1YRRA

Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
382
structure length
381
Chain Sequence
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVKKTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-acetylglucosamine-6-phosphate deacetylase
publication title Structural analysis of N-acetylglucosamine-6-phosphate deacetylase apoenzyme from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 130
structure length 381
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.5.1.25: N-acetylglucosamine-6-phosphate deacetylase.
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1yrrA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1yrrA02
3EWCA 3TN6A 1XRFA 1A4LA 3MSRA 1EJWC 3F2CA 4ERGA 1EYWA 4C6CA 1A5MC 1ADDA 3URBA 1R9YA 3S2MA 4C5ZA 3T8LA 2KAUC 3BE7A 4L9XA 4EPDC 4I6VA 3MPGA 1PB0A 3GTFA 4QS5A 2D2HA 2EG7A 1P6BA 1KRCC 4HA0A 3OU8A 4JOMA 1GKPA 4GYFA 5FSEC 4RDWA 4DLFA 1M68A 4ZSTA 1FWGC 1BF6A 2GWNA 5HMFA 4LCSA 1XWYA 3OOQA 3MDWA 1KRMA 4H9UA 3AU2A 1R9ZA 4C6KA 4XD6A 4IFKB 1YRRA 4IGNA 4GY7A 4H01A 2E1WA 2VR2A 4EPKA 4PCPA 1RA0A 4RZBA 3PNUA 4RDVA 3UPMA 4PE8A 1HZYA 1E9YB 4C6QA 2AQOA 1FKWA 3GU9A 3F4CA 2QS8A 3B0YA 3NEHA 3RYSA 4IQJA 4IG2A 4NG3A 2Z25A 3UF9A 1UIOA 4D8LA 3QY8A 4PBEA 3S4TA 4IGMA 3WMLA 3C86A 1FWEC 4INFA 1YIXA 1KRAC 4QSFA 4GZ7A 3IJ6A 1A5LC 2P9BA 5HMDA 1V4YA 2HBVA 3B40A 3GTXA 2VUNA 1UBPC 3IARA 1V51A 1FWHC 2FTWA 4HK5A 3CAKA 4KIRA 4C6BA 2YB4A 2HPIA 4GY1A 2W9MA 4CQBA 2A3LA 2ADAA 3A4JA 2R1PA 2I5GA 1YBQA 3MKVA 2VHLA 3JZEA 4YIWA 1EJRC 2CZVA 3MTWA 2R1KA 3SFWA 4TQTA 2WM1A 4LCRA 1I0DA 1ITUA 2WJFA 4UB9A 3K5XA 1WXYA 4OFCA 3GUWA 4CNUA 2AMXA 2UBPC 3TN3A 2R1LA 4RDYA 3E3HA 2Q01A 4B92A 1EJTC 2Y1HA 3UBPC 3ITCA 1M65A 1ONWA 3EGJA 4G7EA 3FDKA 3F2BA 4DZHA 3LNPA 3CS2A 4CNSA 3ID7A 4HJWA 2OB3A 1EJUC 1FWBC 4RE0A 1VFLA 4BY3A 1QW7A 4KQNA 3T1GA 5HMEA 4GX9A 4QRNA 4DI9A 1RA5A 1GKQA 4DNMA 3G77A 4C5YA 4C6PA 4LALA 2P53A 3O7UA 2DVUA 4J2MA 1O5RA 4KEUA 4Z42C 1K6WA 1V79A 3UR5A 4DLMA 4LEFA 1WXZA 3WZ0E 2Z28A 2PGFA 1K1DA 3OVGA 4IH3A 3MVTA 4CQDA 3GGMA 1EJSC 3LGDA 1RAKA 1UMLA 3FDGA 3ICJA 3OQEA 4H9XA 2PLMA 4XAFA 4GBDA 1YMYA 4V1XA 1FWIC 3GRIA 1J5SA 4AQLA 1PTAA 1JGMA 4G2DA 4IG2B 4PCNA 3NURA 4KEZA 3AUOA 2FTYA 3GTHA 4CQCA 4HK6A 3LA4A 4H00A 2PAJA 2HPMA 4KF1A 2OGJA 2GOKA 4H9ZA 3S2LA 1I0BA 3LU2A 3QY7A 4C6NA 3PANA 2Z2AA 3F2DA 2Q09A 4F0SA 4BJHA 2VM8A 4LH8A 4V1YA 2G3FA 4F0RA 4EPEC 1ITQA 2R1MA 1NFGA 3PNZA 4C6EA 5LXXA 3DC8A 4DYKA 1PO9A 1NDVA 4B91A 4NP7A 4C6LA 3O0FA 2PUZA 2AQVA 5FSDC 2R1NA 4J5NA 1K70A 1YBQB 1J79A 3FEQA 3WYZA 1RK6A 2D2JA 4C6DA 3URNA 4WGXA 4IF2A 1EZ2A 2GZXA 1FWFC 4BKNA 4LANA 4ERIA 1P6CA 4DI8A 4H9TA 2ZC1A 2OOFA 3A3WA 1S3TC 4KESA 2PGRA 4F0LA 4C6JA 3IRSA 4QTGA 5G4HC 4DZIA 4GC3A 3MJMA 2ANUA 4GOAA 1EJVC 2YB1A 3OJGA 1V7AA 2HQAA 1ONXA 2Z27A 4H9VA 4C60A 1E9ZB 2D2GA 1FWDC 4P5UA 3MVIA 3GU1A 3K4WA 4EP8C 2VC5A 1DPMA 2Z00A 1A5OC 4XAGA 2HNHA 3IGHX 3S2NA 2QPXA 4CEXC 3E2VA 4XD4A 1POJA 2HBXA 3GIPA 3CJPA 4H9MA 4KEVA 4ICMA 1EF2A 4EPBC 3T81A 3GG7A 4LAOA 4MUPA 3LS9A 2DVXA 2E25A 4C6FA 2RAGA 2P50A 2YXOA 4RDZA 2FVMA 4HK7A 3N2CA 2ICSA 4CNTA 4XAYA 3NQBA 3HTWA 1ZZMA 3GU2A 2F6KA 2WJDA 4QROA 1J6PA 3PAOA 1A5KC 2QT3A 3PBMA 4R88A 4M51A 1M7JA 1A5NC 4B90A 3IV8A 2Z7GA 1XGEA 3SO7A 1FWCC 4DO7A 4I6KA 3HPAA 3DUGA 3ISIX 4C6OA 3QGAC 3HM7A 2IMRA 4CEUC 4H9YA 2GSEA 3E0FA 4B3ZA 4GX8A 2OODA 4WVXA 3GTIA 1RK5A 4R7WA 4E3TA 4IFKA 2XIOA 4AC7C 3K2GA 3A3XA 2BGNE 4GXWA 4L6DA 4QS6A 4KERA 3RN6A 3RCMA 3LGGA 4XAZA 1KCXA 1YNYA 1RJRA 1PSCA 3URAA 3ORWA 2Z26A 4WHBA 3LSBA 3EWDA 2Z24A 4UBPC 3E0LA 1RJPA 3DCPA 3TN4A 4R85A 3QY6A 1J6OA 1FKXA 4KETA 3TN5A 3GIQA 1XRTA 2DVTA 4GY0A 3V7PA 3URQA 1O12A 1A4MA 3UR2A 4ERAA 4PBFA 3IACA 2QVNA 3B0XA 1FWAC 2FVKA 3LY0A 2I9UA 4LFYA 3TNBA 2UZ9A 3E74A 2EG6A 3E38A 5A6TC 2OQLA 1UIPA 2O4QA 2VC7A 1EJXC 4LAMA 2Z2BA 2O4MA 3D6NA 4LCQA 3IPWA 2YZ5A 1NDYA 3OODA 1IE7C 2EG8A 3KM8A 1KRBC 1RJQA 1NDZA 2GWGA 1QXLA 1FWJC 4LAKA 4GK8A 4XD3A 4J35A 2WJEA 4DIAA 3QGKC 1P1MA 3S2JA 5E5CA 2FFIA 4IFOA 1NDWA 3RHGA 1R9XA 5AKQA 3F4DA 5CH9A 3MDUA 4G7EB 1V77A 4NI8A 4XD5A 4ZSUA 2Z29A 3AU6A 1W1IE 3R0DA 1GKRA 4C6MA 3LSCA 1POKA 4C6IA 4IFRA 2Z4GA 2BB0A 4C65A
chains in the Genus database with same CATH superfamily
4LJ3A 3QV6A 5CZJA 4A4AA 1R7AA 2YA0A 1UR0A 1XLIA 3R43A 2ALDA 3VDCA 3RGTA 4MGGA 1HJXA 4FXJA 3Q94A 3UZWA 3T8LA 3TEVA 3BG9A 3G1RA 5H2ZA 3T07A 4AY8A 5C9UA 3QBUA 4Y9OA 3WDJA 6XIMA 4RE4A 3R6IA 3P6LA 3PW5A 4EXAA 4QR6A 5D38A 3GR7A 5D4YA 3NQDA 3FGCA 2QCFA 1V6TA 1P0DA 1FWGC 1F4HA 3BMVA 1ENUA 2E9LA 1Y65A 1QW9A 3ALGA 4CQAA 1GONA 5KZDA 2NX3A 4FEZA 4IGNA 4AUBA 4D6FA 4DL5A 2Y7EA 1ZB5A 1BWVA 5L1JA 3UA3A 7REQB 2BSLA 3GDKA 2W79A 3PUOA 5CPSA 3SY1A 5KG2A 3H2OA 1F05A 2P88A 4ED0A 2A7RA 3NOEA 1SFTA 4LF1A 3UF9A 2V5LA 1UKQA 4NAFB 1IEQA 4LBSA 4UMCA 3ARPA 3GHSA 4ADSA 3LRLA 4QQ3A 2CFFA 3S1GA 5I3IA 2WK2A 3U9IA 2PDUA 4IISA 4JFSA 1WDPA 4GD0A 3CO4A 1FWRA 4B3KA 2PDHA 2FTWA 4HK5A 3EPOA 2V38A 3FA3A 1GYLA 3WIJA 2V9WA 4LYPA 3ZIZA 4ZEPA 4Y2WA 3CEUA 3NPUA 3W26A 3USZA 5DG7A 2OX1A 3RCYA 2QJIA 1TELA 1G69A 4IRDA 1XIFA 4QFUA 3GNNA 1V6UA 2UBPC 2V5CA 2QCEA 1TIMA 3BLOA 1JD9A 1JZ4A 1L6YA 2A5HA 2POZA 4LQ1A 4OTKA 4P7QA 5KFBA 2OLHA 1BLIA 3EGJA 2OR2A 5G5IA 1IEVA 3F2BA 3CYJA 5A3HA 2WO5A 4D6JA 2OEMA 2ZWZA 2A6LA 4B5TA 1L6FA 3TONA 1QWKA 3K13A 2UVWA 4N42A 3SGZA 2ISFA 1N48A 4R8UB 5GJNA 2FJKA 2XFYA 3M9MB 1M7OA 2TPSA 3W6YA 1MEIA 5FI8A 3FY1A 5KFXA 1I8JA 5BW6A 7XIMA 5A94A 3OVQA 1Q4NX 5IBXA 4OOUA 1K77A 2YL6A 1SFLA 3CPRA 3MVTA 4PA8A 3BQ5A 2YXXA 3AIBA 1EJSC 1PWLA 1TJPA 3BVJA 2FHBA 3T0AA 3W7EA 1ZCOA 4PN2A 2PDYA 3EOSA 2YCIX 4M7SA 1FWIC 3P80A 4UQBA 5I3HA 1EP1A 3STCA 1JGMA 4G2DA 1R2SA 1G01A 4RPQA 3M0VA 2WHKA 1BRLB 1HJWA 3M5XA 2DV0A 2E67A 4N9EA 3EX6A 3NCOA 4DNHA 1E6QM 3PFRA 4UTTC 3S2LA 4Q8FA 4HOZA 1K1SA 3F2DA 5LHEA 4X9SA 4LUSB 3DFYA 4GIEA 1KBIA 2BFGA 4RPPA 1F74A 3O06A 4QJ4B 2R1MA 1WUEA 2HISA 1Z9AA 1XD0A 1W3KA 3H23A 2CZEA 4Q8PA 1E5NA 2YA1A 2DZPA 2GDQA 2YSWA 4RZRA 3R7MA 3PBYA 1SJBA 1Q6EA 1OYBA 4F0LA 2XU2A 2YPIA 4GYPC 4FF5A 1HVXA 2PC4A 3AXMA 1FDZA 3CUFA 3AWNA 4GC3A 3RRAA 3D5HA 3G1FA 3WNNA 1E9ZB 4UR8A 1YTKA 2QAFA 4O11A 3KBSA 4E8GA 1TG7A 2AAAA 3ZQ9A 1B3YA 5BWFA 1DJWA 3CQJA 3TQKA 3W0KA 3VD4A 1QBAA 2EJ1A 1TA3B 2ZA2A 1AW5A 3AROA 3EKLA 3BICA 1GQJA 3CM4A 2XUCA 1JQVA 5EWGA 3MUCA 1AMKA 5F7UA 3VDBA 4Q43A 3FA5A 4MB4A 3KZPA 1VRDA 3EPIA 3OSNA 1UQZA 1X96A 1XSKA 4KCVA 1OY0A 2ASHA 4O57A 3CWHA 1ISXA 4CD8A 3IJ8A 4AVFA 4PL2A 3BLIA 1OG0A 1Q7ZA 1M7JA 1A5NC 1M04A 4GZIA 3TW9A 4NHVA 2QAPA 4C6OA 2HZGA 1U5VA 2W9CA 5E0CA 1VLIA 3AXXA 2J7CA 3N15A 4QQUA 1KC7A 1VJSA 3W7HA 1FH9A 4LSBA 3WLRA 4QS6A 2MANA 3QC0A 2A3AA 3KBWA 4LBRA 5DX7A 4H7ZA 5FJRA 1JQXA 1Q63A 3C5QA 4FS2A 4KETA 4ORMA 1TIWA 1SR9A 2A3EA 3SQMA 2ZUUA 5JUMA 1R46A 3FHAA 1XISA 2OZ0A 1UWAA 4AAJA 1GEQA 3M5VA 1E3XA 1MQQA 2YZRA 3O6YX 2IKHA 3H7RA 3BV4A 1FH7A 2RUSA 1KGUA 5CGMA 4ZZ9A 4O52A 4KWWA 5BU6A 4W93A 1X6LA 2GVGA 1UC5A 2NV1A 2DH2A 4LAKA 4UNLA 1PTDA 1DQUA 2Y61A 4XZ9A 3GYEA 1UWTA 2YDSA 3RHGA 3MR2A 5I3FA 3LMZA 1DOSA 5A95A 1ZJHA 4NAEA 1B1YA 3DU0A 1XIHA 3QJAA 5DQGA 5D32A 1XBZA 3STPA 4I7UA 3S1WA 4FLRA 4ZTYA 1FWWA 3E1F1 5TBOA 3KWSA 1EJWC 3F2CA 3ANYA 3T9PA 3A6OA 3FKKA 5I78A 4R27A 5EKYA 5CG7A 3SCRA 4ZCWA 5E09A 3SN4A 1MZRA 5G1TA 3RPTA 4JTCA 3GQYA 3WQ4A 3Q8QB 4U7CA 1V6WA 1W9BM 3OU8A 4OBSA 1KW1A 2IQDA 1QNQA 1YDNA 3E02A 1WZMA 1HX0A 4MY9A 3WCZA 1BYDA 4NUWA 4WCJA 1M7XA 1XYLA 4N6EA 3QC3A 3LMYA 4D1JA 4F2TA 4Z1CA 2P0IA 3WBWA 4K2SA 1TE1A 3KL0A 1NH6A 1Z42A 4FAMA 5AC5A 3MP5A 1EC7A 3WLPA 5FJUA 3SCQA 3GU9A 3WF1A 1S2CA 2E8YA 1HQTA 4Q22A 4IGMA 3C86A 1YIXA 4AG0A 4ZOAA 3IJ6A 3AXIA 1A50A 3E0WA 4ZGYA 1OCJA 3I7RA 3EB4A 1N8IA 4J7RA 4JDBA 5AY7A 2J7GA 4HA1A 5I3JA 5KFAA 4FF7A 2E40A 2IUZA 4HMNA 5JIPA 5KG0A 5FD0A 2NQ9A 5RUBA 2J25A 2F2HA 4NX0A 2EKCA 4R33A 2R1PA 2I5GA 4GYJA 1XFBA 3H55A 1W1YA 3EPNA 3QTGA 4D9PA 1PKMA 1LL6A 3JS3A 4DXXA 4W87A 4JGDA 4O16A 5JH1A 3DFQA 2Y8UA 1XC4A 1I0DA 3FYYA 2BGSA 1K9TA 2XIMA 2VFFA 4WLCA 1JDCA 4YL2A 1O60A 2YCJA 3VK5A 4YTUA 1M03A 1P0KA 4F9JA 1PUDA 3TQPA 2FMOA 3GQCA 1I6NA 2Q01A 4HGXA 1QNOA 1E56A 3ITCA 2WVVB 4GQRA 3TTEA 2B7OA 1OINA 3R8GA 3KBVA 3U0HA 3FV9A 4JPGA 3IANA 4RE0A 4FPSA 1QW7A 2P0OA 2PTDA 4AEFA 3CU2A 3L68A 4AISA 2PBOA 3BOXA 3OBEA 1XGZA 1UR8A 2ABAA 1TWIA 1J0YA 1IXOA 2A7NA 4RNHA 4NILA 1TMLA 4JCMA 3M46A 1V3HA 1RY0A 3SDOA 3CLMA 3WQPA 3CHVA 1WAWA 2X42A 3AZRA 1PKYA 3GUGA 3TYEA 3NQ6A 2EHHA 3AMLA 3W3OA 3POHA 1YNQA 3W81A 4JEQA 3KAOA 4I9MA 3EAUA 2VZSA 2PRMA 3H4BA 4OWGA 3UP8A 4UUIA 9CGTA 2W8LA 1R3WA 4GYKA 2QQ6A 3ANVA 3LTSA 4QIUA 7REQA 3QQWA 4RU9A 1QMLA 4BJHA 2V2DA 3AIUA 1WB0A 4DL6A 3DG6A 2EXOA 2Q8LA 3MUXA 1J11A 4DYKA 2AQ4A 1ZJBA 2VC6A 5M2FX 4HU3A 3NUKA 3DG7A 4NQ1A 3EKZA 4JYFA 3TE9A 1ZENA 1OX4B 2Z1WA 1T8QA 4M56A 3C2YA 4H9TA 3VNKA 5HQLA 1A80A 4WX2A 1X97A 3AIVA 4Q7NA 4DZ5A 2V5DA 1T0OA 3B04A 3UXAA 2EJAA 4M7TA 4DZIA 1FDJA 4OUIA 3NZRA 4RLIA 2QIIA 4F9DA 2HQAA 4LAZA 1RBLA 2I56A 4D6DA 2GJNA 4HPGA 3GU1A 1PX3A 1RPXA 4U31A 4HPNA 1W5PA 2C13A 1CW2A 1H61A 2F2KA 4XKYA 1SU5A 4PMRA 3UERA 3ZVIA 4H1ZA 1VPQA 3R0UA 3T78A 3WLNA 3GK0A 2O9RA 1XHGA 2XM2A 4TVDA 2ASDA 4C6FA 3VVGA 1NWTA 3TR9A 4DUWA 4W84A 2YL5A 2A3BA 1A3HA 3NQBA 3W87A 2HE5A 3MANA 2CBJA 1CIUA 1J6PA 3PAOA 1YQ2A 4UFJA 1WA3A 3CASA 1S46A 2WWDA 3AMKA 4G7FA 4L64A 3KUMA 4ZB0A 2NWRA 3HJZA 2Y4SA 5EA9A 1LQ0A 2YOCA 1UH4A 4JXCA 1D8WA 2ISSA 4M3PA 4NNCA 5F2GA 3PR2A 2Q8XA 4YCOA 5DANA 1XI3A 2OZ3A 2QCLA 4CD4A 1XM3A 3URAA 1NWSA 2WHJA 1OYAA 1W6TA 4W86A 4O13A 2PF0A 1S1PA 3KTSA 4YR2A 1OFQA 4YR0A 1ME9A 1BRLA 4Q6XA 4L7ZA 1F6KA 4I5UA 3REQB 1AQHA 2I9UA 2VZUA 5LIYX 1ZUAX 4NNBA 2VX4A 2YKKA 1IR1A 4JTUA 1CLVA 4UNIA 4J27A 1O1HA 2VTFA 3WDIA 2IQ0A 2XIBA 3SCNA 5KG1A 3BW3A 1UW9A 1DYSA 4JTHA 6REQB 4PTMA 5E70A 4J35A 1V3JA 2J27A 1R87A 4M1BA 1J0JA 3OBAA 4WJEA 4DJED 1E4IA 3LXBA 1W2PA 3VDGA 2XSBA 2WZEA 3WUEA 2Z29A 5HAOA 1TWWA 1POKA 4KWOA 4XO6A 3QKZA 3V36A 1P0BA 3ZSTA 1DJXA 3VNIA 3NQCA 1Z41A 5BOOA 4YHGA 2VGFA 3TK7A 1TPC1 2W8KA 4L5ZA 4Y90A 4BEQA 3BE7A 4HPHA 4ENLA 2WLYA 1LBLA 4WDWA 2FH8A 1NJJA 1GOIA 1TA3A 4O1FA 4JD4A 1QOQA 1ITXA 3AHZA 1AQMA 3AZSA 5CSUA 4GO9A 1H1NA 3CB8A 3Q8RB 3OVPA 3PZNA 1BF6A 3AYVA 1YTEA 4J40A 1HTIA 3CHDA 1W3JA 1BTCA 3L4TA 5EFFA 5KG6A 1DP0A 3TR2A 3UG8A 1MW1A 3AI0A 4LY8A 3MFHA 2PRHA 3MA8A 2W63A 2I1OA 3C2FA 2G4FA 2E1WA 2BBFA 4G1NA 1XYAA 4W85A 4OKDA 3AJ7A 1VFHA 5G1YA 2B7NA 3GXTA 1X8FA 1IQ8A 1LQAA 3UNDA 2Y0FA 2C15A 3F4CA 2PLCA 2QS8A 2PDMA 1UKTA 1MW0A 1H1YA 4AD3A 4U6PA 2X7WA 4K7YA 4K8EA 3U5UA 4Y9PA 4F0KA 2GL5A 4R7OA 3EMCA 1S0NA 1DVJA 2W5FA 3S6OA 2IQTA 3PJTA 2QUVA 3OEXA 4MKVA 4V15A 1DJHA 2E68A 4RW5A 1WQ5A 2HVNA 3WEZA 2HPIA 3RB3A 2WVUA 5TD4A 3CZ8A 1QOXA 1F9CA 4YXGA 2CZVA 3H2AA 3LQGA 2R1KA 3QHMA 3WD2A 1VLWA 4BK9A 4FALA 2W3ZA 2WJFA 4QXIA 3B0VC 1GOXA 3KOFA 4QLLA 2PWUA 2J75A 1KCLA 4ML9A 4HZ7A 2ZRYA 3W2KA 1DBTA 2NX1A 3QV9A 2BXYA 4PRWA 1AH0A 3O0KA 2Y1HA 1MRAA 4K36A 4NF7A 2PWGA 4DZHA 4ZVJA 5C9XA 3CS2A 1J4EA 2PWEA 1YXCA 2O92A 1XLDA 4Q8NA 3G1SA 1QDSA 3N9KA 5H91A 1YE6A 1V8EA 4EXQA 5HMEA 1XDMA 4UC5A 1CXIA 4XX6A 1XICA 4PB3A 4A8NA 2PODA 1U1UA 3UZXA 3O7UA 4Q4PA 4BQ5A 2JEJA 3QZ8A 1S0OA 1VCGA 2VZTA 4HNNA 1JXKA 3GVVA 4K1WA 1E15A 1CGYA 4IH3A 4S38A 3O15A 2Z1XA 3TOYA 3Q37A 3RB0A 3W1QA 2VCAA 3LCIA 3U57A 4H19A 3W7IA 4E8CA 4P2VA 4TV6A 1IXQA 3HV8A 4FS1A 3SEPA 2RJHA 4DBEA 2FGLA 4DAIA 1BKHA 4AWUA 1Q6OA 3MO4A 4IMGA 2V69A 1AA1B 5BNKA 4HU8A 4YQWA 3QZEA 4KFPA 1U5HA 1X38A 4C6NA 3W73A 1GZJA 1PL9A 2JKPA 1XBYA 3ABOA 2XINA 3NEVA 3LI0A 4YPJA 3UPBA 2Y24A 2TMDA 4HT3A 4DJDA 4HVXA 1OF8A 3EDJA 2HNEA 2OMAA 2XJ7A 1K03A 2YR1A 2B81A 4NZ1A 3LDVA 5FSDC 4ICNA 1NIUA 1FHLA 4MYAA 3HZ3A 1KWKA 3OIXA 5LZLA 4Q7IA 1JI1A 3NA8A 3H2MA 1WKYA 2OKTA 4I8YA 3N2TA 3UXDA 3SBFA 4E0CA 1P5BA 3GV8B 2A21A 1VGAA 4PMJA 1JD7A 3IVSA 4GJ1A 3P0XA 4L6HA 3AO0A 3N04A 5IHRA 3LZ3A 1V0NA 4MMWA 4EX4A 4UOJA 1DPMA 3RAOA 2Z00A 3RAXA 2HXTA 3E2VA 3N34A 3WJSA 1YNPA 2VZVA 3LCFA 4EPBC 2WVVA 3G3MA 3TC7A 2PD9A 5AOUA 3RBDA 3C8NA 2GVYA 1QPOA 3ONBA 2FVMA 3GHUA 3GNOA 4XAYA 3O05A 4PBGA 1XLKA 1FXQA 1ME7A 1U22A 3ZFHA 2A2IA 2VEIA 3F4NA 1UKOA 4Q7BA 3G5EA 4GNKB 4J9RA 3QW4B 2VRKA 2QUNA 2GSEA 4DL7A 1TR1A 3CPGA 1HKMA 1LT8A 3RO8A 1GUVA 1EYEA 4RUBA 1X6NA 3T0CA 1D3GA 3N4FA 2XVKA 2PMQA 1HGYA 1QI4A 4Q44A 3E96A 4ECWA 3LK6A 3MZNA 2W92A 2DZAA 3V0SA 1FKXA 3WJXA 3GNXA 2FVLA 4M6VA 3SCTA 1WO2A 1T8XA 1ZGDA 3MKCA 1JI2A 2EG6A 4ICCX 3WMSA 1DWHM 3L12A 3TSDA 3GVWA 4F66A 1CB2A 1HJSA 2D0FA 2NQJA 1XLFA 1NDYA 2RH9A 4AW7A 2EG8A 3TWBA 2UY5A 1KRBC 1ISWA 1ZP4A 3SRDA 4LB3A 2XIIA 1Z6KA 3MP3A 3QGKC 3VMNA 4FIRA 4MIMA 4JKMA 1LJYA 2CLMA 4O3SA 2GGGA 3G0SA 3R0DA 4AXNA 3E5BA 5GVJA 3LSCA 2ZX8A 3DFOA 3W1PA 4GISA 4A29A 5H8MA 4HCLA 1TPH1 3IGXA 4LOCA 3EWCA 3VA8A 4O8RA 4EXBA 2DZSA 4OJYA 3GG1A 1W0MA 3G1HA 3BANA 1K7FA 2KAUC 3KDOA 1EC9A 1F3EA 1WDRA 1XYFA 3DFHA 2EPMX 1RSCA 4I6VA 3LRKA 3WK1A 2G3IA 1JZ3A 1W3IA 2PURA 1PB0A 4QJ1A 2XTKA 2QV4A 4HPXA 4Y9NA 3FJ6A 3RMEA 2RDIA 3PK7A 1GG1A 2UY2A 2PSNA 4FO4A 1AZ2A 3HN3A 4ZSTA 3IGUA 2TYSA 3M0ZA 3TQVA 2F84A 3LPGA 1XWYA 1XLLA 3I68A 1TPVA 3Q4DA 4BWLC 3BAJA 3LN3A 3WMBA 3H2EA 4HHMA 1S2AA 2ZDRA 5EFDA 1U30A 2CESA 3S42A 3BPWA 3HGOA 1Y5VA 4IFKB 4PZVA 1UOKA 1OC5A 3S5OA 3GXMA 4DUOA 3TYCA 3EXSA 3QV7A 2XN2A 3LHZA 2DZVA 3O6CA 5AYIA 3NEHA 1SZFA 3PBUA 5A69A 2R94A 4X0VA 2QXWA 3NO1A 2DY3A 4OECA 3OHIA 2POTA 1A53A 4CN6A 2V81A 3UGVA 4X61A 2CC0A 3V5CA 3M0XA 5PTDA 1VBRA 3OBKA 3UYCA 4CD5A 3RXZA 1OGSA 1V51A 1QI3A 1FWHC 1W3NA 1K1QA 2Y5JA 2YBTA 3CAKA 4L9YA 5FF2A 1M9HA 3REQA 5B7YA 3B8UA 3V6JA 4Q4QA 2DUXA 1UZ1A 3FYPA 4CQBA 3A4JA 3BOLA 1O5XA 1Q6LA 1TJRA 5GJMA 1VIWA 2R8JA 3M0LA 1EP2A 4M6UA 3SFWA 2WM1A 2YX0A 4AD2A 3K8KA 3NVDA 1S2UA 1Q66A 4X2RA 3S1XA 3TMQA 1CENA 2WBGA 2ZIDA 3AIQA 1KFBA 1WZLA 6REQA 4ZQRA 4AEOA 4EYHB 3BV7A 5G4WA 3XIMA 1CGVA 5D8ZA 4GCAA 4K37A 1XUZA 4XTDA 4W7VA 6ENLA 3ELFA 2D1ZA 4UOZA 4L4PA 3ID7A 3DDMA 3FXYA 1GK8A 4F0MA 3A21A 1KXQA 3U7VA 1JZ2A 3DHDA 3M0IA 3TSBA 4HCDA 4WK9A 5D2WA 4QG9A 3H4XA 2VEPA 2QGHA 2OH2A 5C2CA 2PZNA 2HMCA 2HEJA 4EKJA 1LLZA 1Z32X 1QUMA 3B0PA 2BQUA 2FH6A 2PLMA 1KBLA 2GK1A 1FWNA 1C8VA 4M1RA 1JPDX 3KL3A 1S97A 2IKIA 5BXTA 1RP9A 2WZIA 3W70A 3LA4A 5DMLA 2PAJA 1XRSA 4WXZA 4H6KA 1CDGA 4J3ZA 1NVMA 1JG9A 3KLLA 2J4GA 1SZGA 4JL2A 4F4WA 1MSSA 1DWJM 3MHUA 2FLPA 1O4UA 4BEUA 3WDQA 3O0FA 2OCZA 4PMNA 1T41A 2MUCA 3W1RA 3FEQA 5L6UA 2V3FA 4ACZB 1Q45A 3EMQA 4DO6A 4LANA 4R34A 4GLEA 2VC9A 3VZZA 5EMMA 2PGRA 4GIYA 2F61A 3FKRA 5A2BA 1A5UA 1C9DA 5DMMA 1AK5A 3U2CA 4WKHA 3P14A 1MUCA 1JPKA 1V7AA 1CXKA 3MBFA 3GAKA 1LLOA 4Z0SA 5D2TA 2OSYA 4BF9A 3KHJA 4KRZA 1FHDA 4TVCA 2PP3A 4DJFD 3QSTA 4WZHA 3BLPX 5DGBA 2DPIA 3TH6A 2DPJA 1XP3A 3WJWA 4FLOA 3NZQA 3GG7A 6ALDA 3ITVA 4Q8WA 2F8QA 4ZB5A 1B30A 2OPJA 3P5ZA 1ONEA 4CCDA 2QT3A 1A49A 5CZTA 3VKJA 3WQFA 5DLCA 4I6KA 2Y2WA 4IT1A 1W91A 1XD1A 2J74A 4ONVA 5CGTA 3INPA 4GXWA 2BHUA 4PCTA 2OLAA 4GE8A 3H53A 3LGGA 1S5NA 2WMJA 3VNZA 2E0PA 3RB4A 1JUBA 3L2IA 3ORWA 5LIKX 2Z1KA 4LB4A 1QOPA 4FNUA 3QY6A 2CITA 3SM0A 4S39A 3ARUA 3G6XA 4BI7A 4O1BA 1FWTA 5DN1A 2ZFAA 3E0VA 4LFYA 3U2EA 2D20A 4IP7A 4MWAC 5GNXA 1JF6A 4A2SA 3WQCA 2VX6A 3QHOA 3N6HA 3RJXA 3KS5A 3L4YA 4WSHA 4AWEA 4J3TA 3MWCA 4FX7A 2DZUA 3EDDA 1YPFA 3STGA 1V3LA 3EX3A 4WDXA 5F9NA 3C2RA 4EBCA 1VF8A 4DIAA 1M53A 1HKWA 5HWMA 4IPJA 1GTEA 3CTLA 3L7RA 4NRRA 1JNDA 1MEHA 1FFQA 3PTKA 4QDWA 4TO8A 4DBDA 1VCVA 1L2QA 1W1IE 1QPRA 4IOTA 1JF5A 3IAPA 3EKGA 1J18A 3HGSA 2ASLA 2GQAA 3JUGA 2BB0A 5M03A 3VMPA 3TJXA 1Z8AA 3VKAA 4ED6A 3BSHA 1C92A 1ZNNA 4M6PA 1LORA 1RQEA 3GXPA 1YE4A 1Q2SA 3OSPA 2J62A 2OEKA 1IIGA 2DUAA 3S5ZA 4GC6A 1T7LA 2CLLA 4GVFA 3WBAA 4US5D 3GTFA 1Y8BA 5DG8A 1KO0A 2JEFA 5LXEA 5E9AA 5C7HA 3SJNA 2WSRA 4DLFA 3FK4A 4CU6A 5IDZA 2GWNA 1EXBA 4MDPA 4DWSD 4W5UA 3A3HA 3AZTA 1IIHA 3BAYA 3KS6A 4C6KA 3W7GA 4NJHA 2VA3A 2AGTA 3SCSA 2IXUA 3DOPA 3QR1A 2VWTA 4Q4MA 1RA0A 4S23A 2QMJA 4WOZA 4WXYA 1Z44A 4F4ZA 2XH0A 3UY7A 3Q8PB 2AQOA 1SM9A 4UFLA 2X09A 2ZXQA 4RUCA 3EBVA 3EEGA 4F79A 1SYTA 2ZZ4A 4WEVX 1JPMA 3H2FA 1UUQA 4X3ZA 2DFAA 1RLCL 3GLCA 2IPJA 1KFKA 1KRAC 1HL9A 4LX4A 5F4WA 3HPSA 3W07A 2VXNA 4UMBA 4PTNA 3ERPA 4IQLA 3KL5A 1OADA 2BQRA 2NQ5A 2ZRZA 4S3DA 4Y8FA 1UR1A 2UVUA 2CBVA 1LRNA 4AD5A 3ABZA 3S83A 1LQ2A 2Y7GA 3ZT5A 4KW2A 5H6HA 5KFGA 5HMSA 5D09A 4UFIA 1EJRC 5CZKA 1JDAA 4Q8QA 3W86A 1FOBA 4L4MA 1UG6A 1QW8A 1DWFM 3G6LA 4E5TA 1SJCA 1NELA 4Q8MA 3NFUA 3QMTA 1ZBCA 3R58A 3WO8A 2GSHA 2PRLA 3PBWA 3RLGA 3W85A 1UA7A 2DZWA 3MMDA 5MHBA 5I09A 1UR9A 3L67A 3NGDA 1XFCA 3WD4A 4HJWA 5M3WA 4IXHA 3LLFA 1KXTA 5XIAA 2QUUA 2ODOA 4LRSA 3SUTA 1QT1A 2A3HA 4DI9A 3TYBA 3W2NA 3M47A 4RV3A 3S9ZA 2R8IA 1UUOA 4Y9MA 1UD8A 1H0GA 4XUGA 2Z28A 4FBTA 3F4WA 1DJGA 3U2OA 5EMJA 3SR7A 2JEQA 1VKFA 4EYIB 5KFJA 4CQDA 3DHUA 5F2IA 3PG8A 4Z1BA 3EEZA 3VIIA 1JUEA 1HUVA 4RUAA 3WF2A 3GC2A 2VQTA 3L0NA 2OWWA 4JEJA 4ZOBA 1PJ9A 2WKGA 4JTFA 3UY8A 2OO6A 4GO8A 4MZ8A 1NQ6A 4YHEA 3GTHA 4EE9A 4E3VA 1LBMA 1RCOB 3DYPA 1WV2A 4YWIA 4H9ZA 3L23A 2ALZA 5KZEA 2PA6A 4QE4A 1D7KA 3AS1A 2PE4A 1KR1A 1KTNA 3PZQA 4PTXA 2VM8A 3T5LA 3STFA 1XG4A 1ZCCA 4I9JA 4IL2A 1W3TA 1ITQA 3ABRA 3AC0A 2XCAA 4LYRA 5HQEA 3TV8A 1D7FA 3WQ5A 4BF5A 4RE3A 5M5DA 2GJXB 1JCLA 4NP7A 4C6LA 2PUZA 4LEQA 3FVDA 4AZ7A 4CNPA 2QULA 4JTGA 2W9AA 3IK4A 1TPDA 3T44A 3URNA 4K1GA 2GUBA 1K4GA 4JV1A 1JDDA 2CCRA 3UESA 1N82A 2V82A 4H3DA 4DI8A 1VCFA 4ZENA 3F4VA 1S3TC 4PYSA 3GXNA 3VE9A 1XIBA 3I7QA 3RILA 1TCMA 1W5MA 1TWZA 1EIXA 3FAXA 1TPFA 4DZAA 2WWCA 1F7BA 1XPGA 1G9HA 1TJ1A 3P67A 2FZNA 3IJDA 1EA9C 3PZTA 4C60A 2D2GA 4LUTA 1VR6A 7CGTA 1Q7QA 4UQAA 3O16A 5CJNA 2TRSA 4WRHA 3WNOA 1NTHA 3NQ2A 2FPTA 2XVNA 1E9LA 1IZJA 2ZA3A 2XGIA 1Q85A 1ZJAA 4JQAA 3GY1A 1W1TA 3W1NA 1T6MA 2B0MA 3WUBA 3VNYA 4FIQA 3PJWA 1G4EA 4LVFA 2QUMA 4XZNX 2GGHA 4HZ8A 2INEA 4E2VA 5KFLA 4H4IA 3SCOA 3WEMA 4GKTA 4JV2A 3S8HA 4RDZA 2JIWA 4EACA 5KT2A 3R12A 4HTBA 4WIWA 7ODCA 3ZWTA 4JUZA 1KTCA 3LXCA 4J9JA 4QROA 2JBMA 2ZC8A 4R88A 1WUFA 4XG1A 3SO7A 1XGEA 4O0QA 3SW6A 2PWHA 1S2VA 3BSMA 1TTQA 2DSZA 4H2CA 4QGCA 4E3TA 1KQYA 2H6RA 2ZUSA 2WSPA 4S3BA 3GIKA 3HU7A 2E8ZA 4DN1A 2BGQA 4LY4A 3M0KA 4WUIA 3WLOA 3QF0A 1MO0A 3K46A 5HJYA 3SUUA 1N8WA 3POCA 1OGGA 4GUHA 4O1DA 2A1YA 1R3TA 3V7PA 2DSWA 5L9FA 1LDCA 3OLEA 2QVNA 1FWAC 4XZWA 1ML1A 5KFZA 2YW3A 2V4QA 2JF7A 1UZ4A 1JFXA 2J77A 1KLZA 3GE7A 1RZMA 2QCMA 4OHQA 2DZTA 5AHFA 1R3VA 3IPWA 5A6LA 4AMCA 3F5KA 3OODA 1PTGA 5GJPA 1QCWA 4DJEA 1CLKA 1PYMA 3GNDA 1YLVA 5BXSA 2WC7A 2BZNA 3W24A 2QJJA 3VIHA 3H12A 4MYXA 5HPOA 1LOQA 1JYVA 4ACZA 1QHPA 4K8HA 3TP4A 5CPNA 3VUPA 2J6SA 3N14A 1NP0A 1BQGA 1K7XA 2DZXA 2WNWA 2R8KA 3OLDA 3SN1A 4ECXA 2HXUA 4UIOA 2WC3A 4IFRA 3DG3A 1G4TA 4JYDA 3TN6A 3R4IA 1XKJA 2YIHA 4YYCA 4K8GA 3BLEA 3BSGA 5CAKA 1VEMA 2ZXAA 1S38A 3KOWA 3A23A 3NM3A 3FDSA 1BXNA 1JCNA 3NZ1A 3DBNA 3IJLA 4QWAA 1NARA 3MPGA 1X7FA 1JPIA 1B4KA 1E55A 2D2HA 3E2QA 1QNPA 2AGPA 1WP6A 3AWOA 3PUGA 3S5NA 4EK7A 2XFWA 1DIEA 1TRDA 1NOFA 2W9BB 4LVBA 1SSGA 3VZXA 3V6KA 4C7GA 3CQ0A 3ATYA 4ROPA 3D0CA 3OGVA 2VELA 4PUEA 1GVOA 3AU2A 5B7ZA 3L66A 6TIMA 1T96A 5I02A 1O7AA 4ZE5A 3AS3A 4UTHA 1QBBA 3LPFA 1Z48A 4YMZA 4O14A 5C8BB 1EHAA 3PWIA 4RDVA 2W91A 4UCFA 3GC4A 4LBUA 4YWSA 4L1GA 2RFGA 4C6QA 3P82A 3U6WA 4EANA 1UP2A 4GBUA 1H51A 1OSEA 2G4JA 1V0KA 2C19A 1REQB 2J66A 2RDWA 3DERA 3N29A 3ZYZA 4H41A 5CC6A 4XZMX 1S2WA 2DEPA 4JIEA 2HBVA 3W82A 4QAWA 3ARTA 2HS6A 4HSHA 3BQ1A 4A21A 4FHAA 2XFRA 1V0LA 3LERA 5U7SA 2VDHA 1J96A 3W1TA 1B4EA 2PS2A 2QCNA 3O3RA 4AZBA 1PPIA 3MTWA 1EL3A 4LNYA 4E38A 3QQ0A 1GYMA 2GGIA 1RUSA 5KFNA 1DQWA 4HPJA 4KT2A 1V6VA 3VIPA 1EIBA 3GSMA 2R1LA 3C3NA 3BQ0A 3E0IA 3E3HA 3IIZA 3LNMA 4DUXA 1W54A 4HSNA 5FF7A 3EA3A 4L65A 2VRQA 1RV8A 1SUXA 2KX9A 4LS2A 4TX6A 1CWYA 1RH9A 2OT0A 3QMRA 5IDIA 3BJFA 1H7WA 4LW7A 4M82A 2Q71A 5DLGA 1J10A 4QRNA 3L5MA 1XQKA 3W7RA 4WKFA 5I2UA 3FGCB 1HKIA 3SUWA 3VABA 2W61A 2P53A 2DVUA 5J04A 1O5RA 4W8LA 1V79A 3QKEA 3CL8A 2IXVA 2WSKA 2QCDB 4LEFA 4PMVA 1IYXA 1CXHA 4UQCA 1K1DA 3G6VA 3SECA 2CHNA 2QJMA 3TCSA 3WH5A 3TX9A 4R53A 1C9WA 1WOAA 3PTDA 1KFJA 1JX4A 1E5JA 3IEBA 2INFA 2PGEA 3C3UA 4EOUA 1DXIA 2ABBA 1AD4A 3V0TA 3FDGA 1E0TA 3TJLA 2YW4A 2C71A 4ATDA 1JAKA 5DQPA 1TVLA 1AG1O 1L9WA 3QZAA 2A79A 5HNRA 2BMBA 2VMFA 5G2HA 1L8NA 3FA4A 2FZBA 1EXPA 1LP6A 2OGJA 3RX2A 1I0BA 2NUWA 3HG5A 4BR1A 1JCJA 3PANA 3MFIA 3BOFA 3UG4A 1R30A 4GJIA 3WELA 1E3ZA 5A6MA 2FGBA 5C5JA 1GZ1A 3I10A 2XPKA 2V67A 3TTSA 2AKMA 2E6DA 1ZTVA 4ZQCA 3OLGA 4DPQA 4QE5A 1FP8A 1LL7A 4WY0A 4NU7A 3WYZA 1J5TA 4V27A 5KFPA 2HWGA 3IK2A 5A6SA 2ZTJA 1AH3A 4YTQA 4XBKA 4CD7A 1A0EA 3N11A 4MJZA 5C70A 4QTGA 4FXRA 3RUBL 3BCDA 3R94A 2WMGA 4GOAA 5HK4A 1JZ5A 5I06A 3CUXA 1EBHA 3EWBX 2ZRXA 1H7XA 4MLRA 1ZJIA 3KTCA 1FUYA 2CHOA 3U3HA 3SRFA 3EWZA 3VNJA 3G6YA 4H8VA 1HT6A 1TWSA 4GC4A 1XLBA 3KOYA 4DWSB 2C6QA 2NXGA 4HNVA 1Q13A 5A5WA 4AWTA 4KEVA 3PW2A 1OD8A 3GM8A 3R10A 4LAOA 3DECA 1DJIA 2QJGA 5KFTA 3JU2A 3SFKA 4DAFA 4JTSA 1JDEA 3BAIA 3FSTA 1YHTA 2ICSA 1SR0A 4JX5A 5DQHA 1M41A 2XGQA 1UKPA 1VPYA 1MFUA 4ECRA 1XIDA 2PDBA 3PVFA 1AJ0A 3NYZA 4GZJA 2ZTKA 2NVDA 4AIEA 4GZEA 4CEUC 3KEHA 4U2ZA 4JTJA 4R7WA 5KT6A 2WMHA 3SI9A 2ISVA 4PUKA 2GUUA 3NL5A 3IIOA 4JX4A 4O1EA 4UZSA 4Z2LA 3SIMA 3TYZA 2WNZA 1YKWA 1SFSA 1LYXA 2O9OA 5I79A 3CH9A 4UOQA 1W2VA 3BQ6A 1UP0A 1TV8A 3IAQA 3IV3A 3LY0A 3ARRA 2XZ9A 4ATLA 3B97A 5E0KA 1PIIA 4HN4A 2XSAA 5BMXA 3TCEA 3EDFA 2Z2BA 4JCLA 3W7KA 4AHOA 2W67A 1SO6A 2JGQA 1BG9A 4NYUA 3VDHA 4IMFA 1FWJC 1K9EA 3CIVA 3CQIA 5KG4A 1TV5A 1CGXA 3AMCA 3PPCA 1P1MA 4IMAA 3U4AA 2VDGA 1XH1A 2CPUA 4XZBA 3RNDA 2X7VA 2VFDA 1PIFA 2VGBA 4QEHA 4XD5A 1OM0A 4GMEA 3BWWA 3H8AA 1AL7A 1E6SM 1OFBA 4C65A 3WLMA 4MF4A 5D30A 1QI5A 3PG9A 4O12A 3AS2A 1E43A 4ZQMA 3ZLGA 2VWSA 2PP0A 3PAJA 1R9YA 4C5ZA 3W83A 2PI6A 1O68A 3BCJA 3PZPA 3B9NA 4HA4A 2Y62A 4ECYA 3ONCA 1G1YA 4K68A 1JXJA 3PPFA 1XC6A 4H6RA 1T3NA 3GFYA 4FNSA 5FSEC 1E6XM 1K8XA 1JVNA 3AHVA 8CGTA 2J6VA 3LBCA 3NOYA 5A6BD 4P7NA 4QLJA 2YGYA 1JCXA 1EDTA 4WGHA 1V0MA 5IXEA 2CXGA 1KRMA 1GW1A 4OV9A 3MV11 1SZRA 1QATA 4FI4A 2VL4A 2IPWA 4GY7A 3SSZA 1M5WA 1HIZA 4WSJA 2QF8A 2YXGA 3EA1A 4JN7A 3UPMA 5HINA 4QWBA 4IJBA 3EXRA 1FKWA 1TZZA 1B9BA 3UCDA 5KT7A 3B0YA 4OOZA 3HFTA 4NRSA 2PBGA 4TR9A 4IPLA 4BI5A 3VILA 1FWEC 4AZ6A 5KFRA 5I3GA 4Y8EA 3B9AA 3M0JA 3SCPA 3AAMA 1QNSA 4GI6A 3GH7A 9RUBA 5FACA 4AF0A 7TAAA 5CBIA 1TPEA 1W8SA 2RKXA 2CHRA 3W1MA 2XCPA 2CLOA 3JRKA 4QLKA 1B3VA 3M0HA 5I6SA 3ITYA 2VGIA 1XDLA 3KRBA 3SY8A 2VD9A 3B4UA 3PZGA 5BXRA 3RRXA 3FIGA 1ITUA 1Q7MA 1AH4A 1TUFA 2A4AA 4YS1A 3HPXA 4G8TA 1S3HA 4CU8A 2J78A 2ZZ5A 3Q65A 3BQ2A 5BRPA 3UZJA 3L4ZA 5EY5A 3P93A 5C54A 3MI3A 4PEEA 1BYBA 2X2GA 4ORIA 1XXXA 5KFMA 4JFUA 4JICA 3NWRA 1MZHA 3USBA 4XZIA 3W53A 3PZUA 1VBJA 3VKDA 2XHYA 1Z69A 1RCXB 3W2JA 4N4QA 1E1CB 3P8JA 4PGLA 1NU5A 2PDIA 3LQLA 3VIKA 3ZSSA 1CXFA 2FZ9A 1FTXA 5G4EA 3LPPA 3O63A 1EUNA 3J7HA 4Q4RA 5D05A 2O0TA 2HK1A 2DIJA 2VFIA 1UMLA 3VZYA 2PFHA 2W9BA 1VRXA 2ALRA 3OQEA 4HCHA 4YP3A 3NQVA 4KFNA 2VENA 2E28A 5JBFA 2R8WA 3G18A 4CCZA 5FJIA 1GVIA 4JQ4A 3ARQA 4JIRA 3PTQA 2X41A 2FKPA 7PTDA 4PCSA 3T42A 4BCEA 4JTTA 3QY7A 5FF3A 3L2LA 1BGAA 3HMCA 5CPOA 2AKZA 4QDPA 3JR2A 3M64A 1P43A 3BW2A 1SO3A 3WX7A 1REQA 3IVUA 2DSVA 4JN8A 3ARWA 5KFFA 1NP2A 4PMUA 4S3KA 1NSJA 3O8AA 2CBUA 4AWSA 1KQZA 4IPNB 5HR6A 2BLEA 3N12A 2DDXA 4QJ5B 1RVKA 2X30A 3QVQA 1EX1A 2OOFA 1VENA 3MT1A 3WBYA 4CVUA 1FCUA 1TZ9A 3B4YA 4FS9A 3H4WA 4BFAA 1QFEA 3H7UA 1R85A 2GUYA 2ANUA 1PCWA 3MMWA 4DJFA 4D8AA 4M80A 4KWVA 1XKYA 1D8CA 4C7DA 3UJRA 1UUMA 3OZYA 4S3FA 1KKRA 4QNEA 4XAGA 3VNLA 3IGHX 5T91A 3C2EA 2BQ3A 1HG3A 1WDWA 2DP3A 2O9TA 3UD6A 2BVTA 3GIPA 3P61A 5AYZA 1I2QA 3UYIA 1XPYA 2D24A 5AHLA 2Z0IA 3VMOA 2IBKA 3TAOA 5IBXC 1UD4A 4O18A 2P8CA 2O56A 4PRRA 4AY7A 1FCVA 3F7JA 1L8PA 4OUEA 1IWAA 1L6GA 3VGEA 4N7QA 3QOKA 2JFEX 5DMYA 5BCAA 4O3NA 3QFEA 1HN1A 1OBAA 1H41A 3IV8A 3OZMA 1Z89A 5E1QA 4Z2KA 2B4GA 4DO7A 3A64A 3EB3A 3R8RA 6PTDA 1S5TA 2QCDA 5FJJA 4RX0A 4H9YA 4WY0F 5DCDA 3I3EA 1RK5A 5DCBA 2Q3OA 1Q6DA 1J0ZA 3W7JA 1R86A 2D0HA 4UFHA 1LROA 1BWKA 3L9CA 3RCMA 4IJRA 1E9IA 3E5PA 4J9SA 1ISYA 1DJZA 5LA0A 2FLNA 3KRUA 1U33A 1ONRA 2DH3A 1GWJA 3WNKA 3CZKA 2BDQA 2C8NA 4MNMA 4ERAA 2ZX5A 1KM2A 3UR8A 4HMDA 4F2BA 1EUAA 4E6MA 5K9CA 1HL2A 2ZZ6A 4OBRA 1OD0A 1IGWA 4E4FA 1EEXA 2O4MA 1XYBA 3HG2A 5AHEA 3U7BA 2I5QA 1CNVA 4B5XA 4N2YA 5T9CE 1IE7C 4AZCB 2YBUA 5TQLA 3MO7A 5D03A 3RLHA 3ITLA 3TW7A 1U83A 4XD3A 2ACRA 3SIZA 3VFLA 4B2DD 3S2JA 4DXVA 5E5CA 4GVHA 2IW0A 4M5PA 2E9MA 1VEOA 2QKFA 2Y85A 4XKYB 2NVAA 4UTWA 3VOHA 4JKLA 3NR0A 2ISDA 2PC8A 1XRFA 2QDEA 3UR7A 4US5A 3VINA 5FF4A 1ADDA 3GNRA 5L1KA 4UTUA 2JF6A 3L4UA 4GQBA 4FK9A 2XSXA 2ZUWA 4I7VA 3EX4A 2WCSA 1E6PA 3MV01 4DWSA 1Q6CA 5H1WA 4FXFA 1S10A 3HIJA 4DO5A 2CZDA 1RD5A 1W1ZA 3RLVA 2OFJA 3UG3A 3PR5B 1IT7A 1VHCA 5DQIA 2C2EA 5KZ6A 2D0GA 1UWQA 3H2NA 4WKAA 5J8LA 1E4LA 4NZ4A 1U1JA 2D2OA 4D6EA 4W88A 4QP0A 5AYXA 1KGXA 4L1WA 1ZAHA 3EPMA 1WCGA 1S9FA 4JTIA 1FBAA 4K39A 3C0JA 4HNUA 3GR4A 3OHMB 3TOPA 1THFD 3VE7A 3RIKA 2PF8A 2G41A 4N9CA 3VGGA 5GPRA 1H5VA 3MCNA 4UQ9A 1UZDA 4ECUA 5CJ5A 2PTZA 3OQ8A 2EEXA 1HJUA 2D3LA 3RJYA 1V4YA 3B40A 2BODX 3QPEA 5HNNA 2VUYA 2NSXA 1RCQA 4N6FA 2V6AA 5KFKA 5D37A 2YBVA 1F73A 1UJQA 2ADAA 4XB3A 2BY1A 1EGMA 1YBQA 4GUJA 2OT1A 4HBKA 1QPNA 2BP1A 2CU0A 2XIQA 1GOWA 2BY3A 3KBJA 2G96A 3CMFA 1G7VA 4TMBA 3T0BA 3TC6A 2VKZG 4U3CA 4CNUA 3MUZ1 1UD6A 1G4SA 2EPNA 5LNRA 1ICSA 3ME3A 3BTNA 1DHPA 3I3DA 2WHLA 2FMNA 2E77A 2PDQA 3QQ1A 4D8ZA 1L2UA 3LI1A 3BH4A 1E4MM 1B31A 2ZICA 1OGBA 2OKOA 4P7RA 3K4DA 1P48A 2OQYA 4GWEA 1R3RA 3WY1A 3FJ4A 3OA5A 1TRIA 2XN1A 4I9AA 1TTJA 4PMXA 1X1ZA 2PDGA 1PBGA 3MZ2A 3CWOX 4AXKA 4KEUA 1PAMA 1GOOA 4YR3A 4Z2IA 2AOSA 3DKJA 2FFCA 3VGDA 1SW7A 5EDWA 2E5CA 1XH0A 1FHUA 1BGGA 4IWWA 3BXWA 4WSKA 1XL9A 2FIQA 1RAKA 3N9SA 5E0FA 4GNVA 4JAWA 3ZO9A 1SGJA 3N6JA 2EAWA 1D2KA 1SPQA 4XAFA 2I16A 1YMYA 4OE7A 1D9EA 3GRIA 4MADA 1PZ3A 3RITA 3V18A 1DORA 4QEEA 4CQCA 3IVTA 2C1GA 2GSJA 4PMZA 5E9XA 1JR1A 2GLKA 5A8PA 3ECQA 4QDMA 3PZOA 3G6MA 2BVDA 4ZBCA 3FLUA 4F0RA 4O1CA 5GNZA 3ES8A 1RQHA 1RP8A 1XLCA 1HKVA 3NQ7A 4FOJA 1DE6A 4LNCA 4ML4A 1J0KA 2JKAA 3H4DA 5SWUA 4HQVA 1KLYA 1H50A 2PDJA 3D47A 1EP3A 3GS6A 4JIHA 1E6NA 1Q8JA 4X2PA 2HK0A 1BVWA 1GVRA 2NZLA 1EZ2A 4BKNA 3ZLFA 1VAHA 3T0DA 4C6JA 2JQXA 5BU9A 1U1HA 3GZ3A 3IRSA 1DL3A 1XRVA 4UTIA 1MRQA 4EVZA 2NV9A 3W6MA 3CLWA 4JIQA 1RPKA 3HQPA 5M17A 4EBDA 3H2CA 1GVSA 3OA3A 4O4WA 3O07A 5AC4A 1CT5A 4CEXC 4F40A 4G3IA 1XR2A 2J88A 3Q45A 2Z1VA 4UTMA 4FNQA 2D23A 1ZU8A 2XGZA 2DJLA 1AMYA 2DW7A 1V5XA 5EYWA 3V1HA 3BZJA 3E12A 1O5KA 4HK7A 1R7OA 1ISZA 2SFPA 1H1ZA 4X60A 1E1CA 1BXBA 4DX3A 2ZXDA 2IPGA 1A5CA 1GPWA 4C7FA 3KBNA 1I1XA 2V9DA 5KFQA 1E0WA 4IIGA 3W1AA 3FYOA 1XYMA 3V0UA 4LS0A 5FEXA 2BGNE 4ED7A 1PEZA 4HD5A 4WOQA 1KCXA 1FXPA 1RJRA 3BURA 3C8FA 4U28A 1EA0A 3TN4A 5J5RA 4IJCA 4JIIX 1OT2A 4PUJA 1ICPA 1XRTA 1NAL1 5ECUA 3UR2A 2VCCA 3TJIA 2G37A 2XGBA 4LTSA 1O66A 5ECVA 1DQXA 1GEHA 2G50A 3E38A 4QG8A 1V02E 1UIPA 1VBUA 5ABEA 3AICA 1G4PA 1P0NA 4PODA 1G94A 4ECVA 2V68A 1OX6A 2VVNA 3FOKA 2ZZ3A 1GYNA 1R5YA 3HURA 3ARVA 4XVEA 1B54A 2G3JA 1AODA 1PHWA 2FGZA 2CERA 2VEMA 1BD0A 3S3GA 1OG6A 1NF7A 4AZGA 3IJIA 4PFHA 4K6AA 4V2XA 1R9XA 3GH5A 4J9OA 4Y7EA 1L0PA 3M0YA 1AW2A 1BVZA 1XLAA 2VEFA 3CMGA 2CKRA 4AHPA 4S3GA 5GNYA 2BG5A 2J9YA 1N2VA 3KBMA 1V7YA 3TUUA 3MUY1 3TZFA 4DEFA 1ZQ5A 3M4HA 4ERGA 4DELA 3PS7A 4KCUA 1GQIA 3OVRA 4NZ3A 4UTKA 1KFEA 4JTLA 2ZRVA 4A8LA 4EEYA 4I7WA 4YLWA 1RR2A 2UY3A 3PUEA 3MCOA 4QS5A 3TIMA 1P6BA 1EGVA 2V4RA 1U2YA 5BWAA 4RDWA 3WLSA 3WQ6A 3NXLA 2V63A 2AGQA 3GWQA 3MB9A 4MOZA 4G9PA 2H90A 4FR1A 4ECZA 4L61A 1EBGA 5D2YA 3CUGA 4RZ4A 1YXDA 5T9BG 5AVHA 4H01A 1KM0A 2Q8ZA 2C1IA 3CUJA 4MSSA 2DQWA 3WUGA 4TTGA 2W7OA 4MJ4A 3W7CA 1XIJA 2OWXA 4RNFA 3CV1A 2X0YA 4ROQA 4JQ1A 4Y9AA 4IRCA 3R11A 2ZA1A 1WPCA 3RU8X 2VOMA 4S1FA 1TMQA 2C91A 4FSAA 3TU9A 3GVRA 2Z25A 3WLQA 4GA8A 1XSJA 1LL4A 4J1OA 1R2RA 2QJHA 1LG1A 1YXYA 4KRTA 4B4HA 5HJLA 4X63A 3WLIA 1F76A 2DIKA 2VUNA 3IARA 1IXNA 2H8ZA 4NJJA 3PVXA 2WOQA 4BHYA 1B0IA 2YB4A 4NZJA 3N6QA 4MB1A 3THQA 3QH2A 3NL6A 5GQBA 2W9MA 4AY1A 3MUAA 3PBVA 3RM9A 3W7LA 4WD0A 3W74A 3DFTA 3CAVA 1T40A 4G56A 1VP5A 3QMSA 4LUJA 3RK8A 1F3TA 1HKKA 3MI6A 4LCRA 2B7PA 4AZCA 3K5XA 1BKSA 1I75A 3L2MA 3OLIA 3TN3A 1E72M 3L0GA 5DT7A 3I6TA 2OYKA 4UQDA 2OYMA 2ZZ7A 2QUTA 3BG3A 5A6JA 3MJYA 3MR6A 4IP4A 1GNXA 1AJZA 2J8GA 1OQFA 1EJUC 2ZUNA 1FWBC 1EDGA 1MW3A 4P7OA 5LNVA 4MZ1A 4DBUA 4QCEA 1A5SA 3CAWA 4DYEA 4AIOA 1EO7A 4XTIA 5FEWA 4PL1A 4HTYA 5T8GA 1TPUA 4LALA 5KFCA 4DLMA 2QVHA 3WSUA 2J6UA 2ON3A 1JIBA 4NJKA 1Q5MA 2QGYA 3LGDA 4S3EA 3GW3A 3OZPA 2DSUA 5CZSA 4W5ZA 4GBDA 4CCCA 3LHUA 3KFTA 2FB3A 3BGJA 3NURA 3TC3A 3L4VA 4DBWA 4TQRA 4LC6A 5AHIA 3O1NA 4MM1A 4X0NA 1TX0A 3EWWA 1QHOA 4J3VA 2JEGA 1XBXA 2W0UA 2VNCA 4REQB 4EAYA 1DIDA 5E93A 3GDLA 4RV8A 2XVLA 3MMUA 3PJXA 3VO0A 1DWIM 1Q3NA 2DPEA 5HNTA 5I23A 1C7SA 3TLLA 3PNZA 3MYPA 1OZQA 4GG9A 3WQ8A 2PGWA 2J79A 3DC8A 2VQUA 1R3SA 5LHFA 1PO9A 3B0UX 4ZFCA 2P3ZA 2R1NA 4J5NA 1W9XA 2CZFA 1UBSA 2AGOA 1FRBA 5KFIA 5DXYA 3PULA 1RLDA 2WB5A 3UU0A 3VOFA 4A05A 4GUFA 4C6DA 4IF2A 5DG9A 4LYKA 2ZBTA 4MB3A 2ZC1A 1GPFA 3LTPA 4QW8A 2MNRA 4CNNA 4XSLA 1JL8A 3OHAA 3NVTA 1ZL1A 2X0SA 2OU4A 4IUGA 5CAHA 1W5QA 4LYQA 4ZR8A 1XG3A 1SJAA 3ABXA 1WKEA 1TVPA 2CNCA 2OELA 4FNRA 3NG3A 3W2MA 3QR3A 3WL0A 4ZMGA 5K3VA 3RDKA 2ZZ1A 5HA7A 5FAGA 1O1ZA 1AUSL 3VC6A 5KFWA 3CJPA 1LWJA 3SGUA 4O19A 1HL8A 1JCMP 1G0CA 4GGHA 3AISA 3VAVA 1R2TA 1WKFA 1OCBA 4XAPA 3H4GA 1B3XA 2V8ZA 4PUWA 3GU2A 4GVIA 3QFWA 4TIMA 2ATSA 1A5KC 2VVSA 3V5OA 2PTYA 4PMQA 2XVPA 2GK1B 1OJXA 3ISIX 1VHNA 3SUVA 5JH2A 3KVJA 4B3ZA 1XS2A 2W7PA 1SZNA 1GT8A 1CTNA 4MPQA 4D72A 2XIOA 1QNRA 8XIAA 3YPIA 4L6DA 1PVNA 3RN6A 2FLIA 1R6WA 1I2OA 3W7PA 1PSCA 3W1XA 1LOLA 4DJDC 3G22A 1J6OA 3URQA 3A5FA 1KCKA 3ARYA 2ZX7A 3GXIA 1W5NA 1RVGA 5DGAA 4F4YA 2QDHA 4EF8A 3UT0A 1BQCA 3KVKA 3MW7A 1WZAA 4DL4A 3W71A 4IR9A 4JY9A 3P84A 4JFWA 1EDQA 5AYYA 4TV5A 1TB3A 2WPBA 3TQ1A 3MSDA 3LM3A 4CLMA 2FFIA 1DKWA 1H0IA 1SW3A 3MDUA 1V77A 1Y0EA 4C1NB 4W4QA 2QDDA 1K4HA 1H7PA 3WK0A 4JS3A 1NEYA 4ASTA 2WTFA 3N3TA 1UZHA 4JHZA 1VPXA 2WNNA 1XJBA 2DJXA 2DUZA 2FLLA 1IV8A 3F5LA 3U2ZA 3H24A 1LUCB 2PCQA 5D9NA 5A6BA 3I7SA 4MVAA 4AIUA 4KEMA 3WNPA 4JOMA 5HQMA 3STEA 2I9EA 2YA2A 1V3IA 2J47A 3W7MA 2I7GA 5HMFA 1WXJA 2BY0A 1BTMA 4A2RA 3WNMA 2PU1A 4L1XA 1EWDA 5F9LA 4IMDA 4DM2A 4QWEA 3W02A 5C2XA 3NM1A 4FNTA 1C8XA 1WBJA 1YPXA 1V3KA 1E1FA 1C93A 3VFCA 3PWAA 2R24A 4LXFA 5JXQA 3V5FA 1MDRA 2VEGA 1V93A 4V28A 2WW5A 2CETA 1QK0A 2DORA 3L21A 4DUVA 2O7QA 4IG2A 3RLUA 2X8RA 3GXDA 2YCLA 3NPWA 1V03A 5XIMA 2WAGA 2WMIB 4E4PA 4RXFA 2EPKX 4IPPA 1TREA 5CC5A 1X1NA 4DM1A 3BL3A 3D46A 5EPDA 1PKNA 4KPLA 3QV8A 1QI2A 4ZQNA 5AVNA 4H8NA 3MCMA 1PWMA 5KEZA 3O2LA 5DCEA 2VCBA 3QOMA 1FH8A 3GO2A 3CBWA 1KA9F 2VP8A 4O3QA 4NSBA 1DTUA 4ZO8A 1US0A 4B5SA 5LNSA 2YCEA 2G5WA 4HSOA 3T05A 3JZEA 4YIWA 3NGFA 1QASA 2DW6A 5I77A 3MMTA 1RHCA 3VOCA 3GUWA 1PKLA 4UCGA 2VFGA 3WKZA 3GIYA 4GXPA 1F8IA 2OLSA 2C1HA 3COTA 1QJWA 1ICQA 2VOTA 5FJTA 2CLIA 2E09A 1YEYA 2BASA 2F9RA 3SUSA 2Z2UA 3DBPA 2OB3A 4DB7A 2PDWA 1P7TB 5TAOA 3DHFA 4DQWA 3DC0A 1QPQA 2PTWA 2AL2A 4HHPA 3W25A 3PFMA 3RO6A 2GJRA 3G77A 3DZ1A 1EOKA 4B9ZA 1B3ZA 1UCWA 3DEQA 4J2MA 4Z1DA 1K6WA 1PIGA 5DY2A 4B16A 1HJQA 1BFNA 3WZ0E 1G5AA 1VH7A 4DHGA 1J8VA 3BO9A 3SCUA 3GGMA 1H4PA 3S2CA 4J9QA 4JNZA 2FDMA 1MQPA 4H9XA 2Z6JA 4ALDA 3HQOA 4BZYA 2Y6ZA 2ZYFA 4O54A 2ZDSA 3G8RA 3A47A 1UROA 1RD6A 4IX2A 4KEZA 5B80A 4HHLA 1G67A 3ARXA 1VFMA 2BWGA 1UMYA 3N4EA 3VNMA 3GG8A 3SQSA 3LU2A 4EF9A 2C3ZA 3W7NA 2DT3A 3ZT6A 2CBIA 1I1WA 2GGJA 3N2XA 2Z2AA 5D9OA 2Q09A 3H26A 3AMDA 5D9PA 2GDVA 5KFOA 2WM0A 3UETA 4PUMA 3E49A 4GC7A 3KP0A 4DYJA 1XIMA 3HMJG 8XIMA 3K8MA 1BSLA 4TU1A 4IRKA 2IKJA 3M1ZA 5C9WA 3OP2A 2E6YA 4MNJA 3A9BA 4HHHA 4R3UA 1GJWA 3I65A 1K8YA 3O6AA 2J7BA 1EJVC 3OJGA 3UJFA 3EA2A 1XUUA 3UEQA 1FWDC 3NZPA 3ZVHB 1GOKA 3PZIA 4Z1YA 3GG0A 4AH7A 4A22A 1R3QA 5F4XA 3LRMA 3TXZA 3PB2A 4WJXA 4AD1A 3WNLA 4E2BA 5CLWA 2BOFX 3A12A 5IOBA 2R9RA 3WF4A 3NQGA 1B57A 2JK2A 2XGPA 3WDHA 3KW3A 4YU1A 4CQ9A 3KDNA 4LV4A 2BS9A 5T26A 2WKJA 2EF9A 4XZLX 3CV7A 4S3CA 1DWGM 4PUUA 4BS0A 2VX7A 3CQHA 5LIXX 3O6DA 1ZZMA 1MQRA 1N7KA 4MAVA 5HDRA 1R47A 2WJDA 1K3UA 1TFVA 1W1PA 4D6HA 4ECTA 3BAKA 2BX7A 1CI1A 2IMRA 5EBAA 5G1MA 3ES7A 3LV5A 3W38A 4F0HA 5HBFA 3E2SA 3AIEA 5FIPA 1IGSA 4AC7C 3S0CA 1ZPTA 3TYUA 4J9LA 1XH2A 4XAZA 3T0TA 3WENA 3EWDA 3BLDA 4UBPC 1FWSA 1RJPA 4KMQA 5K7JA 1AFSA 3UVIA 3TMLA 3M5ZA 4GY0A 2X1RA 3AOFA 4YTRA 4I3GA 3EYPA 5C5YA 2OVLA 2H3DA 3KVLA 2FVKA 3B03A 3WLTA 3E74A 1TV4A 5LA2A 2VFEA 5MF5A 5F1UA 3QZ7A 3PW0A 4ZOCA 4S2CA 4REQA 3B8IA 2PD5A 2E9BA 3CZGA 2PDNA 3MHFA 4YJ5A 4B2DA 3H70A 1HKJA 1JAEA 3WH6A 1NDZA 3UJSA 1SZEA 2I57A 1PX8A 4A3HA 3TXVA 2WJEA 2O55A 5CEWA 3GNPA 1WNOA 2WCAA 1IEXA 5KG7A 3PF3A 4D6CA 1JXLA 1W9UA 4JX6A 3RFAA 4LUTB 4JTEA 4DY1A 1TCDA 4CKQA 2PU0A 4PMOA 4MWAE 3CZLA 3N4AA 2RJGA 5FJPA 1EX5A 2FZ8A 4U4MA 3CZEA 3MSRA 1MEWA 4IPIA 3AUJA 2WV8A 1MXDA 1A5MC 4NL1A 3URBA 4JKKA 1ZRQA 5KG5A 2REQB 3UWVA 1LT7A 1ECEA 3MP4A 4YN5A 4QM1A 1JULA 1BF2A 1KRCC 2FJUB 3PM6A 5CSRA 2NQHA 1JNEA 4ZFMA 2D69A 3W28A 2OYLA 4FX8A 4MLJA 5KG3A 2C2DA 5I0DA 3T2PA 2WKLA 2YCKX 3KTXA 4NKCA 1MDLA 4H9UA 4J3UA 1X39A 5C6MA 3W1LA 3GDRA 3JW7A 3NDYA 2FQIA 3G1VA 2WCGA 2QW5A 4MAZA 1HZYA 3A4WA 3W84A 2BTMA 4DWDA 4IQJA 3SCVA 3VD7A 3A22A 3GAYA 3GV5B 1MI3A 3XINA 1JCYA 2NQLA 4GXMA 3N2BA 1A5LC 4UTTA 2P9BA 1GCYA 3GH4A 3GTXA 5CG0A 1JIHA 3CHFA 4O8AA 1GVFA 1JCTA 3A24A 3CYVA 3L65A 1ZALA 4ZTXA 3NQFA 4Q8VA 1FCQA 3E2RA 2B31A 2ZADA 4MPKA 3AHTA 2X40A 3CUHA 5LYRA 5CC7A 1KGWA 1W9DM 5LGZA 3LG3A 4MNLA 4GI8A 3VNDA 5J5DA 2Z1SA 2VR5A 1E6ZA 4CGTA 1W9VA 2E5BA 4GI4A 2AMGA 2VHLA 5DF0A 5BRQA 3VM7A 4QW9A 3TDFA 1D3HA 4E8DA 1JRBA 5CBBA 3EX1A 4JHOA 4POCA 4TQTA 4MTVA 3UGRA 3LCGA 2QCHA 1UWIA 3VD3A 4MZYA 4ZE4A 2OG9A 3BG5A 1GVQA 4Q4SA 4LS1A 3DFNA 1YDOA 4GYPA 2WNQA 1UQYA 1B90A 3LOTA 3UJEA 4CQ8A 2CKSA 1S2TA 3VKBA 2EPOA 2OZ8A 1UPPA 4C1NA 5EB8A 2P10A 2ACQA 2I14A 5AZ0A 2JEPA 4WQ6A 5L9XA 5IFTA 1QAPA 3VKCA 2X1TA 1H60A 1VJIA 3T1GA 4DO4A 3RPDA 1P4CA 3UCCA 4KWUA 3TJ4A 1TQJA 4MKNA 4OBTA 1H7OA 3GV7B 5C9RA 1LUCA 2QMKA 3SQLA 4NY2A 3LLDA 1HW6A 4ED3A 4US6A 3EPGA 1B5TA 3PBGA 1VFSA 4L80A 5KT4A 4RCXA 4O50A 2JE8A 3NTYA 1JZ8A 1GJUA 3GTNA 1N8FA 2GJLA 2AU0A 2P5NA 2CXEA 2HS8A 3PJUA 3I4KA 3G1AA 1PTAA 4B3LA 5ABHA 5DMNA 5FAJA 3N13A 5BZAA 3UWYA 3WDRA 5EWEA 3Q58A 3VOIA 5CPTA 4GI9A 3B8DA 3M6DA 1KM5A 2DQXA 3PHAA 2G3FA 1W9PA 3F1QA 4QAIA 3PN8A 2ACSA 5I5RA 3V4BA 1DJYA 2WMIA 4PFMA 1AVAA 2AQVA 3ATZA 3BLLA 1K70A 1Q6FA 4PULA 5LSMA 1SO4A 2ZOXA 1JUKA 1H7NA 1RK6A 2D2JA 3VD5A 1KCZA 4XBSA 4WGXA 2GZXA 1EQPA 2PLJA 1P6CA 2E1DA 5DRIA 1T5AA 3GDBA 4MWAD 2YL8A 3ZXWA 2PDCA 1SW0A 3VI2A 3R2GA 3W27A 4O0ZA 1OC7A 2NT1A 1V08A 2YL9A 3FXGA 3H54A 1VEPA 1FDYA 3GILA 1CLXA 4EP8C 1OVDA 3SAZA 3TTYA 2VC5A 2ZE0A 4LV9A 1XV8A 5BXPA 1GG0A 2WQDA 4OGZA 3OG2A 1EPXA 4M29A 3RX4A 4AB4A 3DYOA 4HIBA 2WVTA 5T14A 2VO5A 3PSWA 1WKDA 1BG4A 1UD3A 2QEZA 4N9DA 3OO2A 3LHTA 3LHVA 2NSOA 4MUPA 2E25A 2RAGA 3B9OA 5G2IA 1P6WA 4I9TA 4JFVA 1C8YA 1P7TA 4BQ4A 1UWSA 2A0NA 4GINA 4XSMA 2V2CA 4PSPA 3CTTA 4LVGA 1OIMA 1D3CA 3W7QA 3CL6A 3HPAA 2HVOA 3EZ4A 3UCQA 3UFYA 4FLQA 2LLEA 3ENLA 2PWDA 4HYVA 2OODA 4G1KA 3FW6A 1ESWA 3GTIA 1AJ2A 1Q6RA 4YVPA 3U4FA 4NJGA 2HE8A 3A3XA 3VIJA 5C55A 3VM5A 3FAWA 3W7DA 1XLHA 2VGGA 3TQ0A 3UXLA 1PX4A 3B9EA 3P0WA 1U5JA 5G2WA 2Z24A 3E0LA 4KCWA 3GVQA 2YFOA 1CECA 5D04C 4W7UA 1O12A 4IQEA 3L0KA 3IJ9A 1PZ1A 5L1IA 4NAFA 2BR0A 2IKGA 3M43A 1KKOA 5XINA 5A6TC 2Y7FA 2O4QA 4WY0B 4AFYA 2OTDA 4U10A 5HUPA 1XLMA 3ALFA 1Q2RA 4ZQOA 3N19B 3FHQA 3LCWA 3H22A 3T08A 5CBJA 3EOUA 1WYIA 4XVDA 4URIA 5DEZA 3UPWA 3WJYA 4GABA 3P3BA 1JJKA 4JR5A 1E1EA 4C91A 1MXGA 4XUYA 3F4DA 4IR1A 2HVMA 3PC0A 4NI8A 2ESCA 1FX6A 1M7PA 4ZSUA 3GFXA 4WR3A 4GPNA 3C0LA 3N25A 4UFMA 2ZE3A 4W9TA 1VD6A 1F2JA 3F03K 3ZS4A 1HGWA 4RJEA 1EYWA 4C6CA 3AYTA 3KXQA 3QM3A 5CSSA 4HOWA 4JNYA 4EPDC 2V3GA 3ZVHA 4DL2A 3WD0A 4EWJA 4J3XA 6CGTA 2WZTA 1ZHAA 5AN7A 3BLKA 4R8UA 2PDXA 3OIHA 3ABSA 4XIMA 2GJPA 3SADA 3OOQA 4HZMA 4JYEA 4A3UA 3OG3A 2VZOA 3M0MA 3WLKX 3UJ2A 2A7PA 5TNVA 1UA3A 1H09A 1GVEA 5FF0A 1CXLA 2VR2A 4D2JA 1F3XA 2WHMA 1UOZA 2WYSA 1W3HA 2QDGA 4ADTA 1UH3A 4H04A 4PE8A 3V6HA 2VURA 3CNYA 2VEKA 4Q8EA 3R25A 2FHCA 3G8EA 1LG2A 3FCPA 3RYSA 3TNOA 3DHPA 3BCFA 3CV2A 2QPUA 4Z0JA 3QY8A 1VIZA 3PW4A 2PWVA 1P0EA 4MNKA 2W62A 1HNYA 4LT9A 2A6NA 4ECQA 2Z1BA 1NFPA 5KFYA 3OTRA 4LUSA 3PB0A 1BPLB 3N73A 4DJEC 4AZHA 6TAAA 4GVGA 1MYRA 4KIRA 4ZA0A 4CNOA 3VCCA 4NXSA 5HWJA 1LWIA 3L5LA 2XYLA 1A5BA 1T99A 4XIAA 4ED1A 1CGTA 2P3EA 3BZGA 1KV8A 2H9AB 5CPMA 4ZODA 3CC1A 3MSGA 4LUIA 3GDTA 1LRQA 1WXYA 3CIXA 3K1GA 1OX5A 4A8IA 1EPVA 1DIKA 1F3WA 1J9YA 3T55A 2RDJA 3MR5A 4NIRA 1WDDA 4TMCA 3C0QA 2C14A 3ZZ1A 1CEOA 1E73M 3HO8A 3W88A 3LGEA 1VJZA 1ZY9A 1H3GA 3P74A 1UC4A 4ED8A 8A3HA 4PMDA 1GKQA 2PWFA 2ACUA 4D6IA 4Z42C 3A4AA 1E40A 8RUCA 2REQA 1WAUA 1WXZA 4NVTA 2PGFA 3VOGA 4F48A 2W4XA 3VC5A 3W00A 2WZMA 3LTYA 3FS2A 4B5WA 1W3LA 3GR8A 5LIWX 4AYSA 3BJTA 3KCOA 3ICJA 1EHNA 4IL0A 3RBEA 1DEDA 4QJ3B 4CUCA 2HDJA 5AYBA 1S39A 1LF1A 1V02A 4N4PA 2VX5A 3UNTA 4Z2JA 5I3KA 3VGBA 5JBDA 5EBUA 3MWAA 4UWMA 4LAUA 1O6IA 4KF1A 3FEMA 1AW1A 1W1B1 3P2VA 4B4FA 4OT7A 5K4XA 4AF0B 5DT5A 4IIHA 4F8XA 2C79A 4K7VA 3M9NB 2C7FA 4EPEC 3GW0A 3WH7A 4P8VA 4X9YA 4XKMA 2NVCA 1K02A 4Z2HA 1N56A 3A5VA 4B91A 3UZYA 5DXXA 3B8TA 3VX1A 4O0KA 4E4UA 4M24A 2Q02A 3B8SA 3HOJA 1RQBA 2WC4A 5K9DA 3ARSA 4S2BA 1TPB1 4MB5A 1RBAA 3WD3A 4QISA 1J93A 1QO5A 5G4HC 2PDLA 2PDPA 2YB1A 1W31A 2GQ3A 5HUOA 3EDKA 4TTUA 5ABGA 1J12A 3CMJA 4H9VA 4TUFA 4AU0A 2XVGA 4P5UA 3R79A 3V35A 3TTOA 2O9PA 4QWDA 4O4VA 4AZ5A 3S2NA 4CU7A 1FCBA 4GJJA 4XK2A 2HBXA 2GPTA 1ODUA 2NXIA 1F4AA 3AYRA 1EF2A 3TVAA 4R9XA 3VIMA 3BMWA 3QPYA 3PP7A 3S1UA 3B9DA 1SJDA 2WJZA 3M7WA 1YDYA 3H21A 1J0IA 4CNTA 4G5DA 4J2PA 1EKOA 1EQCA 3W76A 2FB2A 1Y5XA 2Y5EA 5K9XA 3THUA 4H7VA 3GD6A 2G97A 3MI2A 4UFKA 3P5YA 2WSYA 3BC9A 4MG4A 3VGFA 4N02A 2YYTA 3HA1A 3MY9A 3BUVA 3R1ZA 4J9PA 4TOQA 4X22A 3R89A 3T8QA 5ABFB 3CQKA 3ITXA 3QZ6A 1HO1A 3DFPA 4ZQPA 5KFDA 5D2VA 4QX4A 4KERA 3N1AA 1BYAA 2BXVA 1YNYA 4UR7A 1QVBA 4WHBA 3LSBA 4E2DA 3GZAA 3Q8SB 4UZUA 3RCNA 4PH6A 4LGXA 3IACA 3RX3A 2WLZA 5HANA 5LIUX 5F1VA 2F7FA 3GDMA 1OHLA 1US3A 1W32A 2WQPA 4HKPA 3PWGA 3WUFA 5JU6A 1RJQA 2BVWA 3W22A 1CGWA 4HMCA 5EU9A 3R0KA 2ZX9A 2X1UA 3GFZA 1QU4A 4GQQA 4IFOA 4Q33A 1AZ1A 4LVAA 1MW2A 2WANA 2OEJA 4HNTA 4MFDA 3DIPA 4YTTA 5JBEA 3ZJ6A 5AC7A 2VDIA 2BHYA 5CKSA 1C8QA 1PXGA 5TF0A 1V3MA 4JTKA 4B5UA 3IRDA 4AC1X 4FXSA 2GOUA 3N2MA 3AHYA 4B5VA 5DRCA 5E6ZA 4NZFA 3KHRA 3NDOA 3GBDA 3FN9A 3LEPA 1ITCA 2HJPA 2X16A 3LM7A 2EO7A 4HA3A 4HYRA 4GUGA 1TV3A 3T4CA 4NNAA 1Q8AA 4LVDA 4MKSA 4ZL1A 3FFSA 4NZ5A 4ED2A 1LTDA 5AHNA 2DZBA 1GORA 4CN1A 2HRWA 5CPLA 3DI1A 3PZMA 4AMAA 3ZJ8A 4KRUA 4FOKA 4EPKA 3RPMA 3PNUA 3U8GA 3VIFA 5D33A 3OW1A 4YYFA 3DGBA 3KHLA 3G1YA 1R8LA 1X8CA 4KWSA 1LM1A 1M6JA 1VYSX 4W8BA 1VC4A 4GZ7A 2D22A 3KX6A 4UNKA 4D1IA 2Y8VA 1UR4A 3S47A 3ZM8A 3B05A 4MWAB 3QYQA 2PLKA 1YDVA 5KFVA 3UWEA 1WE5A 3NZGA 2HSAA 4MY8A 1IT0A 2W27A 2J24A 2RDUA 2AL1A 3SJ3A 4C6BA 3W72A 3C0SA 1VFOA 3RG6A 3WBEA 1G7UA 3QR0A 2VJXA 2A3LA 1SQ7A 3CT7A 1WBHA 1TE6A 1I9CB 1CZ1A 1TTPA 3KVMA 3AQUA 3QLDA 2FZDA 2R14A 2GQ8A 4J3WA 3RAQA 1OX4A 2J7HA 2BNJA 5KITA 4N9BA 3HFYA 3RR1A 4ACYA 1E6RA 2J13A 5L1LA 3RU6A 2WXDM 2AMXA 2ZKMX 4O3PA 4FB7A 1TMHA 4N0RA 3WQDA 4MUZA 4HYKA 3GXFA 3LPOA 1GHSA 3LX9A 4B92A 1EJTC 4A8RA 3EOEA 4QNWA 2ZWYA 3LNPA 1HP5A 2NWSA 3DKLA 2ATMA 3HB9A 3WLJA 2ZQ0A 4UTLA 4FA3A 5KZMA 4Z17A 3KHDA 2NUYA 3GB6A 3B8WA 3HQNA 3TSMA 5KETA 4B15A 2D3NA 4FR6A 2EPHA 4DNMA 3CIWA 4C5YA 3QTPA 5I07A 3A9IA 1A3XA 4JQ2A 3EOLA 1KXHA 1A0DA 1US2A 3UVAA 2BOGX 1ZAIA 4XISA 4LUYA 1GQKA 3APGA 1ZBKA 1LCOA 3ZMRA 3S6TA 4Q6JA 3S5YA 1SO5A 3NQMA 3PPGA 1BSIA 4RE2A 1UH2A 3U48A 5HULA 3W1UA 5DBUA 5AC6A 1S5VA 1VYPX 4MJ2A 3CUZA 4Q32A 1E0UA 4M19A 4PCNA 4ZXLA 3VX0A 3LLXA 4HN8A 1EGZA 1J01A 4GGBA 3CGTA 2Z6IA 3WK3A 4AHQA 3TA9A 4EWND 3V3WA 4PMYA 1ME8A 3VYLA 3UG5A 3V75A 3IWPA 4AVOA 1SVDA 2XISA 4HU0A 8TIMA 4JTQA 1K6AA 3THCA 1MVYA 3BARA 2Q6ZA 1F6PA 1KBJA 1Q6QA 2P76A 3MYOA 4F4RA 5LXXA 3AALA 5KFSA 3MC5A 1OFRA 4XV0A 1YBQB 1J79A 1H7RA 2GFTA 3T6CA 3FX4A 3QYSA 2EPLX 1DV7A 1WX0A 2XFFA 4MY1A 1X1OA 3U5YA 1IZCA 4W8AA 4JFTA 3M07A 4PEKA 4FLSA 4Q8OA 3T4WA 4DF1A 1ADOA 4KFOA 3SGGA 1ZS2A 2XIJA 2ONEA 3MS8A 2CIPA 2TSYA 5EWFA 2AAMA 1XBVA 1ONXA 4K3ZA 3PZ9A 3UW6A 4JV0A 4GFIA 4QG6A 3AYSA 4A3QA 2H9AA 4TX9A 3UWQA 5BMWA 3JZUA 3UZ5A 2GVEA 3NL3A 4IMEA 3W6LA 4YCPA 1TR9A 3NPVA 1FY6A 5FKYA 1BAGA 1KFWA 2OZTA 5KINA 1HO4A 1UR3M 3HGRA 1I45A 4MJMA 3AXKA 4UTJA 1K8CA 1EH9A 1XDJA 3HPFA 2IS7A 5U4NA 5EMLA 3N2CA 1ELSA 3V16A 3IN5A 1MWOA 5BRBA 4DEZA 4O17A 2F6KA 1AD1A 3WQGA 4GH3A 1WZKA 4JTRA 3VIGA 3UZZA 1XW8A 2Z7GA 1FWCC 4JZ5A 3ITTA 1TWDA 3HM7A 4GX8A 2RGLA 3W29A 2PP1A 1IF2A 4BWLA 1R0MA 1TV2A 1LOSA 2G8ZA 3TZNA 1W37A 4GQ0A 4FZIA 5EMYA 1F07A 3W37A 3CH0A 2DIEA 5EMUA 3IUDA 4HMEA 3CB3A 3KP1A 4IHCA 4LF2A 4DVOA 2Y70A 1QI0A 1A4MA 2YYUA 1OIFA 1ZLPA 2OXNA 3WJZA 2GVJA 1YW1A 4H8UA 5KFHA 3TNBA 3TYDA 1M01A 1P1XA 1NFBA 4RL3A 3M6YA 4D6GA 1W8GA 2VC7A 1GTHA 3JVAA 1IWBA 3DAQA 5JVLA 1V6XA 3NSXA 3D3FA 2ASJA 2GWGA 4JL1A 1QXLA 4IGHA 3IJQA 3P62A 1T94A 4GK8A 3R8HA 4DJFC 2PZ0A 4O53A 1QWGA 1DXEA 1XYZA 4GIRA 1B2YA 3PUDA 1JYWA 2XZ7A 2E6AA 3CO8A 2QV5A 1RBOB 5KMYA 5AKQA 2ATLA 2DU2A 4G7EB 1W5OA 3AU6A 3EWYA 2L5HA 3HGJA 2BV9A