA 3KTSA 1EXPA 2VDIA 2Y89A 1FHDA 3CT7A 4Z2KA 1PV8A 2IQTA 1UR8A 4C6NA 2C6QA 2E1WA 1Y0EA 3WUEA 1WXYA 1IZJA 3EEGA 4JTJA 1UR1A 4C5ZA 1W56A 2H9AB 1OIMA 4NJIA 4H9MA 4LV4A 1FWWA 4KQNA 4MY9A 1XSIA 1EA9C 3EWBX 3THQA 1PIIA 3UZZA 4DWDA 2A7NA 1OC7A 1LOQA 5KG7A 1GCYA 4PB4A 1XGDA 3GDTA 3GXNA 4H83A 4J9SA 4MUZA 2R8HA 5AC4A 1HJQA 4HCDA 3BVJA 3N9RA 4J9LA 2ZXBA 3SADA 4L9XA 4OV4A 1XYMA 1YNYA 4Z1AA 4IX2A 4IP4A 4Q4PA 4DZ5A 2PDNA 3WFLA 4BEQA 5DG9A 3W07A 1G0CA 2BG5A 2VL4A 2C79A 1KCLA 4MADA 3W82A 4FBTA 1EDQA 2XFWA 4AX7A 1GTEA 3G24A 4RK8A 3EWCA 2AKMA 1R6WA 4ICNA 3MVTA 4GO9A 3RILA 5CBIA 1JUEA 3OLDA 3TJXA 2R24A 1OB0A 2X1IA 4H00A 4LUSA 4PMUA 4YXGA 4TXEA 1QR7A 1EJUC 3TVAA 5FJRA 2EPNA 4EACA 4JV2A 4F2BA 3TOYA 4DL3A 2VFDA 2PTYA 5C7VA 3QH2A 1XJBA 1XC6A 4YHGA 4RL3A 1AA1B 1X1ZA 3QSTA 2H3DA 4H7ZA 1KFJA 2PTDA 4PTWA 3VIOA 1M9HA 1HJWA 4UQAA 4RCXA 4S3AA 4HPJA 3UGVA 2J27A 1E72M 1YIXA 4LALA 1C9WA 4D6CA 2YXOA 2BP1A 4L9YA 2OSWA 3I7QA 3B05A 3I65A 5EWEA 4P7LA 1KM1A 3RM8A 4IP5A 2OFJA 1K8XA 4KFPA 3LCLA 4XZMX 1EP2A 4NXSA 4DJFA 1B3ZA 1EO7A 5CZSA 1SZRA 4R7OA 1TZZA 1JYXA 1MWOA 4LW7A 3RPTA 7REQA 5L9XA 3O6YX 4TVDA 3RNDA 2G3FA 3B9EA 3PBGA 1TV5A 4IOTA 2OVLA 1EDTA 1QPKA 2E25A 4V2XA 1J6PA 5ABFA 5GNXA 1PX4A 2WMJA 6ENLA 5HWMA 3MW7A 2QJJA 2W61A 3AALA 3V7PA 1ADOA 1EC8A 4CKQA 3WBXA 3TZNA 4F2UA 1VFMA 2TYSA 4NL1A 1ICSA 3M44A 3H4GA 5DBTA 3N18A 7CGTA 1SR9A 4H6QA 3W7NA 4JTDA 3U6WA 2VGIA 1TVPA 5GVJA 3UWVA 5I23A 2BQ3A 1S2WA 4AAJA 2ALZA 4K3ZA 5E09A 2DPEA 2Y7DA 2PGEA 4MPKA 2NWSA 1T41A 1VFHA 3UPBA 3MU7A 3MFHA 4WSHA 4I5RA 1SZFA 1GVRA 3PUGA 4LPCA 1O5KA 4AU0A 3W7OA 1W1YA 1S1PA 2JBMA 4FOJA 3PR4A 3PZTA 4R5EA 3QPEA 4PZVA 3WJZA 2OKTA 3GNOA 3BLEA 2OGJA 2AGOA 1CT5A 3W2MA 1BKSA 3BZJA 3WDPP 2C0HA 2VEGA 2I5QA 2H3BA 4S3CA 4OKDA 4PGLA 1F73A 3M46A 1BFNA 2DIKA 4MIMA 4YLWA 4QG9A 3R1ZA 2V6AA 1F07A 2DZWA 2YJQA 4IXHA 3W1PA 1SZGA 3ARSA 2FVMA 5F4SA 4B3KA 1LL4A 4J7RA 3VNZA 3DECA 4KF1A 2VRQA 3H7RA 5DCDA 2DQWA 4MWAC 2R8JA 1DWHM 2W9CA 5I00A 3LRKA 3P6LA 4GVHA 2NLYA 4QSHA 3ITTA 3WF4A 1SPQA 4NZFA 4H2CA 3LRMA 3AHXA 2VZSA 3ZYZA 5I6SA 4MNMA 1IT8A 1VYSX 3PY2A 3VE9A 5KFSA 3FYPA 4ZQOA 1PKLA 1R46A 3V1HA 5C0QA 4HGXA 2W9CB 1HL8A 3MV11 2FKPA 4QJ4B 1LLOA 3CHEA 2VFGA 1JYWA 5T14A 3WQVA 2QULA 1MW3A 1RD5A 2ZRYA 3WD4A 4QNWA 2OGYA 3T5HA 2CKSA 3M5YA 2FLIA 1QOXA 4B15A 4Q45A 2E6YA 3C8FA 1XYAA 3K4DA 2J7FA 3BOXA 3S9IA 2R9RA 1EL3A 2RKXA 3W6YA 4ECRA 4JN7A 5XIMA 2YXXA 4RR4A 4GA8A 3E5PA 1L6FA 4JFVA 1LOLA 1V6XA 3VGFA 4J9MA 2C16A 4UCGA 1UJQA 4QS6A 1QNSA 2EPLX 3AIVA 1KBKA 1FH7A 1I75A 4IGHA 3UR8A 4NF7A 4CCDA 3KZPA 1QASA 3PP7A 1H7WA 5J5DA 2Z0IA 3F4DA 1EO5A 3EZ4A 1UPPA 5D09A 4GGHA 3DYMA 2Y4SA 1MDLA 2ACUA 4GFIA 2IQ0A 5CSYA 4RZRA 3W3OA 5CC6A 1Q66A 2EEXA 2QMJA 2FTWA 3B0PA 3VGHA 3HMJG 2Y88A 1XPGA 3T2QA 4OOZA 3DESA 3UBPC 1D2KA 3QQWA 1C8YA 1WYIA 4D2JA 1K9TA 5FF7A 3QKEA 3PW0A 3AXMA 1GQJA 3UPMA 4JDYA 2AOSA 4ATLA 1Z48A 2QUUA 1RD6A 1EQCA 4JQAA 2E67A 1ZP3A 4KFNA 3I6TA 3MP4A 1EF2A 1K1SA 5KFHA 2Z00A 3WLLA 1U83A 1VS1A 2ZC8A 1QNQA 4JIIX 4J9OA 3VDCA 2E28A 2W9MA 1IE7C 2X16A 3LLDA 4B5TA 5A6BD 5KFKA 4Q32A 1FHUA 1NOWA 4ZFMA 2J6TA 1UD8A 3WH6A 3FJ6A 1LUCA 3E0LA 4GCXA 4O0ZA 3C56A 5M1TA 1EGVA 5KFWA 4LUIA 1OZQA 5DBUA 4AB4A 3VABA 4OHQA 2L5HA 1BYDA 3G3MA 4O11A 2QT3A 1A5BA 4LUJA 4BEUA 3N6QA 4ZQPA 2EKGA 3M5XA 3PNUA 3CASA 1K6WA 1XRTA 3H2AA 4JCMA 1J2BA 1VZWA 3P74A 3OG3A 1KCXA 4UR8A 3EXSA 3SCVA 3MMTA 5EWFA 1RJRA 1IIHA 4JTIA 4PMDA 1JYNA 4XUGA 1DBTA 4H04A 3BAYA 3WK0A 2WZTA 1ISZA 1SQ7A 3KBNA 3VNIA 3QN3A 4WXZA 5G2HA 2BVTA 1GW9A 3CPGA 2XVLA 3L2IA 2OODA 3TLQA 3DG6A 5I77A 4XV0A 1RYRA 1EX1A 3ABQA 4DUVA 3N04A 3U8GA 1QU4A 4JHOA 4XG1A 2O55A 3ALFA 2DORA 3BLDA 4K1GA 4JL2A 2VYOA 3SY8A 4GVIA 3LPOA 3HFTA 3UWYA 2B0MA 5AZ1A 3QR1A 5KT7A 1TUFA 4Q6XA 2PE4A 3WMBA 4OZOA 2ODOA 3E1F1 4NAFB 3OQEA 3N3TA 1ZNNA 1N2VA 4ZOAA 1YKWA 3SCQA 1KRMA 3GW0A 2VX4A 3DFSA 4YCOA 4PCTA 3VNJA 2BBFA 4O19A 2QCDA 2G37A 1YTEA 2PC8A 3MMWA 4BZYA 4GYPA 3PZVA 3CUGA 4M29A 1CENA 2VEPA 1EQPA 1JCYA 4BWLC 3GY1A 1ZU8A 3G77A 4DL2A 4H7VA 3MUZ1 2VO5A 4HOWA 1JFHA 3WCZA 3WQ4A 4WKAA 3S2JA 1E9ZB 1P6WA 3I4KA 2YL8A 3KUMA 5HXMA 1UR0A 2GGGA 1LBFA 2ZQ0A 3MUXA 3QY7A 1U33A 2IXVA 3EA2A 1JR1A 3O6DA 5XIAA 2PDFA 1M04A 3TH6A 2YYTA 2RDUA 4GZEA 3TMLA 1BVZA 2YKKA 4EBEA 1HT6A 3SFWA 3G6XA 5K9XA 1M7OA 2IS7A 1XIMA 4UTMA 3TC6A 3Q37A 3CMGA 2WPBA 3LM7A 2CXEA 4ECTA 3F5KA 2NX1A 2GVJA 4O14A 5CAHA 4J9NA 1U5JA 4W5UA 1DWFM 1YNPA 3UZJA 2FZNA 4RDZA 4F48A 1QWKA 1UKOA 4A22A 1PEZA 3A5FA 2XIJA 3NQ7A 2QCLA 1YHTA 1V3KA 2Q3OA 4O52A 1EWEA 1GT8A 4Y9OA 4N4QA 4K37A 2QNEA 3KLLA 4H01A 1B3YA 1AODA 1UD3A 3CAVA 3V0TA 3CQ0A 3P7YA 5FAJA 2XIBA 3MCNA 3IEBA 3E74A 5D9NA 1ZCOA 2MNRA 3TYAA 2OR2A 4R85A 1H3GA 3CUFA 3OA3A 4EE9A 3LLFA 4L1GA 1AFSA 4J5NA 4GC7A 3GAYA 1JF6A 3HQOA 3MBDA 3GAKA 2FDSA 1DIOA 2W9AA 1AH3A 2XN2A 3OA5A 3M7SA 4JOMA 3G6MA 5BOFA 4ORMA 1RA5A 1QHZA 2VX5A 1U5VA 2VJXA 4O3NA 1C9DA 2TRSA 3E5BA 4IJRA 3LB0A 3A3XA 1KV5A 3RCNA 3H7UA 3LK6A 3O05A 5KFDA 3WLQA 3NCOA 2IW0A 3T8LA 3VMOA 3F2DA 5HINA 2P5NA 4KW2A 5FSEC 2VZOA 4QNEA 4PMVA 4XSMA 1VENA 1ESWA 3G1DA 1FFRA 2BZNA 1NFBA 3NL3A 2J75A 3RLVA 2VD8A 4V33A 5I5RA 4K7YA 4GBDA 2POTA 1K02A 2DUZA 3HG2A 3BW4A 1KR0A 1BRLB 1W1ZA 2QDDA 2YDAA 4YIWA 3HPFA 4GY0A 1EJRC 1FWFC 5KG5A 2OWXA 5EPDA 4R34A 2OX4A 3P60A 1VEMA 5MF5A 3WKZA 5KMYA 1JRCA 4GCAA 3WEOA 3N4EA 1JNDA 3GK0A 4XZWA 4DL5A 3UJEA 1P0KA 3TJ4A 4FALA 3EAUA 1UPMB 1Q6FA 1HKIA 3GHRA 1J79A 1Q2RA 3KHDA 4AIUA 3IUIA 4UQ9A 3V16A 4QLLA 4LGXA 3EWUA 2WMIB 3EOOA 3TOPA 1EXBA 4DAFA 3WNNA 1M65A 3TROA 3U4AA 4M19A 3O9NA 4ACYA 4DJDD 3G1FA 4B9ZA 1E0WA 3RAQA 2O4QA 2Z7GA 1JF5A 5KEZA 3WYZA 3NA8A 2QR6A 5C5YA 4RNIA 3ENLA 3E2QA 3LGGA 2E8YA 3LNPA 3O2LA 4GQBA 2P8CA 3UJ2A 2PGRA 4MTVA 3HPZA 3PPFA 4LUTB 1J11A 2BFGA 2YFNA 3QLLA 3WH7A 4QWDA 1M7PA 2NX3A 1KBJA 2X1UA 3URQA 5LXXA 1XBVA 4JTFA 1OEPA 4G56A 3FS2A 1VEOA 4PUMA 1QOQA 4FNUA 4RW5A 4LH8A 1ZCCA 5F4WA 4PB3A 2CZVA 2R1MA 4CQDA 1JQVA 4P5UA 1MFVA 5CKSA 3NTYA 4W9TA 2A3EA 2C19A 4AWSA 1BQCA 3ZXWA 1ECEA 1DHKA 2XUCA 4XD5A 4FHAA 5DELA 1MRAA 2CETA 3G1AA 3N29A 4GABA 3R0DA 4DF1A 1RBLA 3LV6A 5AC7A 1F2JA 2QPSA 4JEJA 1E6RA 2HQAA 3UWZA 2ACRA 2YBUA 2WAGA 4W8BA 1Z9AA 4AVFA 4XO7A 2C22A 5J5RA 2HWGA 5BCAA 5H8UA 3VAVA 1JX4A 4RJEA 4CNPA 3AU2A 3QYSA 4FLRA 3M0XA 4CNSA 3GXTA 2BVDA 1QW7A 1OHLA 5A8GA 2Z26A 3ATZA 5CPMA 2A7PA 4GI9A 1R9YA 2CLOA 1XH2A 3S1XA 1X6NA 4AFYA 2VUNA 1GOIA 1QCWA 1Y8BA 4GC4A 3BAWA 4IQJA 4DL4A 1QBBA 1R3VA 2ALRA 4L7ZA 1BVNP 3UJSA 1HG3A 4F0LA 3GC5A 2HNEA 1YEYA 2OYKA 3USZA 2CLKA 1RQEA 3DI1A 2WHLA 1MVYA 1LG2A 1KRCC 3M1ZA 1V02A 4OVXA 1RYSA 1O68A 5BRBA 1E71M 2R1PA 2WCSA 5D9MA 1EDGA 3BUVA 1QUMA 2HBVA 1V6TA 4S38A 1G7VA 2DT2A 1SFSA 2OSYA 4MNJA 1TWWA 3HMCA 1BYCA 3SB0A 1IV8A 4C6FA 4AHOA 3FDKA 1DJWA 5CSRA 3FA4A 1IEIA 2GVYA 5BW6A 1C92A 4ZMGA 1I0DA 1AVAA 1WE5A 3TQKA 1JZ4A 1D7FA 4PEKA 1C90A 1XH1A 1JPMA 1JCMP 1AL8A 1T8XA 1V7AA 2OWWA 5A6LA 1L2UA 3EOLA 4AWTA 2XIIA 5U7SA 1YTDA 3THCA 3W7KA 1S97A 2PDUA 4BK9A 1Z41A 3LGDA 1TUXA 2E77A 3HPSA 2A3CA 3U57A 4PRWA 1XRVA 4MOZA 5MKGB 3WF1A 3H4DA 1PAMA 4WSKA 3H8AA 3AIQA 4LVAA 5DCEA 3IIVA 2EBNA 4I7VA 4Y9NA 1UOZA 2WJZA 3ZMRA 1MUWA 2GJPA 1OZMA 2QW5A 4NHVA 4JNZA 3UY8A 4ES4A 5KFGA 1GYLA 4IGSA 2CLIA 3CAWA 4RDVA 2DFAA 4FS9A 2OELA 1TPC1 1LLWA 3SRFA 1AZ2A 1TWIA 3VDHA 5KT2A 1ITCA 2FZ8A 1U5HA 3E2VA 2VGFA 4MJMA 4EYHB 2WBGA 1FKWA 4CCCA 5A6SA 4HMNA 1U1HA 4B2DA 7A3HA 1F74A 2V5KA 3ZFHA 4M1RA 2QKFA 3GDMA 5FF4A 3LS9A 2NX9A 3ZJ7A 3SM0A 4IR1A 1W1B1 4ZOEA 4Z2GA 3GSMA 4ZQRA 2VDGA 2INFA 2W66A 3PZGA 1X38A 3LZ3A 1P0NA 1I8JA 4ECXA 1UKTA 1W9PA 1RK5A 2PD5A 3TJIA 1IR1A 1CYGA 4OTKA 1Y65A 3VILA 3LHTA 5E0FA 4WQ6A 2J7BA 4OOUA 4Y9AA 2EPOA 4QW9A 4NSBA 4QJ3B 4ZO9A 1W3TA 3GNXA 5GPRA 1XDMA 1OFQA 4LANA 4ZL1A 4KETA 3KP1A 2XSXA 1A5AA 5EB8A 3SRKA 1NJJA 1VB9A 2QJNA 1BTCA 3ZJ6A 1G94A 5CG0A 3GG8A 4HHMA 3WUBA 4N9DA 1ZHAA 2PEVA 4LCQA 4QX4A 1K3UA 4H41A 4B90A 3GUWA 3GO2A 2ZZ4A 3W23A 1LF1A 3TYZA 4DO4A 4O57A 5BXPA 3E3HA 1SO4A 3H55A 1N7KA 4RXFA 4XTIA 3QMTA 2BY1A 1UUMA 2VI0A 4FS1A 3QHMA 4JQ4A 1HP5A 3GV5B 1W1A1 3EWXA 5HA7A 1S0NA 5CSSA 3Q8QB 1W3HA 4JTKA 1IGWA 1XIBA 3AXHA 1X97A 3CJPA 4N6FA 5REQB 3W7CA 3JR2A 4JXCA 1A5UA 3TCSA 1Q3NA 2CITA 2HNHA 2WNNA 4US5D 3S1VA 3THAA 4YTRA 4JKLA 5FEZA 3OSPA 4B5NA 4ED3A 4TO8A 1T94A 4ZE5A 4P7NA 4PMXA 5M03A 3M7WA 1ALDA 2C1IA 3THDA 3USBA 5HNRA 5I3JA 1QI3A 3WMLA 5A1AA 5C7HA 4XAFA 3WK1A 3DENA 3AZRA 5I3HA 3S3GA 3N12A 3P0XA 3VO0A 3V35A 3QZAA 1OK4A 2OMAA 4FR1A 2BLEA 3O63A 4A8LA 3BW3A 2GUYA 1W8GA 1ISYA 3AYRA 4L4OA 4Q4SA 4AYSA 2PAJA 4JTHA 1Z42A 4OU1A 3TQ0A 1LCOA 3CWHA 4F9JA 5H1WA 2XFFA 4ZCWA 4GNVA 4D71A 3SN4A 1KRBC 3M5ZA 4C6BA 3WNKA 5KINA 1X6UA 5F2MA 3UZXA 3UETA 3XINA 3AHZA 1DV7A 4XX6A 4ZGYA 1M53A 3SCOA 1B2YA 5LIKX 5CPOA 3EDDA 2XJ7A 1XUUA 1GOQA 1ZS2A 1E43A 3TN5A 4ACZA 1XW8A 2FH8A 3I4EA 2HMCA 4PMOA 3N2CA 3L12A 3RAXA 5F1UA 4AHPA 2C7FA 3VYLA 1LRQA 2D23A 1FWAC 3KRZA 1MZHA 3GR7A 2BOGX 3KHHA 3KLKA 3P93A 2OYLA 3GVQA 3B0YA 3TQ1A 4ACZB 2W67A 3EMCA 4HNUA 1IR2A 5ABEA 3EX3A 2Y8KA 1A5OC 1QI2A 1DE5A 2PMQA 5M2FX 2XFRA 3TR9A 4L64A 3UJRA 4I9TA 4PMYA 1XIIA 4K7VA 4OUIA 1SFLA 3U2OA 1PZ0A 1W91A 2XGBA 5A8OA 3C2EA 4UZSA 3A9BA 4H9UA 3T08A 1TV2A 3M43A 4DELA 4DYEA 2ZC1A 2RGMA 4QS5A 3UG4A 3UW6A 3P62A 4CQ9A 4QAIA 2VUYA 3EWZA 3OLIA 4XWUA 4PUEA 1HL9A 1R2SA 3SI9A 3LXAA 4OGZA 1RLDA 4ZTXA 1VR6A 1Z7AA 2GJXB 3MR5A 1F8IA 3EDEA 3G1YA 1Q7ZA 3TNBA 4DNMA 2XGIA 3EPNA 3OLGA 3WLOA 1M41A 1N55A 3UQNA 3R89A 3R43A 1EOKA 5GJNA 5IM51 4NLGA 1R3TA 1F61A 2DU2A 1E9YB 2NVAA 2G97A 4J1OA 4S2CA 3LN3A 4ZO7A 1ZY9A 3HG5A 4K1WA 3LSBA 3W87A 3FAXA 2FHBA 1J0IA 3SIMA 3FSTA 3LEPA 2O92A 1ZP4A 3HZ3A 4HMDA 4AZHA 4XQ6A 2HE5A 4ERIA 1ICPA 3FW6A 4G7FA 4Y9MA 3VZXA 2V3GA 5CZJA 1XD0A 4Q8VA 3AMLA 4POCA 2E9BA 3FXYA 3FEQA 2W6RA 2CBJA 1LLZA 4H19A 1JD7A 1UROA 3TX9A 3B9NA 1K9EA 4NT0A 4KBXA 4DO5A 1WZAA 3S6DA 3ES7A 2NSXA 4OBTA 3VGBA 4LXFA 3VNYA 1V6UA 3VIMA 1O1ZA 3B3DA 3RLGA 4UFKA 4W87A 4EAMA 3KHJA 2O4MA 1BVWA 2AMXA 4J28A 5CG7A 1Q6RA 1TQJA 4LVBA 3W1NA 3S5YA 1OFOA 4ERGA 1M3UA 4KGLA 1B3WA 2BGSA 4N6EA 2H90A 2EPKX 1MI3A 3CHVA 2YDRA 1GYMA 1Q45A 2PLKA 1LRNA 4O54A 5TD4A 4DPQA 1B9ZA 3W1AA 4KERA 1BTMA 5FIPA 4Y2WA 4WRHA 4E5TA 1KB3A 3G3DA 1GHSA 4CN4A 3NNTA 1W17A 5AB3A 3DX5A 2X42A 3CUXA 5FF3A 1MUMA 1YDVA 3RB0A 2QCEA 4Q8MA 3LHZA 3W1RA 5TAOA 4UTHA 3BCJA 1LRTA 4NRSA 1X39A 4Y7EA 4DB7A 3EKZA 3U0HA 2UVRA 4KCWA 3A13A 2CHOA 2YCLA 3QKZA 4QJ5B 2ZXDA 1V08A 2ICSA 1ZBCA 5C2XA 3ZIZA 3WLJA 1TV4A 1BG9A 2WOQA 3KBWA 1PSCA 4LB4A 2YCLB 2GVGA 3N25A 1KA9F 3GIJA 1F7BA 4HA3A 3ISIX 4NZ4A 5JBEA 3WJXA 1EA0A 4LQ1A 1X96A 2WC7A 1UYQA 4GYKA 3TR2A 3GRIA 4K8EA 3FXGA 4NVTA 1ZJBA 5T26A 3RAOA 1DJGA 1GPWA 1SW3A 3QOKA 2Y1HA 1SMAA 5JU6A 3WLTA 1UKSA 2ATMA 3NQ2A 3SW6A 4EEYA 1MDRA 1YTKA 2Y70A 1KXHA 2G5WA 3ZVIA 2YA0A 4WR3A 4KRZA 4OECA 1XS2A 3RUBL 3N4FA 1GGOA 1UZHA 5T8GA 3W7DA 4EVZA 4EAYA 2UVVA 1R30A 4ROPA 1VPYA 1NWRA 4IIEA 1JPIA 4EPBC 1KTCA 2P76A 2Y6ZA 4UBPC 2VVSA 4LSBA 3IARA 1J96A 3O6AA 4XZBA 1E5JA 5L9FA 4LBSA 3NQBA 1H49A 1TELA 2J88A 3GS6A 1W3NA 3CNYA 4XB3A 1FVPA 1H4PA 2DP3A 4RW3A 4KIEA 1XL9A 3H2MA 3WEZA 3FGCA 2HPIA 2VWSA 2C15A 1F76A 3LMZA 3A5VA 2BOEX 1XLJA 4NZ3A 4U5IA 3FY1A 2VD9A 4A3HA 1FWSA 5DMLA 2HXUA 4G1NA 1W3KA 4TUFA 1ZAIA 4MJZA 1AG1O 5CPQA 3KTCA 1CNVA 5KFUA 4IFKA 1T3NA 3AJ7A 3DZ1A 2PB1A 3EOEA 5KG2A 3W84A 4BQ5A 2EKCA 2OZ8A 4G7EB 4S3KA 3BQ2A 4UFJA 4RNMA 3WBWA 4RNJA 2FHFA 1J8VA 4IFKB 4W5ZA 4HHPA 4DQWA 2PD9A 1UD5A 4UC5A 3Q2DA 3ARVA 1ONEA 3TAOA 4HNVA 3WQCA 3C2OA 4KFOA 1W9BM 3MKVA 4LNYA 3E49A 3HPXA 3PAJA 2PWFA 3P82A 3OZOA 3K30A 4QP0A 1OX4A 4DO6A 2GK1A 3M6YA 4O1DA 1BXNA 4LVDA 4LY8A 3LQGA 3VCNA 4AD0A 4GY7A 1WA3A 3R0UA 2HZGA 2P50A 2WSQA 1VRXA 3PVXA 1J93A 5EMJA 4QCFA 2R14A 1XQKA 3OODA 3QR0A 2OEKA 3VOGA 5GQBA 1IXQA 3ITOA 3S6TA 4CVUA 4K39A 4HU8A 2XWDA 1WO2A 2XHYA 3LTYA 3IVSA 3UP8A 1NWUA 1E3ZA 3M64A 4IWWA 5BXTA 3S8HA 2XZ7A 1QAPA 1WKDA 1M03A 4QSFA 3TXZA 4UCFA 1Q6CA 2WVVB 3V0UA 1GONA 5LHEA 3FFSA 4O3RA 2X2GA 4O10A 1EJWC 1OYCA 3NQGA 3QY6A 4YTTA 1X7FA 4JFSA 4QDMA 1ZALA 1ZJHA 2DT1A 1M6JA 1TE1A 5AYIA 2REQB 2BVWA 4HPHA 3AMDA 3T09A 3W75A 4ICMA 5BRPA 2PWUA 1QNVA 3JW7A 4XKYB 5KZMA 5E5CA 1XCWA 5CJMA 3DBNA 2ZZ7A 2WM0A 4EXQA 3W76A 1YBQA 1G9HA 2WSPA 2QAPA 3OVGA 3W53A 3T42A 3FNDA 3W74A 4Y8EA 2NQJA 2ZRWA 3EWWA 4IMFA 1W9VA 3CHDA 3QRHA 5EYWA 4EPKA 5D32A 1YBQB 4H8UA 1HQTA 4MJ4A 2A5HA 4UFMA 3CAQA 1G7UA 1GJUA 2D22A 3DN5A 2J62A 4JY9A 5HJYA 3CMFA 1KWKA 4CQBA 4GGBA 1AQ0A 3TYDA 1W3JA 5CGMA 5KFXA 3IGHX 2PU0A 2WPGA 2YCEA 4DO7A 4MDOA 8A3HA 5BOOA 3DFQA 1OFEA 3E0FA 3E9AA 4KKXA 1A3WA 1TKKA 4PUWA 3WD3A 1HP4A 4J3SA 1NQKA 2I17A 3GZ3A 3F4NA 4JNYA 1IEXA 2BS9A 4IFOA 4B5VA 4ZO8A 1GEQA 2GOKA 2RDJA 3HM7A 1XCXA 2TMDA 2Y7GA 2V5JA 2P1FA 3MFIA 2B7QA 4KWWA 2Z25A 4E3VA 3II1A 1KGXA 4AISA 2A3BA 3BANA 2E4TA 4QJ1A 3DKLA 1R0MA 3M0LA 4LAKA 2ZOXA 2WJFA 2XIQA 4QWCA 2RFGA 2NXHA 4NG3A 4HTBA 4HCHA 1K8YA 4AEEA 4DWSB 1NF0A 4GVGA 1NWTA 1P6CA 3GTNA 4QLJA 4TVUA 3AZTA 5DQHA 3SCRA 3S4TA 1NQ6A 2V38A 4P8WA 4C1LA 2AGTA 3HFYA 3UA4A 3QW3A 3U5YA 3WNOA 5KFJA 3LGEA 1YDYA 1J5TA 4CN1A 2WKLA 3ABZA 3NQVA 4FA3A 3L68A 2VELA 4HQVA 3VD9A 1VFFA 1SVDA 3OIXA 3ZLHA 4W7UA 4AEOA 3L0KA 3LSCA 3WG6A 4C7GA 1EFZA 1WKFA 4GX8A 4TV6A 2BY0A 1FWJC 3RRAA 3TEVA 5HNUA 4WK9A 4F3HA 4GHRA 1G4TA 3V18A 2YDQA 4FSAA 5DQGA 3PBYA 5DGAA 4FO4A 1QO2A 1A80A 1QFEA 3IUDA 2GQ3A 2W27A 2QVNA 2XG9A 2TPSA 5KFCA 1EUNA 2E40A 4KMQA 3HG3A 3EA1A 2POZA 3PUDA 1N48A 1VQTA 2XIOA 1ML1A 3GFYA 4D9PA 3FKRA 4S2BA 2QCFA 3U9IA 1K7EA 1REQA 2GSJA 3EYPA 3VKCA 1WPCA 3GYCA 3PW2A 4GACA 3S2CA 4C6CA 3TW6A 3VIIA 4E38A 2JEPA 3HURA 4JKMA 1W1VA 3S5SA 5CH9A 1TJ1A 4FF5A 1KFCA 4W86A 1N8IA 4CVWA 2NVDA 5C9WA 2QCCA 3NSMA 1XFBA 2FDMA 3IJ8A 2OKOA 3T0DA 4E6MA 4PR4A 4IPIA 4M82A 5EDWA 4DUOA 3UG3A 4O3PA 1PKMA 3EX2A 3FDSA 4YJ5A 3W70A 3AS2A 1UP3A 3OBKA 4ROQA 4GISA 3DH7A 4JFTA 4TQRA 2VQTA 1DWJM 2R82A 4J9JA 2YFOA 1DYSA 2E8ZA 4NI3A 5HMFA 2E6DA 3MP5A 1T7LA 5HJLA 3CV1A 2DY3A 4HNLA 3P61A 2NW0A 4GIEA 2YR1A 1RJPA 2P0IA 2XM1A 4Z2IA 3N6JA 4MDPA 1QDSA 3EMZA 4AMCA 3SUVA 3NXLA 4GZIA 2CZDA 2WBKA 1QW9A 3OG2A 4UFHA 1KO0A 1GVFA 1GHRA 3PBWA 1RCOB 3RX4A 2I5IA 4N7QA 3H2EA 1GORA 4HU3A 2BSLA 2YX0A 3CHCA 4IJCA 4H3DA 3CUHA 1OX6A 1JDEA 2KZHA 4GINA 4WJXA 4CNNA 3QQ1A 5I7GA 2A7RA 2FYMA 3VM7A 4WLCA 1XP3A 1NY1A 3C0QA 1XX1A 3KWSA 3VDGA 2J6SA 1W5PA 1E3XA 3CMJA 2NUXA 2Y0FA 3PTQA 1PX8A 5G4HC 4I6VA 3B9AA 2D24A 1DIEA 3G6LA 4ZO6A 1TWZA 3WY1A 2ZZ1A 1CB7B 4RPPA 3STCA 4HA0A 3ATYA 3S9ZA 5DXYA 2WYSA 1KV8A 3V4BA 1ZRQA 1IZKA 2ASLA 2O9RA 5AECA 2HCVA 3WJSA 1DP0A 2D2HA 3L4VA 2ZADA 2PLMA 3AXIA 1FH9A 1L8NA 1UWRA 4R33A 1NIUA 2YA1A 3SI8A 3DYPA 3C3NA 1V3LA 3DGRA 3W2LA 2ISSA 2Y24A 3ARZA 3TN3A 3I7RA 2G3NA 1ZQ5A 4CQCA 1FH8A 1E40A 1THFD 4M3PA 3R12A 2YCKX 4AZ6A 1R2RA 3UVIA 4A3QA 3QF0A 4QEHA 2ZX5A 4B91A 2VFEA 4D1IA 1IWAA 2QYGA 3AICA 2O9PA 3QHOA 4Q8EA 2HV5A 2HTMA 3NPWA 2X40A 5FA5A 2QDEA 3NG3A 3WFZA 3T4WA 1C91A 1DPMA 4L65A 3FVDA 3ABSA 2G3IA 3LXBA 4ZXOA 3WX7A 4D8AA 1KM0A 4GVFA 2OEJA 2DW7A 2IA6A 3JRKA 2QF8A 4JTRA 4HSHA 3RG6A 2QGYA 4M6QA 3ONBA 4AG0A 3GXIA 1WX0A 2G8ZA 1K7XA 4DXVA 2O56A 3L4UA 2GJLA 3UWEA 1FKXA 3LD5A 1UWUA 1HGYA 1P6BA 5I09A 2WSRA 2ACQA 4GIYA 2PDBA 4PRRA 2E3ZA 4ZSUA 3QR3A 1A47A 3KBSA 3RLHA 4NAEA 3L21A 1PIFA 4DM2A 4C6OA 1A0DA 3WZ0E 1NWSA 2GQ9A 3D3AA 3T1GA 4NP7A 5CLTA 1D3GA 2EGZA 3INPA 1NOUA 4ZODA 1XBXA 1XCFA 3I6RA 3ZJ8A 3TMQA 2D3NA 3W2UA 3WQWA 3KM8A 2DVUA 4ZOBA 5E0KA 1BWLA 1EZWA 1F6KA 1TRDA 4ZOCA 1UQYA 2C3ZA 2QCHA 4QRNA 5H8PA 3V6KA 5D4YA 2W4XA 1WDSA 3UXIA 4LNCA 5D30A 3GQCA 2VFHA 1DE6A 5TIMA 3RX2A 4YR2A 4LS0A 4W93A 3ZWTA 1Z32X 4IPLA 1GQKA 3EOUA 3AZSA 1TPVA 4L6DA 4PBEA 4C7FA 3DHDA 3TSDA 1IZCA 2AAAA 1FUYA 3LCIA 2XDFA 2AAMA 1EHNA 4E4FA 2JFEX 3EOSA 4K8GA 4RNOA 4EBCA 2XVNA 2UV8G 1PE1A 3BCFA 3TLLA 4OBRA 3BE7A 1CLXA 1C7TA 4QTGA 1TTIA 1ELSA 5AYZA 1JEZA 1A5CA 4RU9A 5KFYA 1JPHA 3BXWA 2VHLA 1JXKA 3CPRA 4OQVA 3NIYA 2VQUA 1C93A 1Q5MA 4UQDA 4LRTA 1YDNA 3A23A 1HKMA 5HPCA 3TSBA 4AZ5A 2G4JA 1UR3M 1XIEA 3NAVA 3I68A 3MJYA 4N2YA 2DSZA 3TTOA 1DKWA 1UCWA 1IM4A 3T55A 4Q8PA 4GG9A 3MHGA 4JGDA 4ZB5A 3B0VC 1UJPA 2WK2A 3V6HA 5E6YA 4QDPA 2VM8A 3M0ZA 1OIFA 1W6TA 3LNMA 3FKKA 2PDGA 3F2CA 1S2VA 3P8IA 5C54A 3H2OA 3KFTA 2HEJA 3HTWA 4WX2A 3HU7A 1G4SA 4AZGA 2CESA 1YPFA 3AS1A 2OSXA 2F8QA 3LOTA 1TPDA 4WVXA 3RM9A 4H9VA 2X1SA 4XAPA 1KC7A 5CGTA 3MA8A 4EK7A 3RM4A 4AD2A 3GDRA 2B7NA 2CHNA 4O3SA 3KVJA 2QAFA 1UR9A 3VKAA 2RUSA 5CZTA 3HGRA 3MANA 3NM1A 2QUMA 2XIMA 3GTFA 4FX7A 1JQXA 3OQ8A 2YW4A 5C9RA 3WQGA 2ZUVA 3M41A 1DL3A 2V8ZA 2FH6A 4KRTA 1SUXA 1TCDA 4IQEA 4PL2A 2C91A 4HU0A 1GZJA 4J4KA 4LF1A 1EGZA 2WZHA 1AW1A 1XLMA 3GVRA 3AS3A 2CLFA 2NV1A 1Q63A 2WMKA 4JIQA 3WDJA 2WZMA 4C90A 3JZUA 3GX9A 1SO5A 5LA0A 5FJUA 1PZ2A 3N13A 2OOFA 1JUKA 4FNTA 4GUIA 1K1QA 5D02A 4LRSA 3N9SA 3CO4A 3OHAA 4J9PA 3K8LA 1T8QA 5LGZA 3LCWA 2GDUA 4FS2A 1R85A 6TAAA 3WLHA 3UWWA 5H2ZA 1XBYA 2PDYA 4HA1A 3AMKA 1PB0A 1J0YA 3MYOA 3TA9A 3NSXA 2QZRA 2HRWA 3ABRA 3HA1A 4IMEA 4ORIA 3WLNA 3P84A 2DIEA 1S5VA 1PPIA 3C2VA 2IXUA 4R7WA 1DWIM 4ZTYA 3IJ6A 3CL7A 2PRMA 4GUHA 3DOPA 4PUKA 3TUUA 4LCRA 4U7CA 3RO6A 3H40A 4PUUA 4C6LA 5C55A 1B3VA 4CQAA 4HZ6A 3D0CA 1KQZA 5A6JA 1E4LA 3RF9A 4XAGA 4MGGA 4GUGA 5I2UA 1A4MA 4GX9A 5DMNA 5AHEA 3LDVA 5AN7A 1YXDA 7TAAA 3ITVA 2C8NA 2PSNA 3G5EA 4Z1CA 1ONXA 3GH5A 4HK6A 1W9XA 4ML4A 3TTYA 1CXHA 2E1DA 3MCMA 4Q43A 4LBUA 2QXWA 2CLLA 1UH2A 2J6XA 2VX7A 4NASA 1UP0A 3GM8A 1P48A 3J7HA 4JYFA 4BF9A 1Q8JA 1BEUA 5F2IA 3WLKX 3UY7A 1UD6A 4L1WA 4JV1A 1KW1A 4H8NA 1KGUA 3JU2A 1SO6A 2YA2A 2YZ5A 3GTXA 4NZ5A 3KOXA 4JTSA 4C6IA 2J7EA 4KEMA 2G3JA 1Z44A 3MI2A 1KXTA 4YN5A 1XDJA 3RX3A 5FJIA 4S3DA 3T8QA 1CGVA 2OZ3A 2VEKA 3DC0A 2FFCA 3PJWA 4HOXA 3NDZA 3A3WA 3M9YA 2Z1VA 5KFBA 3DC8A 3WBYA 1H61A 1U1UA 1SR0A 3ARWA 2XM2A 3F1QA 3PHAA 3BG5A 3PULA 3GR4A 3CV7A 1OADA 4IX0A 5A2BA 4HIBA 1A0CA 3KHGA 1MEWA 3MSRA 4K8HA 1I2NA 1VBJA 2ZXQA 3U3HA 3S2LA 1R9ZA 3R7MA 2GUUA 3MR3A 2VCAA 5KG0A 4ZEPA 1JL8A 5T9CE 2V3FA 4MVAA 4GIRA 2NWRA 4V1YA 4Y6GA 4GJ1A 2P88A 3S6OA 5BXRA 1PL9A 4Y96A 1L9WA 2Z2AA 4BQ4A 4RLIA 1W9UA 1H5VA 1XIDA 3MT1A 1LP6A 1QTWA 4RZ6A 3N2MA 4ECUA 1XPYA 1O94A 3HPAA 4JTEA 2DH2A 2WSKA 2ZVIA 3B06A 3KW3A 1E55A 1KM2A 1DTUA 5AC6A 4C6JA 1GQLA 3KP0A 1TVNA 1BF6A 1GKQA 4ZQNA 3WNPA 4K36A 4QGCA 1ITQA 3I6EA 3S5ZA 3PZIA 1OINA 3FA5A 1Q6OA 3FYOA 1EB3A 3W7GA 7XIMA 3NURA 3EPGA 5LYRA 2I5GA 4FP1A 2MANA 1N56A 2ZRZA 2GGIA 1HTIA 3C0LA 4UB9A 1CXEA 1Q6DA 3G2GA 1CBGA 3SUWA 2JKPA 4B4FA 4UFIA 2FPTA 4M8UA 1UHVA 2J74A 3OZYA 2G96A 1I0BA 5GJPA 1LORA 2F6KA 3QVQA 3H53A 4CD7A 2OOGA 2GYIA 5FF2A 3D47A 1MW2A 3UXLA 1OBAA 5HUOA 3AJXA 4BI7A 4HNNA 4GUFA 2NUWA 3KBJA 4EXAA 5LIWX 5HATA 2OTDA 1H5YA 1XFCA 2YLAA 4LBRA 4FNPA 2ABAA 2V68A 1RALA 2XGQA 5LIUX 4L1XA 5JBDA 2A21A 3CL6A 5A2CA 4M1BA 1VGAA 3QFEA 3GFXA 4FMVA 1XLKA 4WSJA 1ICQA 3ZT6A 3LV5A 4JIPA 5E1QA 3PS7A 3KWXA 4L6HA 3PB2A 4UTWA 3B04A 2PLJA 3PZUA 1T0OA 4ZXLA 4E4UA 3RMEA 1ZTVA 3QV9A 4R9OA 4F0HA 4ED2A 1R86A 3STPA 3OU8A 3BLFA 3CHFA 4DJEA 2FMOA 2BDQA 2ZA2A 3DG7A 1V5XA 1M1BA 4C6MA 5KT6A 1AMKA 1P7TA 2AQVA 4QE1A 3PB0A 4J3XA 5HANA 3URAA 4CCEA 5CPNA 3SURA 3IAQA 2Y62A 5F4XA 2B4GA 3TTSA 4DWSD 1JZ5A 4INFA 4L61A 1DOSA 4G9PA 2OWCA 3K8KA 1P7TB 1VLIA 2GVEA 3IJLA 3AWNA 4LTSA 3B8WA 3FOKA 2XZ9A 5B80A 1XLEA 2NT1A 4IR9A 3WD2A 2JQXA 3NOYA 1RQHA 1LBLA 1FWGC 2BMBA 4LJ3A 3NGDA 4DN1A 3VKJA 4WKFA 1T99A 1TPH1 3B8VA 2QLYA 1JIBA 1JAKA 1JZ7A 2I9EA 4MPQA 5K9DA 2OCZA 3C61A 2D3LA 2P3EA 3ERPA 2BXVA 1MYRA 4PCSA 4LYKA 3NYDA 1JG9A 5ECUA 4IRKA 1VEPA 4C5YA 3NGJA 1QHOA 4JZ5A 3VOIA 4ZE4A 3ID7A 3CZLA 4DJDC 3N73A 1JJKA 2UY5A 3MCOA 2VZTA 3QGKC 1LT8A 1AD4A 3GH7A 4AQLA 1E0XA 2Z1WA 4F0SA 4MF4A 2EQDA 2EPMX 4E2BA 2HE8A 4H9YA 2BY3A 2QMKA 2ZZ6A 3FJ4A 4PSRA 3MUCA 1VFUA 2HK0A 4YTQA 5DLFA 3ARRA 3P2VA 3NDYA 3LLXA 3IUHA 3W1XA 1NU5A 3VPLA 4LUSB 8CGTA 2Z1BA 6TIMA 4KWVA 3U48A 3WH9A 2E9MA 1E6SM 4FNRA 3ITCA 5D8ZA 1DJIA 4QAWA 2CLHA 3BGAA 3QW4B 4FX8A 2EPHA 4Q8QA 1CECA 3L4WA 3B40A 2WANA 4CN6A 3RBDA 1HVQA 4FLQA 3KL0A 3RB6A 4ICCX 2TODA 2DZTA 4NZCA 3EB4A 5AVHA 3W9ZA 1CGYA 4PB5A 3SCUA 1J0ZA 4CD4A 5LNVA 2DSUA 2V5BA 4GI4A 2ZUUA 3CH0A 1V0LA 1KCKA 1YXCA 5CC3A 5C9ZA 4YYCA 3DFHA 4ED8A 1X8FA 2BGNE 1Q6GA 2V5DA 4AZBA 4YYFA 1BAGA 2DIJA 3DIPA 1V6VA 2XPKA 4GPNA 3FN9A 2XFYA 7REQB 2PPGA 3H21A 1EX5A 1H11A 3DYOA 4V28A 3M16A 3AOFA 4R8UA 2CU0A 1FBAA 3WO8A 3GHUA 1XRSA 2XC9A 3K4WA 5ABFB 1PBGA 4J2MA 3VIKA 2O7SA 5BWFA 3MY9A 3OP2A 1XLAA 4WDUA 1OGBA 1DEDA 1HUVA 2P9BA 2SFPA 3M0IA 3XIMA 3P5ZA 5ABGA 3ZWSA 5G1YA 4F79A 2V5CA 5I07A 4JICA 5A8PA 5DMYA 2PZ0A 5G4WA 4F4ZA 5SWUA 2G95A 2NUYA 4GYJA 2BWGA 2WLZA 4FZIA 1BYAA 5CLWA 2QVHA 1UBPC 3GU2A 4H8HA 2JK2A 2WJEA 2Z6IA 1K03A 1NFPA 3K5XA 4AVNA 2DSWA 1O6IA 2ZA3A 4WOZA 1H09A 1YE4A 3MKKA 3VKDA 4WZHA 1EJ7L 1OQFA 3RBEA 4KWSA 2Y8UA 1Y5VA 1RZMA 1UASA 3BARA 2JKAA 1AW2A 1YMYA 3PBVA 3TQVA 2ZWYA 3HGSA 2GPTA 1CCWB 4J3WA 1E1CA 1XG3A 1H63A 2NZLA 2H8XA 4TX8A 1AW5A 4E8CA 4ZVJA 4LEFA 3HV8A 2GGEA 1PKNA 4DEZA 4UR9A 3NM3A 1G4EA 3BLOA 1I2RA 3N19B 3AHVA 2ZICA 4Z1BA 4R9XA 1E1CB 1HL2A 2PWEA 4A6GA 2R8IA 4H9XA 1S5MA 5CEWA 2VX6A 1FWHC 3W1UA 1GG1A 2CXGA 2OLSA 3LX9A 1F3XA 1WAWA 3I3DA 1XLCA 3NWRA 2H6RA 1V93A 4V1XA 5F9LA 2B7OA 2DUXA 5D2WA 4NUWA 3WQPA 1LZOA 1EC7A 3TFXA 4E3TA 3NL5A 1XM3A 3CAKA 3FVMA 4JTLA 4ZSTA 1D8WA 3L5AA 1EYEA 3WSUA 3QBUA 1O1HA 2JEJA 5CZKA 1JGMA 3VC5A 1F6YA 1S39A 1I2OA 3BMWA 3B8IA 5FJOA 4NU7A 1J2WA 3MS8A 1NVMA 3DDMA 4H7CA 3ZO9A 1HNYA 4DF2A 3W6LA 4N9CA 2ZZ2A 3CV2A 1RK6A 3CUJA 2PRLA 4JFWA 3WQ6A 5A6KA 3NZRA 4TQTA 5HWJA 3GYEA 1HJVA 4UR7A 3PNZA 4DF0A 3U4FA 4NQ1A 3V6JA 4A8NA 5DO8A 1BWKA 3VGDA 4DNHA 1OCJA 1ME7A 4HPNA 2CBVA 3KRSA 1OVDA 3CH9A 3EDKA 1FY6A 2YL5A 3W7HA 5TNVA 1Q6LA 3SCWA 3N15A 3ZQ9A 1F5ZA 3GKAA 4Q4MA 1K77A 1GJPA 5EU9A 1WAUA 4OBSA 1DIDA 1RUSA 5I3IA 1KR1A 3O1NA 3A4XA 3VIJA 1JGIA 1VFTA 3BV4A 3ARQA 1GOXA 4IXXA 3XISA 1GTHA 3L7RA 3PZMA 1P1XA 1KBIA 2VOMA 1F6PA 1HJSA 3KRUA 4BS0A 1D9EA 3WJYA 3WK2A 4HK5A 4AD5A 4O8RA 4U28A 1TR9A 3PPGA 3GE7A 3N1AA 2A4AA 6CGTA 2UBPC 4HJWA 4NJKA 3W83A 4AC1X 1M5WA 2V9DA 3HJEA 2YZRA 1S10A 2X0SA 1K7FA 3MUIA 1SMDA 1MEHA 3VGGA 3P0WA 5I02A 2WM1A 2DVTA 1CIUA 1K6AA 4B5SA 1KXVA 1TZ9A 3CYVA 2DJLA 1LUCB 3RIKA 1J6OA 4G1KA 3DFYA 3L23A 4C1KA 4HYKA 1WKEA 1U22A 1NFGA 3LI0A 4JS3A 3L66A 5KFMA 3L4XA 5KG1A 1YADA 4DLFA 3W7MA 3I3EA 1EPVA 1SJDA 3BJSA 2EHHA 2QIWA 2VCCA 1XKYA 1BPLB 3VE7A 3SCTA 2PC4A 1H51A 3ES8A 5I0DA 1FDYA 3KVKA 4QWAA 4A35A 1XYLA 1LQAA 1FWEC 4ZA0A 3O16A 1MW0A 1S2TA 4PTXA 3K46A 4MZ1A 2ZTKA 5M17A 5D33A 3L9CA 4MJ2A 2NQHA 5LNSA 1TWDA 1H7XA 4GD0A 4DHGA 3BL3A 3F7JA 2W9BA 4HMCA 2WTFA 1RPXA 1EJSC 1CGXA 4Q4RA 3W7RA 5A6AA 3OJGA 4EWJA 3WQDA 3ZVHA 4UTUA 3MV01 3LPGA 2B81A 5D2TA 3BG9A 2D69A 3QM3A 5EGRA 1RQBA 4B92A 3AMGA 3URNA 4JL1A 3A4WA 1LT7A 1TPB1 2V3EA 3NJ3A 4U2YA 1RR2A 3SRHA 2QPXA 2V3DA 3R8HA 3VKBA 3ZVHB 1KXQA 1WXJA 3U7BA 1NEYA 1AQFA 4YMZA 1TQXA 3W2KA 1IT0A 4D6HA 1OYBA 3HJZA 4AY8A 2QCDB 1LJYA 1BGAA 1H0IA 1SFJA 5AOUA 1V77A 4LVFA 2WWCA 1K8ZA 4KS0A 2W8LA 2I14A 5EMLA 1IT7A 4HK7A 3WK3A 4WKHA 4RKAA 5C6MA 3IRDA 1US3A 1MZRA 3BGJA 2ADAA 1WDRA 1IWBA 2KX9A 3CZJA 3PANA 1DORA 2HPMA 1V0KA 1ISVA 3W88A 4I5UA 1L2QA 3LCHA 2X41A 1B4KA 5FL0A 1RPKA 3OVRA 4QHRA 2C2EA 1WOBA 1YPXA 4Y9PA 4GMEA 4GY1A 5A6BA 3ABXA 2GDQA 5CC7A 2XH4A 4I6KA 1QNOA 1V79A 4HKPA 1IXNA 3GIYA 4HSOA 4NZJA 4GQRA 6XIMA 4TX9A 2OYMA 4W8AA 3H12A 4CEUC 3I3BA 2EJ1A 2ZX6A 3SRDA 1VKFA 4AX6A 3GDLA 4O1BA 3ITXA 3SIZA 1H41A 5CCZA 3AYSA 3S83A 2ZVRA 1E4NA 3NPXA 2J7GA 4FXRA 3N2TA 3G1HA 3KL5A 2EXOA 3PC0A 5D9OA 3SZ8A 3H2FA 4FPSA 2YB1A 5JH1A 1QOPA 5IBXC 3VKKA 3BW2A 3WLSA 1A50A 1FFQA 4KEZA 2UWFA 5LGXA 1G67A 3GG7A 2HVNA 4M5PA 4OJYA 4S3BA 2FZDA 2DW6A 5CZ0A 2IKGA 1PZ1A 2V4RA 4FNSA 3LENA 2KAUC 3O6CA 2CZ5A 1FA2A 4QCEA 5G4EA 4IPPA 1RVKA 4QWBA 3UWQA 4QLKA 3MBFA 2OLAA 1B3XA 1ZBWA 4IMAA 4GKTA 2WV8A 3QMRA 3AXXA 3VNLA 3CPUA 1GKPA 4HCLA 1A5MC 3MP3A 1OD0A 3G1VA 2FTYA 4IGNA 5A69A 4A3RA 1UR4A 2WO5A 3TNOA 3MYPA 4G8TA 4CNOA 4GJJA 4D8ZA 1W1TA 2GQAA 2QPUA 3I7SA 1Y5XA 3E96A 4EPEC 4IG2A 4AF0A 3QQ0A 3IVUA 1ZETA 2OZTA 3UNDA 2V63A 4L4MA 2C14A 1NDWA 3B8SA 3LYEA 2RJGA 3EPMA 5IFPA 5DG7A 2RDWA 3ZSSA 4XD3A 1TG7A 1JXJA 3P5YA 1WBJA 2FLLA 4LYPA 4ADUA 1T6MA 4GRSA 3HF3A 1XUZA 5K4XA 3MTWA 3RYSA 4U5KA 4QIUA 3UGRA 4G5DA 1I1WA 4Q44A 3QLDA 3GBEA 3G1SA 3W7QA 3F4WA 1SJCA 4QE4A 4DVOA 3LBOA 5J04A 1B4EA 2ALDA 2WQDA 1PHWA 2AMGA 2PBGA 1VHCA 2PDXA 2A1YA 3GILA 3L4TA 2OH2A 3BCDA 3KDNA 1HO1A 2A6LA 4DL6A 4JQ1A 4U3CA 4GI8A 1WOAA 3M6DA 1UKQA 2W0UA 5HJXA 4UTIA 1HKJA 1JUBA 2B31A 1FWNA 2ZFAA 2Z1XA 3BAIA 4XZ9A 3AQUA 1H1YA 3SDOA 2ZCGA 1F8MA 4DRSA 3BWWA 2Q8LA 4GC6A 2GUBA 3KCLA 1OT1A 1OFDA 2ACSA 3LTSA 4N02A 1WZMA 2CPUA 4D1JA 4HT3A 1XSJA 1G1YA 3LHVA 4FI4A 1GOMA 3PPCA 4MKNA 3Q8RB 1S5NA 3U2ZA 4GXWA 4WY0A 1FCUA 1ZAHA 1TX0A 4GFSA 3VMPA 3CB8A 3QV7A 1W3IA 1OC6A 1KM4A 1G01A 3GIIA 4HP5A 2YIHA 2YYUA 4RZ5A 3WNLA 3T0CA 2YDSA 1HXJA 3QJAA 3NQDA 5B7YA 1EH9A 1ME9A 4UTTC 2W91A 2BR0A 3A9IA 3SY1A 3MUAA 1O95A 1UC4A 1Z3NA 4O3QA 3MKCA 1G4PA 5A6TC 3HG4A 1PTAA 4P8XA 3AISA 1TE6A 3VOJA 2OB3A 3BSMA 3V1PA 1S3HA 3SN1A 1Y5WA 3KS5A 3HQ1A 2PDPA 2PP3A 1OG0A 2Z1KA 3C6CA 3L4YA 3L2LA 1X7IA 3FX4A 1RBOB 4DJED 4V27A 1B90A 1FWCC 3WF2A 2BASA 1B3OA 1ECQA 2FHCA 3M47A 3BLLA 5KT3A 4KWOA 1C7SA 3PN8A 1HN1A 3ICJA 3YPIA 3T0AA 3BMXA 1IEVA 1A53A 3WBEA 4NX5A 4YHEA 4V15A 5K2ZA 5C71A 3K13A 7ENLA 2XH0A 3MC5A 2R1NA 2DSKA 1AH0A 4CCZA 4PULA 3U2CA 4L4LA 1A5SA 3MSDA 3N34A 1GG0A 3TYBA 1WV2A 2CIPA 5FJJA 4M56A 1XYBA 1VFSA 2V4QA 3MJMA 3LHWA 2ON3A 4KESA 4KPLA 6XIAA 1PCKA 1J0JA 3MDWA 4X9YA 4YWIA 4MAZA 4GQGA 1FWTA 1WUFA 3GNRA 2D73A 1S1RA 4IQDA 1VAHA 3MQTA 2E09A 1VC4A 5I03A 2ASDA 1O7AA 2VGBA 2CFFA 2D1ZA 1LDCA 4Q4QA 4Z17A 4ZQMA 1R3QA 4AXKA 5EMMA 1MW1A 4GI6A 2J47A 5AY7A 1JCLA 2J8FA 2Q01A 3NFUA 4G2DA 4LAZA 5D8WA 3EDFA 2QCNA 3KBMA 4QWEA 4XD6A 4AWUA 4URIA 4MLRA 2VRJA 3EB2A 1A5KC 1KM5A 5LSMA 2F6UA 2GLKA 3NGFA 5L1KA 1LTDA 1H7OA 1S5TA 2VR5A 4IL2A 5CJNA 4GE8A 1KFWA 1KLYA 3BDKA 4BJHA 4DUXA 2AQ4A 1S9FA 4QITA 1PIGA 5C5JA 2E9LA 3GNNA 3DI0A 4HHLA 2H8ZA 3W28A 5A6MA 4F0RA 3R0KA 4MY8A 4Z2JA 1NARA 4W89A 1OY0A 5L6UA 5LNWA 4DJDA 3F4VA 1T40A 3SO7A 4X2PA 2PDJA 4TMBA 3ANUA 1B30A 3SUTA 5H91A 3OPSA 2DVXA 4Q7IA 3IGSA 3GFZA 3GV7B 2ASHA 5IOBA 1NELA 1VIWA 4ADTA 4FR6A 5CAKA 1GVEA 5DQPA 4DJFD 2VEFA 2BHYA 3AU6A 3KEHA 1TJ2A 1BD0A 5DLGA 3CC1A 1IWPA 2NQLA 4NZ1A 2C1HA 2ZRVA 4C6DA 3FA3A 2X1RA 4I8DA 3H6OA 3TV8A 1UIOA 5KT4A 3IJ7A 1K8CA 5E6ZA 2H9AA 5LA1A 5G2IA 3STFA 3PSVA 1ZBKA 1LL6A 3LPPA 1ONRA 1H7RA 1ZUAX 1OM0A 3S2MA 1GNXA 2PBOA 2QJHA 4C1NA 4ZZ9A 2FJUB 3BLKA 1VIZA 3QZ8A 3DAQA 4Q4OA 3BV7A 3C2YA 3F4CA 1CWYA 1E51A 3KZSA 4FX6M 1AUSL 3TWBA 3V3WA 4KGJA 5LXEA 3ANYA 4LAMA 3MPGA 1UZDA 4C1NB 4ALDA 4AY1A 4LC8A 3C52A 1E0UA 1TPWA 1OF8A 4CU7A 3WQFA 4CUCA 3CEUA 4HPXA 4M6UA 1OK6A 5D03A 4OFCA 4PUDA 4M24A 3CL8A 1XIJA 3MWAA 3ORWA 1YQ2A 3VOCA 2I7GA 1PDYA 3QSRA 5IDIA 3H22A 3PZNA 5BNKA 1I9CB 3EDJA 3W7JA 2IMWP 5AVNA 1TMQA 2VDHA 3T44A 5LNRA 3N11A 2NLIA 4F0KA 3M0HA 3VGEA 3NOEA 3CBWA 2HSAA 4L9ZA 3SUSA 2IPWA 3AIWA 1RLCL 3GBDA 3L0GA 5AC5A 2G50A 3CEPA 4B4HA 4NNCA 2RDTA 4FLOA 3AAMA 4I7UA 4N4PA 3WMSA 1CGUA 1DQUA 4ECSA 1D7KA 1JPKA 4JEQA 2Y5EA 1UH4A 2XVGA 1VYRA 4GNJA 2GZXA 2IQDA 3G8RA 4CU8A 1EZ2A 5DT5A 1IIGA 4M51A 3GTHA 4RNFA 4JFUA 4W88A 4JTUA 5BU9A 4TTGA 3W81A 3N6HA 1F3EA 3O07A 3PJTA 5G5IA 4J27A 5HUPA 1V3IA 3WIJA 2X1TA 3MZNA 4UXDA 3OOQA 1Q13A 3K8MA 4ILSA 4UWMA 3OBEA 3OSNA 4X22A 4DM1A 1ISWA 4JTCA 1VH7A 1HX0A 3MVIA 1A3XA 2AGPA 4O1FA 1VD6A 3GXDA 4ECYA 4MWAA 3GU9A 1BXBA 5EBAA 3M9OB 4LFYA 1UC5A 3VUSA 3VTRA 5IXEA 2XN1A 4YU1A 1Q85A 1UIPA 4D6EA 2OU4A 4IIGA 3WL1A 1X6LA 2W79A 1KD0A 4MWAB 3VFCA 4CGTA 4HPGA 1A3HA 1Z69A 3FV9A 3UR2A 3Q8PB 2NQZA 4MFEA 4YPJA 1QPQA 1SZEA 3CU2A 3ONCA 2FGBA 3LQLA 1JPDX 2FFIA 2F38A 3WDQA 4XVEA 4O16A 1H0GA 4I8YA 1PS9A 4M6PA 2VEIA 4FEZA 3E38A 3PZOA 3PFMA 3QYQA 4QBXA 2PRHA 4FXFA 3GIPA 2NQ5A 3A4AA 3TYCA 2J6UA 3JS3A 1F3TA 3AC0A 1W5QA 3WD0A 3VZYA 4L5ZA 3NZQA 3T0BA 1TPEA 1SW0A 2W7PA 1KTNA 2P10A 3BLIA 1HIZA 1OCBA 1HKKA 5E93A 3W73A 2IKJA 3LCFA 3W01A 3WELA 1WDWA 1JXLA 4YVPA 3R79A 4UNLA 3E2SA 3OW1A 5HAOA 4P2VA 3P67A 2D0GA 2QQ6A 4ECVA 3WEMA 3PTKA 1WQ5A 2I56A 3TDFA 3ZJKA 2VRKA 2WHKA 3MHUA 5CPLA 1XICA 4AH7A 1KLZA