4DEZA

Structure of msdpo4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
b'TKWVLHVDLDQFLASVELRRRPDLRGQPVIVGGSRKVVTCASYEAREFGVHAGMPLRAAARRCPDATFLPSDPAAYDEASEQVMGLLRDLGHPLEVWGWDEAYLGADLPDESDPVEVAERIRTVVAAETGLSCSVGISDNKQRAKVATGFAKPAGIYVLTEANWMTVMGDRPPDALWGVGPKTTKKLAAMGITTVADLAVTDPSVLTTAFGPSTGLWLLLLAKGGGDTEVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV 1
publication title The PAD region in the mycobacterial DinB homologue MsPolIV exhibits positional heterogeneity.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 75
structure length 232
sequence length 238
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dezA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4dezA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dezA01
2JC0A 1JLAA 4KSEB 4KITB 3QIDA 2ZUCA 3OGUA 2YKNB 1HQEB 4WZQA 3GIIA 3KNAA 2YNHA 1LWFA 3KK1B 1NJYA 9ICTA 3M9MB 3RJHA 3HVTA 1D8YA 4LQ3A 2KTQA 4RNMA 3V81B 3UDLA 1R0AA 5J2MB 3D28A 4B9TA 2I5JB 2XI2A 1J5OA 3H5XA 9ICQA 2VG7B 4QZDA 4KMUA 3KLIB 3DRRA 4ZH4A 2QV6A 3OLAA 4CCHA 4J9NA 1N6QA 1S6PA 4ED7A 1IKWA 4MKBA 1MMLA 4PHPA 4P4MA 5J2GA 3I5CA 3SZ2A 4XPEA 3RH5A 9ICXA 1KHVA 3ZDDA 3OJSA 1MU2A 1D9DA 2UVVA 2IM0A 1SH0A 2OPRB 1DOQA 1FKPB 4QZCA 3HP6A 4YR3A 4U7CA 4K4IA 4R64A 5HP1B 1AROP 1TK8A 1SV5A 3RTVA 4I2GA 7ICTA 4NLQA 3E01B 5IIKA 4QZ8A 2HHVA 2A1JB 1X2IA 4ELUA 4K4ZA 1JLQB 1S4FA 4DL2A 2YNGB 4Z6FA 3JPRA 1TV9A 2WHOA 2BQRA 1ZQRA 3V7KA 9ICGA 4IFVB 2V4QA 4GC7A 4IDKA 2V9WA 2IC3B 3GFKB 2VANA 4BXOA 3N6LA 3ZDCA 4DWIA 3BQ1A 3RAXA 1NHUA 2BANA 1RDRA 2JZBB 1Y88A 1HMVB 3GIKA 9ICWA 4MKAA 4PGYA 3I0RA 4U6PA 4IG3B 8ICNA 5HNKA 3IG1A 1D0EA 4EBCA 2AGQA 3DM2B 2R2SA 4Y34A 3LK9A 1FKOA 4BDPA 3DI6B 3IGVA 1TV6B 1HQEA 2W9AA 3IHQB 3GIMA 3KK1A 1ZQAA 4F4WA 5CYQB 1ZQTA 2BQUA 5KG7A 1SL2A 3V81A 4TN2A 4C8MA 1X9WA 4ZP8A 1N4LA 4R65A 1S77D 5J2MA 4MK7A 4RQ8A 4UB2A 1ZQHA 1HNIB 2I5JA 4IQWA 4WXOA 1ZQYA 5KFWA 9ICLA 2VG7A 3KLVA 3LANA 1XU4A 3JPOA 5KFJA 2FVRA 4KLSA 3BDPA 1LV5A 2AQ0A 5KFDA 2R2TA 4NLUA 3HVWA 1LW2B 1JX4A 4NLKA 5KFPA 2HHXA 3PX0A 1C1BB 4MFAA 3H4DA 3V6JA 1S6QB 3PW2A 1JN3A 4QWCA 2OPRA 1TKTA 4J9PA 1FKPA 2C2DA 1RT3B 4ZHRB 1IKVB 1KLMB 3E01A 4K4GA 1CEZA 3PHEA 3CJ2A 1JXEA 2A1JA 3MR5A 4NLSA 1HYSA 4KFBB 2BHNA 5L1IA 3H8JA 4NLTA 2YNGA 4NLDA 1RAJA 5DDMA 2HHUA 3KHHA 4IFVA 2I9GA 2IC3A 2HHTA 2GC8A 4DL3A 2JZBA 3GV5B 1BQMB 1HMVA 3QEBZ 4EYIB 4RPZA 3G6XA 4LZGA 5KFBA 2HNDA 4UB4A 3LDAA 2BR0A 4IG3A 2W9BB 1U09A 4WYWA 4WE1B 4TQRA 2FLPA 4F4ZA 3ISDA 1C1CB 3DM2A 4ZP6A 4P4PA 1CSJA 4K4YA 3C5FA 5D49A 2ZTEA 4NLVA 5DDYA 4ZMMA 3G6VA 5J2HA 1QAJA 3DI6A 2HWIA 4F2SA 5HHIA 5DB9A 4DS5A 5CYQA 4UAZA 2ISPA 7ICUA 3RH4A 4NLOA 4IR9A 1ZQDA 1HNIA 2R2RA 4F93B 3PX6A 3T5LA 5K14A 1SKRA 1NK5A 3GV7B 4K4WA 1K1QA 1ZQEA 4KLFA 2BQ3A 1XC9A 1NK0A 3BR9A 1EP4B 1LW2A 2WB4A 1MSWD 1C1BA 4J9SA 2FVPA 5DB7A 1LB2B 1S6QA 3KLEB 3CDEA 4WZMA 3T19A 1S48A 4R8UB 4QZFA 2F1JA 1RT2B 1RT3A 3NBPB 3RAQA 4XPCA 4ZHRA 3NAHA 4MEYA 1IKVA 1XS9D 1KLMA 4YMEA 2KZ3A 1L3TA 2E9ZA 3C23A 1S1TB 4WFYA 3PR4A 3DOLB 3UPQA 3BREA 5CA7A 5J2CA 2W8KA 4DF8A 1ZQJA 2PI4A 2RF2B 4ECUA 4O5CA 1XR7A 5D3GB 1TAQA 4IR1A 4QZEA 1BPBA 2WTFA 3TAPA 2VG5B 4ZVFA 5KG5A 4Q44A 1IKXB 4K4VA 1BQMA 3GV8B 4PHDA 5J2DA 8ICUA 2RDIA 4RNHA 4IRDA 4M94A 4KLGA 1LW0A 3GDXA 4NRUA 1NKEA 3SFGA 2W9BA 1T4GA 4Y2CA 4GC6A 4WE1A 3OL9A 5DQGA 2ZJ5A 4ECTA 1C1CA 3JSMB 3NL0A 3T5KA 2C28A 1ZJMA 1S9FA 5BOMA 3AU6A 1HQUB 2Y1IA 1NK8A 1UA0A 3Q8KA 3C2KA 4NLGA 2PFQA 1RYSA 3C6UB 3MFIA 1GX6A 4PGQA 5DBCA 4DL4A 3SFUA 4KTQA 8ICZA 2XY7A 3H2LA 3PJWA 1I6JA 4KLLA 4ZVGA 3ZDAA 4Z6DA 4K4UA 1JLGB 1T7PA 4I2HA 5J2PB 4O3RA 4DSFA 4UB3A 1D9FA 3LWLA 3PVXA 5EDWA 3CVKA 1EP4A 1UWBA 1X9SA 3UXPA 3MR3A 5KT7A 2JEJA 4UQGA 3KLEA 4B9UA 2R8KA 3RJFA 2W8LA 2PFNA 3RBDA 4R8UA 4Z6CA 4KO0B 1RT2A 3NBPA 1W25A 2IHMA 4F5OA 2FLNA 3C6TB 5DB8A 4YCXA 5KT2A 5J0YA 1S1TA 3DOLA 4RW8B 2H5XA 5KT4A 1T3NA 3M8RA 4I2CA 1U49A 4C8LA 3TFSA 3ORYA 5KG4A 4PHEA 5D3GA 3E51A 3IN5A 5KFIA 5HMLA 2VG5A 4DL5A 5BPCA 2B5JB 2BCVA 1IKXA 2GIQA 1TQLA 3H5YA 4IH5A 4NY8A 1TAUA 3OL7A 4MIBA 1JLCB 4KLMA 3EPIA 1UT8A 1SH2A 4EZ6A 1NHVA 5J1EB 4EYHB 2BPGA 4F5RA 5C24A 3JSMA 4O0IA 1Z3EB 2ATLA 3CJ5A 4YVZA 2NRTA 3MTKA 2BCSA 5KG3A 4IFYB 1C7YA 1NJWA 9ICUA 1N56A 5CYMB 5DG7A 1S1VB 4ED8A 4RZRA 2DPJA 3H5UA 5C25B 1QTMA 4KLHA 5DG8A 1QUVA 4DF4A 1JLGA 4F5NA 3PW4A 1LWEB 4QWAA 5J2PA 4MF2A 4DQRA 2AX0A 1DGSA 5KFZA 1ZQSA 3G6YA 4KLJA 2WOMA 4DLEA 2JLEA 3GILA 3MGHA 4KE5A 4KO0A 3UXNA 5KFSA 2BDPA 4DL6A 3C6TA 4I2DA 5J0XA 2P66A 3NTUA 3E2EA 5EUHA 3B0XA 1T05B 4O3OA 3V6HA 1S1WB 4UBBA 4O5EA 2XY6A 1JMSA 4KLTA 4EBEA 4K50A 1RT1B 2AGOA 3BGRA 2ALZA 4KBIA 2W9CB 4XA5A 1RT7B 4MH8A 4EO6A 2B5JA 2YNFB 2HHSA 3H59A 4H4OB 3HVAA 1IKYA 1JLCA 4I2QB 2DPIA 4JV2A 4URGA 9ICSA 5J1EA 7ICJA 8ICSA 1C0TB 3FFIB 4G3IA 1RTDA 2KN7A 3JPTA 2BCUA 3EYZA 5KT3A 1DLOB 4BGDA 2ASJA 5CP2A 4PUOB 4MEXA 5J0TA 4YN4A 5IILA 3EW9A 2BGWA 1S97A 1SUQB 5DG9A 3GQCA 1A76A 4YD1A 3OSNA 3EPGA 2FPKA 1RXWA 3M8PB 4IRCA 3NKYA 1B22A 5CYMA 4Q0BB 1QE1B 1KTQA 5KG0A 5C25A 2HNYB 3QIPB 3UQ0A 2AGPA 3PO4A 5DLGA 4JV1A 1LWEA 9ICBA 3KHGA 3BSAA 4RQ4A 3HKWA 2JEGA 4RQ5A 3G86A 4RPXA 3Q8RB 2W7PA 1TK5A 4F50A 2V0NA 3M9NB 4I2IA 1C0UB 4O44B 1DTQB 1EXNA 2IMWP 3SV3A 3MEDB 3PJXA 2XGPA 1KFDA 3UXOA 9ICNA 3KLHB 2YKNA 3V6KA 3JPSA 3RBEA 4E0DA 2RDJA 1ZQOA 2NRVA 3KLGB 1S9GB 1T05A 1TL3B 3C5GA 9ICMA 5CWRA 1S1WA 1RTJB 1ZQWA 4NM2A 1XSPA 9ICJA 3LALA 5HP4A 1PZNA 4O3QA 3RB6A 1NK6A 4I2FA 1RT1A 2GWSA 4DFMA 1HNVB 2FVSA 5HMMA 1TVAA 1XR6A 3KLIA 2E9TA 2W9CA 2XI3A 2VG6B 1SZPA 3RJGA 2YNFA 3UPFA 2HHWA 1RT6B 1UT5A 4Y2AA 4M2YA 4H4OA 4WFZA 4MFCA 3C21A 9ICFA 2HHQA 4I2QA 1SL0A 1BGXT 4DOBA 8ICYA 5EOZA 4DOCA 4MK9A 1COOA 3I5BA 1C0TA 3FFIA 2KFNA 1Z00B 5I42B 3MF5A 3ISNC 1DLOA 5KFMA 3Q8PB 4KLEA 1U4BA 4QW9A 2V4RA 5HBMB 4ECQA 4PUOA 8ICJA 5HP1A 5DBAA 3IRXB 2I1RA 3FRZA 5L1KA 2FMPA 2PI5A 1RA7A 5F8LA 5C5JA 4RQ1A 3CO9A 1SUQA 3ISND 1IXRA 3TQ1A 1JLQA 4R0EA 4DL7A 3M8PA 9ICKA 1FK9B 2PFOA 4Q0BA 4O3PA 4UAWA 4RUCA 4LZDA 7ICIA 5KFRA 3HPOA 4PH5A 2HNYA 5BOLA 3LAMA 3QIPA 4ECYA 5J2JA 4DO9A 4RNOA 3DRSB 4NYZA 5KFOA 2KZZA 1KDHA 4K4XA 4X5VA 1ZQKA 3MDAA 3BQTA 2LYHA 1ZJNA 4KHRA 4I2AA 1N5YB 2BKEA 1ZQIA 8ICIA 5IIIA 2HAIA 5KG2A 2ZKUA 3RH6A 1C0UA 2P6RA 2ASLA 8ICMA 4O44A 2W7OA 2WRMA 7ICNA 1XWLA 3LAKA 4B9LA 2R8HA 4I7FB 4C8NA 3KLHA 3V4IB 1NOMA 1V9PA 1TV6A 4LSLB 4IH7A 1KHWA 3IM1A 3DYAB 8ICWA 4NXZA 3KLGA 1S9GA 4KKOB 1TL3A 9ICIA 3MECB 3BSNA 1RTJA 4J9MA 2ZE2B 4PHAA 2FLLA 3ZD9A 1KSPA 4KLIA 3QZ7A 1T03B 1HNVA 9ICOA 2UUTA 2P6UA 8ICTA 2VG6A 3JPQA 3DLEB 2B21A 4XUSA 2R8IA 2ISOA 2D3ZA 1NNDA 1RT6A 1VRUB 3PMLA 4QZBA 4M6WB 4ED2A 1XR5A 4KB7A 5F8NA 2D41A 1UA1A 2XCPA 3FQKA 4GXKA 1BPYA 4TUQA 1C2PA 3KMSA 4P2HA 4RU9A 1Z00A 5I42A 4O3SA 2WCXA 4RQ6A 3C2MA 3M9OB 5KFGA 4DFKA 2NRWA 3B0YA 4NLYA 3DLGB 4RW4B 7ICOA 3NAIA 2B43A 4F91B 5KG6A 3D5MA 5KFFA 1RA6A 4ECXA 3Q8SB 1U9LA 5D46A 4KFBA 1B43A 1S0OA 1FK9A 4I27A 3MDCA 8ICXA 4RW7B 3KHRA 3KTQA 2IM1A 3DRSA 3PO5A 5F8MA 5L9XA 1X9MA 4DSIA 4TUSA 1MQ2A 1YVFA 4F4KA 5J0SA 4ED3A 2FVQA 3RRHA 4DSJA 4EZ9A 4J9RA 3OSPA 5IIJA 1N5YA 4TXSA 1L3UA 1T8EA 2D3UA 1S0VA 5DB6A 2AJQA 1QSYA 3QLHB 8ICCA 5EWEA 5HHHA 3RJJA 8ICOA 4NLZA 1U47A 4I7FA 3V4IA 4UB5A 4YXJA 4QZ9A 7ICVA 4LSLA 5KT6A 4GLXA 2XO7A 2ZUBA 3PNCA 3DYAA 3C2LA 5J0OA 4GXJA 4KKOA 3MECA 4M9GA 4IKAA 4EO8A 7ICHA 4O3NA 2ZE2A 3ZDBA 4ZPAA 1JKHB 2FMSA 4DLGA 3CDWA 1T03A 2BE2B 3N4MB 2VA3A 3QYYA 1N48A 1RTIB 1QSLA 2JEIA 2HVIA 3MABA 3V7LA 4KLOA 2XGQA 4DSLA 5C42B 4JV0A 4TQSA 3DLEA 1XSNA 4ZVHA 1VRUA 3LP1B 1ZTTA 3TVKA 4M6WA 3M8SA 4TLRA 4NLRA 4EEYA 5HROB 4DFJA 4M04A 4DQIA 2KZMA 3BSCA 9ICVA 1TK0A 3QZ8A 2OPQB 3MEEB 2JC1A 1REVB 3KK3B 4WXWA 2IM3A 3DLGA 4RW4A 2HNZB 4HKQA 4M95A 4FBUA 2OPPB 3HW8A 1DTTB 4I2PB 4FS1A 4R66A 7ICSA 4URSA 8ICQA 9ICEA 1KLNA 2IJNA 2MAXA 4KLDA 3ITHB 4R63A 2RF2A 2BCQA 4RW7A 1JLEB 9ICHA 5IINA 1NKCA 4M0AA 1NJZA 4ZVEA 1NK7A 2F1IA 2UVUA 3HVTB 3KK2B 4QZAA 1ZQQA 1ZETA 3M8QB 8ICEA 2IHNA 3MBYA 4RW6B 1KFSA 2ZTCA 5KFEA 4O4RA 5KFUA 4B9MA 4WYLA 4LVSA 3HT3A 4GXIA 1HQUA 1ZQBA 1HUZA 3RR7A 4IRKA 2ZUDA 2ASDA 4C8OA 3C6UA 1NK4A 5J2IA 2BRLA 4OL8A 4RUAA 8ICGA 1SKSA 4JK1A 1BPXA 3LP2B 3Q8MA 2BE2A 4ECZA 1RTIA 1H38A 5J2BA 4O4GB 3T3FA 5C42A 3THVA 1S1UB 4JUZA 3LP1A 3SYZA 9ICRA 2Y1JA 2FJVA 4NCGB 5HROA 3RJIA 5TZVA 4Q8FA 5F9NA 5L1JA 1IM4A 2FJWA 2OPSB 3FDSA 4YFKA 2OPQA 3MEEA 1JLFB 4O9MA 1REVA 3KK3A 4YR2A 2AX1A 2HNZA 3CDUA 2HW3A 2OPPA 4RNFA 1DTTA 4I2PA 4MFBB 3HX0A 4DOAA 4RW8A 3LP0B 4F4YA 3ITHA 5DBBA 7ICFA 1FKOB 4G1QB 1L5UA 1JLEA 4IOBA 3TAMB 3RB4A 4J9QA 4QZHA 4YR0A 3MEGB 1HARA 3JPNA 4LSNB 3KK2A 4RQ0A 4Q8EA 2ZD1B 2R8GA 4IQXA 5J0PA 4BWJA 3T5HA 3M8QA 4B3OB 4FS2A 1BPDA 4YMNA 1HUOA 4Y3CA 4NLWA 2ILZA 4QW8A 1RT5B 1TVRB 5DQHA 4RW6A 2HWHA 5F8HA 4TYAA 2IJFA 3DOKB 3DRPB 3V7JA 5KT5A 1JXLA 3H7IA 2F8EX 3RRGA 3OL8A 2NRXA 4F2RA 3ISBA 4I28A 4IFYA 2UUWA 8ICRA 1D8LA 5CHGA 3PZPA 1MQ3A 1SKWA 4P4OA 2ZTDA 4I2EA 2HMIB 1Z4UA 1TKTB 5JUMA 1S1VA 1JLBB 4Z6EA 4IG0B 2DFLA 3T5JA 3LP2A 4ZPBA 4YG2A 4NLNA 3OLBA 4ID5B 4O4GA 4MFFA 3UQ2A 4J9OA 4KN4A 1S1UA 1ZYQA 3QGHA 3GIJA 5KFKA 5DLFA 1HYSB 2QE5A 9ICAA 4I29A 2OH2A 4DG1B 4NCGA 3SI8A 3V6DB 8ICKA 5J2NB 4ZPDA 4IQVA 3JPPA 4YXMA 2UVRA 7ICGA 1U48A 4FO6A 3NGDA 2OPSA 5FDLB 1JLFA 4QPXA 5DGBA 5F8GA 2Q0ZX 3DDKA 1L3SA 1RYRA 5J0UA 3RB3A 3MR2A 4B9NA 2HNDB 4MFBA 3QO9B 2I1QA 4QZGA 5I3UB 1CUKA 3EZ5A 3PY8A 5IIMA 4PQUB 3RR8A 3LP0A 3CJ0A 4YD2A 1TFRA 4F4XA 1ZQMA 2VA8A 5KFNA 4K4SA 4G1QA 3ISCA 3PR5B 4RW9B 2PFPA 1RT4B 3TAMA 1RT7A 3MEGA 2RKIB 4NM1A 2WONB 4WFXA 4ECWA 5J2AA 4LSNA 4KN7A 4RPYA 2ZD1A 4ICLB 4JWMA 2FVCA 4B3OA 4M9JA 5KG1A 1NJXA 1BPZA 1RT5A 1TVRA 3DOKA 8ICFA 3DRPA 5K14B 4PGXA 5J2FA 2R8JA 3TI0A 4TYBA 1EETB 2IAJB 2W9MA 4MK8A 3OJUA 4K4TA 3ETLA 4HYKA 1XO1A 4I2JA 3KHLA 5F9LA 4QWEA 4RNNA 5KFYA 3PW5A 5J29A 3RJEA 4B9SA 4C8KA 3KJVB 5CB1A 1XSLA 4H54A 1BVSA 2HVHA 2HMIA 9ICCA 3OHBA 4XQ8A 3QGIA 4X2BA 1D1UA 3OHAA 1JLBA 4IG0A 3H4BA 1QE1A 5F8IA 4KV8B 2AU0A 5J2QB 1TKXB 1BQNB 1NKBA 4ID5A 3K75D 4QWDA 4TY9A 2C22A 1ZQXA 3QGGA 1RTHB 3I0SB 3BQ0A 4DG1A 4J9LA 3HWTA 3V6DA 3IGNA 3BJYA 5J2NA 3QE9Y 5J0WA 2VA2A 3OL6A 1DTQA 2FPLA 5FDLA 2YKMB 2FMQA 3MEDA 4O5KA 3PX4A 2BPCA 5J0QA 3PMNA 1ZQGA 8ICVA 4RT2A 5L1LA 1LW0B 2IM2A 3FQLA 3QO9A 5I3UA 4DQQA 4PQUA 3TANA 3JYTB 3H8SA 1ZQFA 2AWZA 4RT3A 4IH6A 4MIAA 4UBCA 4J9KA 4F3OA 2B6AB 3DLKB 2D7SA 4RW9A 1RT4A 4YQWA 2RKIA 2WONA 2BRKA 4ICLA 3KMQA 3TARA 1WCLA 4YP3A 5J2KA 1JIHA 4KAIA 3TAQA 3AUOA 1QLNA 2OWOA 3CIZA 1ZQVA 1ZTWA 4Q43A 4K4HA 2R2UA 4ELTA 5T14A 4NLPA 1S1XB 1S76D 1HPZB 5DKWA 5DQIA 4R5PB 1EETA 2IAJA 5HBMA 3IRXA 1UWBB 2O5DA 5CJ7A 2XC9A 4KHMA 1MC8A 3KJVA 2J6TA 4FBTA 2FJXA 5J2EA 4ECSA 1ZQUA 1KFTA 1K1SA 4PWDB 2ILYA 5DGAA 7ICQA 2M9NA 4KV8A 5J2QA 4ZP7A 1TKXA 1BQNA 4DQPA 1SH3A 2XWYA 4H4MB 3FYHA 4F5QA 4DSKA 1RTHA 3I0SA 1ZQCA 1ZQLA 5KFTA 4Q45A 2IA6A 5KFXA 4F5PA 3EZUA 2C2RA 2BPFA 2CJQA 3UQSA 1S9EB 5KFVA 3H8WA 3C1ZA 3DMJB 4ED0A 1TKDA 5KFQA 2BCRA 7ICPA 9ICPA 3V72A 7ICKA 2YKMA 3H40A 4NRTA 2CKWA 5F8JA 3IS9B 2EC0A 1TKZB 3N97B 4RQ7A 4NZ0A 3T1AA 1HJPA 3CWJA 4XRHA 4F92B 1GX5A 1OS5A 3JYTA 4RQ2A 1T94A 2MUTB 5C24B 1QAIA 4QWBA 3ZDEA 2AQ4A 2B6AA 3RB0A 3DLKA 2ZJ8A 2F1HA 4DFPA 4ZP9A 4ECVA 1RZTA 4DEZA 4URQU 1LWCB 4MF8A 3GYNA 5HLFB 4JWNA 1WNEA 1BPEA 4TY8B 2YNIB 1A77A 1VRTB 8ICPA 3LWMA 4ECRA 1S1XA 1HPZA 3KLFB 3QEAZ 7ICMA 3H5SA 1QSSA 4R5PA 4UB1A 1SL1A 5KFLA 3ICLA 2GIRA 1TL1B 1ZQZA 5IIOA 5D4BA 5CR0A 2WK4A 3N6MA 4QZIA 5JXSA 1NK9A 1ZQPA 2WOMB 4DQSA 4UAYA 3HHKA 4PWDA 1JLAB 4ED6A 1S49A 7ICRA 5KTQA 3Q8LA 2NRZA 4H4MA 4YMOA 2YNHB 1KRPA 1LWFB 4DS4A 8ICBA 3H98A 1TP7A 2PXIA 5KFCA 2XCAA 1R0AB 4BWMA 4M47A 4IQTA 4ELVA 4I2BA 1S9EA 2IBKA 3BGRB 3DMJA 3RJKA 2XY5A 1J5OB 3TFRA 4M9NA 3C1YA 3DRRB 3PW0A 1S10A 3QLHA 3UR0A 3AU2A 3I5AA 5KFAA 3ZD8A 3PW7A 1N6QB 1S6PB 1L3VA 1IKWB 3MFHA 1IKYB 2E9RX 3VQSA 3IS9A 1TKZA 3KOAA 2FPMA 4B9VA 5KFHA 8ICAA 1MU2B 4PPXA 1RTDB 2MUTA 4EBDA 1S0MA 1U45A 1JKHA 3BSOA 3Q8QB 1SV5B 2ZJAA 3CJ4A 3NMAA 2J6SA 7ICLA 2KFZA 4YMMA 4M9HA 1KEJA 2JEFA 1RPLA 1LWCA 8ICLA 4DSEA 4TUPA 4M9LA 4IQUA 3K4GA 5HLFA 1ZQNA 5EWFA 7ICEA 4TY8A 1RXVA 2YNIA 4KLQA 3N6NA 1VRTA 2C2EA 3EWAA 4IDKB 2UVWA 4BXOB 1S0NA 3MGIA 5EWGA 3SV4A 3KLFA 2BANB 8ICHA 3FSIA 4ED1A 4XO0A 4F8RA 1TL1A 3BQ2A 4ZPCA 3CJ3A 3PV8A 3I0RB 5J0RA 4TURA 4KLUA 3IG1B 4NLXA 3MR6A 1WCNA 4LQ9A 2J6UA 4RQ3A
chains in the Genus database with same CATH superfamily
2KJ5A 3QIDA 1ACMB 2NZ4A 2XYPB 2DGVA 1UEKA 2XMUA 1PK1B 2M8DB 1NJYA 2XM3A 3HVTA 2XMKA 4B3MF 3JB9k 1D8YA 4OYWA 4RNMA 1TMMA 1R0AA 5J2MB 1U1KA 1W2IA 1QH9A 2VV5A 3KLIB 4KMUA 4J03A 4LFCF 2F9JA 1RWXB 4CLZA 1AXQA 4CCHA 1EJUC 5ALFA 3TADC 3WKAA 1S6PA 1IKWA 1MMLA 4PHPA 4P4MA 4CNYA 3D0GE 1OY6A 2WBRA 2NYVA 2X51A 4XPEA 4X4UA 3K5PA 3E74A 9ICXA 3ZDDA 2MJUA 3CCVS 3CF5Q 1SH0A 2XLJA 1N33J 3HK2A 3W2WA 1EJRC 3OFFA 5ETQA 5EN1A 4NXMJ 5HP1B 5HANA 2HLTA 2H3IA 3E01B 1YDLA 4V1YA 2A1JB 1H0HB 2KJVA 2EWHA 4DL2A 1CVJA 5A8RB 1ZAWA 2MGZB 2R7XA 3V7KA 2AEMA 4IFVB 2V4QA 4GC7A 2LBOA 3F2DA 4NMLA 4BXOA 1GH8A 3N6LA 1EX8A 1V85A 5BYRA 3RAXA 1N5QA 5A0LA 1Z1ZA 3CO0P 1HMVB 3GIKA 2GCFA 4ACOA 2POKA 4MKAA 1S5LU 4PGYA 4IG3B 4LFAF 1F0MA 2NPIA 1X4GA 1HHTP 1I51B 4DI6A 2GQCA 3H8MA 3W2VA 2RRBA 2PO4A 2DKZA 4ES1A 1VCTA 3DI6B 1TV6B 3AOBA 2KFYA 5L46A 2JH3A 1LKZA 1P1TA 1SC4B 2XLIA 5KG7A 4TN2A 4I69A 1N4LA 1XJWB 3EGJA 5J2MA 4HI2A 4MK7A 3GLJA 5HQ8A 2G0IA 1RTZA 2G2OA 1ZQHA 4ILRA 3TZZA 3I9V9 5KFJA 4OI2A 2KKHA 2F4VF 2AQ0A 2R2TA 4CDGA 4P9SA 5HMZA 3E0FA 4NLKA 4HTIA 2HHXA 3PX0A 1C1BB 4PEOA 1S6QB 2LXIA 2RD5C 4DPXA 4G9BA 4AXIA 3JTPA 1TKTA 4CQCA 2MKSA 3QBCA 1DFDA 1RWPB 1VIOA 2C2DA 2PMZD 1U8SA 4OJ3A 1KN5A 2JGAA 3BPDA 4LF2A 2EZYA 4DZ6A 3E01A 4N77A 2BACA 2A1JA 3MR5A 4DR3J 1HYSA 3PJ9A 5A8RA 2MJNA 2HHUA 2MGZA 2GSEA 2ASYA 2ZDPA 2EFOA 4ATNA 2MLZA 4IFVA 1FWLA 3FUYA 3WK4A 2I9GA 1CULB 2HHTA 4U67Q 3MKVA 1FWCC 5C2GA 3KG4A 4WHBA 1X66A 3GV5B 5GMDA 2ZBIA 1HMVA 2Q6BA 3G6XA 3GG0A 3NGUA 4WKRA 5KFBA 2HNDA 3LDAA 4IG3A 4ZIWA 2IBOA 2W9BB 3CJSA 3RRKA 1X40A 3ISDA 1C1CB 4ZP6A 4R25A 1JWWA 3C5FA 1K5OA 2ZTEA 4NLVA 2GQ2A 5DDYA 3G6VA 3FMBA 1QAJA 3DI6A 3LW5C 4AL6A 5DDRC 1SJFA 4F2SA 5HHIA 4DR2J 4OJ5A 2B9EA 3SQGB 1WKLA 2G06A 5HI7A 3R3TA 2Z2LA 2X1FA 4IR9A 4RQMA 2HURA 3G4SS 5DM6Q 2YWKA 3AA9A 3PX6A 3OW2R 2CDRB 3HZEA 2DNHA 4DDFA 5CQGA 2MHEA 4DV1F 2IYGA 3V4MA 2XMJA 3BR9A 2WB4A 2YBVA 1C1BA 2FVPA 1S6QA 5IFMA 3KLEB 2Y9HA 3CDEA 5AI9A 5AI5A 1M5KC 1F3VA 3T19A 5HR7A 4R8UB 4KGKA 3HULA 5B0CA 3NBPB 1X6IA 2AYMA 5T7LB 4R7WA 1HL6A 4YMEA 1L3TA 3C23A 1S1TB 4WFYA 1WG4A 4F71A 2MZTA 3BREA 5J2CA 1ZQJA 1YKWA 1GMUA 3J81j 3QU4A 4O5CA 1UTAA 2LKYA 1XR7A 1BPBA 1CULA 3R7NB 3WIVA 2QLWA 5KG5A 4Q44A 5A6WA 4K4VA 1JRPA 4CLUA 2F7VA 8ICUA 5ETTA 4IRDA 3O8WA 1LW0A 3GDXA 1NKEA 5IXUA 4PL2A 2W9BA 3N9UC 1P7DA 1N32J 2ZJ5A 2EBGA 4ECTA 1C1CA 5AM4A 3JSMB 5DJBA 2VJVA 3NL0A 5CYJA 2CQ0A 3AU6A 2GJFA 2Y1IA 3Q8KA 3K89A 3OV7A 3VGUA 3EMTA 2NO4A 2YQEA 3SQGA 5FD1A 3SFUA 2Y9TA 3NS7B 2AYBA 2GLEA 2P50A 3QSYB 2J9CA 2EQYA 3PJWA 2J7UA 1FA0A 3UD5A 4YOEA 2YWEA 3MPDA 1HFEL 1SQEA 3LWLA 3LGNA 2G2ZA 5EDWA 3CVKA 5EX3A 1AUSL 2OLWA 1M0SA 2HBYB 3MR3A 2W4DA 1O6XA 3OR1B 2JEJA 1RWKB 3KLEA 4I4BA 4B9UA 2UXDF 2W8LA 5AK5A 4LBHA 4R8UA 1ZM9A 2ZH7A 4OJOA 5L38A 3NBPA 5T7LA 1BLUA 4NXNF 1HR0J 1SC3B 5KT2A 2H3VA 1S1TA 2K60A 2NLWA 4UOGA 1F3FA 3M8RA 4F0MA 3IRUA 1U49A 5KG4A 4PHEA 1FJ7A 3K0JA 2W55A 1PVRA 5BPCA 1COKA 2ZM6J 2B5JB 2BCVA 2GIQA 1ZM2A 2B7BB 5ALKA 4A8EA 1TQLA 1V4YA 3WX8A 4MIBA 1JLCB 3GP9A 4KLMA 4DUZJ 3G2XA 1UT8A 3IR5B 2CWXA 4GKJF 4P2XA 1WYGA 4A8YA 4F5RA 3JSMA 4J90A 3A4TA 3BH6B 1UQVA 2ZNZA 4HH0A 1JB0C 2BCSA 5KG3A 2IA0A 1ZD2P 3R5GA 2CRXA 1R3NA 4P6QA 4UATA 4QJFB 3QGKC 4OI1A 5K5MA 5DG7A 5C25B 1NSQA 4ZVRB 1YG0A 3I87A 2W43A 3W9HA 2DY1A 1KBUA 2GX8A 4QWAA 3CC2S 2AX0A 3L3CA 2FDNA 1TFWA 2NXCA 2MQPA 3S6EA 4DPTA 1ZQSA 3G6YA 2WOMA 2JLEA 3BV8A 4OI6A 2ATCB 3GILA 1CG2A 1ZD4A 3CDAA 3OBIA 2HBMA 1D9AA 3EGWB 2A0FB 3E2EA 3KXDA 1T05B 3V6HA 1JQGA 4UBBA 1UFLA 5DZ6A 3M6WA 2XY6A 1YQHA 4KLTA 4EBEA 2LU1A 2AGOA 3WC0A 4Y2JA 4KBIA 2JSXA 4XA5A 3RF9A 8ATCB 2B5JA 1R27B 3H59A 4H4OB 2YVSA 3HVAA 3L5KA 1HW9A 2R7QA 2OGJA 1JLCA 2E5LJ 2DGWA 5J1NA 2OYYA 2ZZNA 3WKBA 9ICSA 2LM1A 2QLTA 3VAIA 8ICSA 3FFIB 4USIA 4ZVQB 1GAOA 1KONA 2X1BA 3EYZA 1NB7A 5J0TA 3M8YA 3PKMA 5ALVA 4OYAA 3EW9A 3ZZZA 1WOSA 1AQ6A 1CJVB 3M2UB 4LBPA 3R9LA 1A76A 2LA4A 1PSDA 5ALRA 1RXWA 2OFGX 5JVHQ 3SSSA 1QE1B 1Y5LB 1L3KA 5C25A 4PG6A 3PO4A 5DLGA 5F3TA 5AK4A 1IR0A 3KHGA 3BSAA 4M5GA 4MTPA 1OIAA 3NVWA 1HNWF 3QFWA 1J5EJ 2WB1F 1N34F 4RQ5A 3M2VB 4B3SF 3T9NA 3HJEA 2V63A 3NGSA 3MMJA 3PKYA 1XMOF 3HKZC 4F50A 1U1QA 1HKAA 2IMWP 3U1NA 4ZVSB 1OUQA 2QEXS 1EJXC 2QLFB 4X65F 5AIBA 1DHMA 4ZJOA 1ZOTA 4LIRA 2YKNA 4P2MA 3RBEA 5KOWA 4CNZA 1S9GB 1T05A 3C5GA 2CJXB 1RTJB 3J7YU 9ICJA 3LF0A 1PZNA 2WW4A 2CNKB 2KXFA 3B6BA 2DK2A 1TVAA 4QR1A 1XR6A 1W2BR 1JROA 2E9TA 2XI3A 1SZPA 1NSAA 1RT6B 4Y2AA 4H4OA 4DR4J 1WUUA 4MFCA 3K58A 1FF2A 2FHKA 1TE2A 2QSFA 3D6TB 1BGXT 2OMLA 1Y0HA 1R6YA 4DOCA 4HACB 3GSDA 4QIWD 5CXTA 5HAOA 3SENA 4EEKA 3FFIA 2LYVA 2KFNA 5I42B 2PEHA 2F4VJ 5KFMA 3Q8PB 1NDLA 4ECQA 4RDVA 2Q3PA 3EGZA 1VDHA 2I1RA 5L1KA 4ES2A 1CJVA 3M2UA 5C5JA 3CO9A 4C4WA 3VAHA 3ZZUA 1IXRA 4B3ZA 1JLQA 4DL7A 3PSTA 4RWXA 1FK9B 5M2PA 5CZVA 2YQ3A 1UEVA 1POKA 1VFJA 3NEKA 1IXKA 5KAFU 5KFOA 1R7IA 2XG8A 4WU2A 2EFVA 2KK0A 4BJQA 1WHVA 3AD8C 3M2VA 3TA2A 4NA3A 4UAVA 4LBIA 8AT1B 4FN5A 1ZQIA 1M5HA 1FNMA 5D0GA 3NOGA 2R3VA 2ZKUA 3RH6A 1WOOA 1Q7LB 3LPYA 4JB8B 1VK8A 4FPRA 7ICNA 3C16A 2N1RA 4C65A 1AB8A 4B9LA 3O2IA 5AI8A 3BEGB 4A48A 1NOMA 3SXLA 1V9PA 1PAUB 2HBZB 3OXLA 1FWEC 2E7WA 5D4OA 3DYAB 4FF3A 4NXZA 1S9GA 1L7NA 3TZWA 5M2UA 2VPXB 2IVMA 1RTJA 2ZE2B 2PAJA 3ONQA 5EE3A 2WHEA 2EC2A 1IIPA 3NVZA 1RT6A 4H9MA 4QZBA 1UCVA 5C7PA 3GR0A 5EE0A 2GMJA 5F8NA 2D41A 2HBJA 2RT3A 3FQKA 4AQYF 4GXKA 4HACA 1Z4NA 4I64A 3KMSA 1R9XA 2RQKA 4P2HA 1M1KT 1F9EB 5I42A 2HSEB 1LOUA 2WCXA 3M9OB 2CVIA 4DV1J 4DFKA 4OD0A 1NZ8A 2NRWA 3DN9A 3J7ZT 2YN4A 5KG6A 3D5MA 1RA6A 2CQIA 2UXBF 3CJTA 3FEYB 2X1AA 1FK9A 1FI4A 4OJLA 3MDCA 3CTRA 4RW7B 4Q2LA 1EF2A 3KHRA 3J81Y 3VGTA 2AZ1A 3CE8A 3L7UA 4HAIA 2J0QD 1A5NC 3ET6B 4F4KA 3HILA 3CDBA 3RRHA 4J9RA 1VQ7S 1VQSA 3HFZB 4TXSA 1ONWA 1MROB 2C3MA 3LPEA 3QLHB 2DNOA 2G1DA 2RHSB 5EWEA 5HHHA 2E29A 3QSIA 1RWVB 1SC6A 4NEYA 1NSPA 4YXJA 7ICVA 5ETKA 4MAKA 3DYAA 2LPEA 1YJTA 2GJ2A 3NWGA 4EO8A 7ICHA 2ZE2A 4ZPAA 4FF4A 2E1RA 3T9ZA 2FMSA 5I3QA 1GTHA 2VA3A 4JMUA 3V7LA 4MYUA 2XGQA 4TQSA 3K1ZA 5DS7A 3TVKA 2ZIUB 3M8SA 3IG5A 5HROB 3ILOA 2DKXA 1S6UA 5LJ3Y 4BKNA 1A7GE 4DQIA 3EVWA 2KZMA 1NJIT 2F3JA 3H90A 3CJ8A 3BSCA 2JLFA 2OPQB 2FB0A 4A8SA 3H0LB 3B82A 2BW7A 3DV9A 3KK3B 2ZXHA 3C14B 3QPIA 2HNZB 3VGSA 1VHFA 2QT7A 4FS1A 1B0PA 1EHWA 3LA4A 2OEJA 1F44A 3THPA 5GADI 4Y65A 5GAEI 2BCQA 2GO8A 4RW7A 4NXNJ 5LMNF 5HN0A 2MKCA 2UVUA 1ZBTA 5JJBA 2X7IA 3KK2B 3ET6A 5FSEC 3TUZC 2GOKA 4LF9F 4NASA 1KFSA 3MCOA 4FNHA 1MROA 5KFEA 2CXEA 4EUVA 1MN7A 2FC9A 2MHNA 3EVMA 3PYDA 1RABB 2QJ3A 2LECA 1HQUA 1M5SA 3J7Z5 4GKJJ 4LSZB 1Y9OA 2ASDA 2GA7A 1NK4A 3HO1A 1BY9A 4OL8A 3PRVA 3TZYA 4RUAA 3DLHA 1SKSA 4JK1A 2E1CA 2CA9A 2UZ9A 1K47A 3QRQA 4YEAA 3R7SB 2BBEA 4DMZA 4DV7F 2E8OA 1QUPA 3NNAA 1IM6A 2NXUA 5J2BA 4XIUA 1GKRA 5LXYA 3Q22A 1T02A 1MG7A 1ONXA 1P9QC 2ZIUA 1VIXA 2Y1JA 2HQGA 3RU0A 2FJVA 4NCGB 5HROA 2OUGA 3L4PA 4L3KA 4O23A 2H4YB 4EFAC 1FWKA 3CMQA 5AE1A 1KKHA 3QQCD 2OPSB 3W66A 8RUCA 3SAHA 1NZPA 5LL6d 2OPQA 2F9DA 1AW0A 3R9KA 2UBPC 4D3HA 3KK3A 4RU2A 4DCCA 5E33A 2HFUA 3C14A 3G8TA 2HNZA 1TFYA 2CNNB 2HW3A 5CABA 4KMOB 4ENOA 3IA0A 2AW0A 4RW8A 2HFSA 5AKYA 1RG6A 2DNMA 3SSQA 2F8MA 3CJRA 3OPKA 1IBMJ 2XWXA 4CT9A 4L72B 5DDOC 4J9QA 4QZHA 4F67A 1JNZB 2VFUA 3Q23A 3NCPA 3KK2A 5J0PA 3UD4P 3T5HA 3KDNA 4KGMA 1JJ4A 4F0KA 4FYXB 5F8HA 2CADA 3AAWB 3CJQA 2J7WA 1F5CA 3V7JA 2DR7A 2IRXA 1RDFA 4Z7YA 3BBCA 4HL9A 4G65A 1I1GA 3G8SA 1H2UX 3P45B 1XTZA 1W26A 4IFYA 5GMEA 2PE8A 8ICRA 4USHA 2VOOA 4P4OA 2V6AA 2HMIB 1HBOB 1WC3A 5JUMA 2BZ2A 5AM1A 1L7PA 1JLBB 2NS1B 3T5JA 1ZA2B 2AT1B 3UDEA 4ID5B 1RZMA 1RWWB 4C60A 3IV8A 5HJXA 5IWAF 3FKBA 2ZIXA 4KN4A 2DHSA 3QGHA 2WVEA 5KFKA 3R1LA 4NCGA 5ALXA 3FCVA 3V6DB 1JMTA 5J2NB 1RHMB 4IQVA 3JPPA 2OPSA 3NGDA 5FDLB 1HNWJ 1ZXIA 4CLLA 5EX0A 3BR8A 3DDKA 1L3SA 3F73A 3RB3A 2VDIA 3SSRA 3ZZOA 4B9NA 2WSEC 3ETOA 5I3UB 2EFNA 3UFCX 2DO4A 3EZ5A 4DV4J 4PQUB 3RR8A 4J91A 2DNZA 4X65J 4F4XA 3EGVA 1I94J 4CLYA 1RT7A 3R1HA 2RKIB 4NM1A 1U1OA 4PXDA 3K8WA 1KRCC 1PCAA 1K44A 3RBZA 4J5OA 2HVDA 4OCZA 5KG1A 2KIVA 5HO4A 3FEXB 4PPZA 1UPHA 1NEEA 2LCWA 3UM9A 4HI1A 4Q2MA 4PGXA 1N62A 2IPOB 4PRFA 1G2EA 3TI0A 1EETB 4K4TA 2AHOB 3ETLA 1VS3A 1RBAA 5HMYA 4QWEA 2KYZA 3R5DA 2QA4G 2K3KA 5IT9U 3KJVB 4RBUA 3HCXA 4H54A 4WFNQ 2HMIA 1HBOA 2PA8D 3QGIA 1CBKA 2GWNA 1D1UA 1JLBA 2QGFB 3N0VA 1NU4A 3LOUA 1QDUB 5AIAA 4RKUC 3M6ZA 1EJVC 5J2QB 1TKXB 1QD1A 4ID5A 1N2XA 1VJWA 2I38A 1ZQXA 2V67A 2F2AB 3SR6A 5HMEA 2OCEA 3I0SB 2CPXA 3O7UA 4J9LA 2OJ3A 3KFWX 3D6HB 4X62J 2E1FA 3DU6A 3V6DA 3IGNA 5J2NA 3T81A 4BUGA 5AM0A 2VA2A 5AKIA 5IV3A 1YRXA 1MLAA 2ROGA 5FDLA 2YKMB 4NWIA 4W92B 3M7VA 2BPCA 1SPBP 4QCLA 2XIDA 3C2PA 2ZHBA 2Q09A 1FIQA 2P35A 3FQLA 4FXVA 1XRFA 5I3UA 3KBBA 5A6TC 2M9KA 4PQUA 4MIAA 2QB1A 2E8PA 2FHJA 4F3OA 2B6AB 3DLKB 4L76A 4I67A 4DR5F 2RKIA 2JFDA 2QTWA 1BWEA 2BRKA 2HYIB 1F1BB 1LQ9A 2CPFA 3C66A 1AFIA 3FCHA 4PXCA 5J2KA 2ROEA 3TAQA 2E5IA 3R5JB 3AUOA 2ZJPQ 3OUYB 2DR8A 1E6VB 2R2UA 4ELTA 3VAMA 5JU5A 1S1XB 4OI4A 4M5NA 5DKWA 5DQIA 1EETA 5AXKA 3DOMB 1D09B 2CWKA 4CYUB 4AQYJ 1UWBB 2DXEA 4DV3J 2O5DA 5CJ7A 4C7YA 3KJVA 3I32A 2KHQA 5J2EA 2WAQD 2JWNA 2VBXA 4PWDB 2H3EB 2ILYA 1HBUB 4DBQA 5J2QA 1TKXA 3O0FA 3TUJC 3GTYX 4G6VB 3K5OA 1TUGB 3AOCA 4H4MB 3LUYA 1LVHA 3QUCA 2OSRA 4P2SA 4DSKA 2QA2A 2FD2A 3I0SA 3I4HX 1ZQCA 2V4JB 2W1BA 3QU9A 5KFVA 3C1ZA 5IC6B 1VQ8S 4L75A 1Z1VA 4DOZA 7ICKA 2YKMA 2WF7A 4NRTA 3HRDD 1X8DA 2OAUA 4AYBD 2DTJA 2HQ3A 2FGCA 4RX6A 2D1CA 2QSWA 2EDUA 3JSRA 4JYAF 5K8OA 1IBKJ 1HJPA 3CWJA 4P71A 1OS5A 3AXKA 5LXXA 1T94A 1VQOS 3A8KA 3ZDEA 2KDOA 3Q24A 2CPDA 4ZCKA 2B6AA 1Q5YA 1XMBA 1EZZB 3DLKA 1H2VZ 4QOTA 4N8NA 3UDVA 3SAFA 1LWCB 2ZBQA 4C0ZA 4MF8A 3GYNA 2MTLA 1WNEA 2YNIB 5JRTA 3OUYA 3LWMA 1E6VA 1S1XA 3TRGA 4UB1A 4JI6F 3ICLA 3DOMA 2RQ4A 2GIRA 5IIOA 1U7LA 2RIJA 2F8HA 4CYUA 1DURA 2O3DA 2QARB 2ZH4A 1NK9A 4RO0A 3OXFA 4DQSA 4PWDA 2EG1A 1I5OB 3ETRA 2DNPA 4X4RA 1HBUA 2F77X 1OPZA 5ALIA 2MY7A 2QG9B 1U1MA 2BE7D 2W4CA 4H4MA 4YMOA 2YNHB 1LWFB 5B0GA 8ICBA 2DR9A 3D1OA 2V4JA 1V5VA 5KFCA 3W1YC 3MR7A 3TO8A 3VALA 4M47A 4IQTA 4I2BA 2IBKA 3U1LA 5LMNJ 1FDAA 1H3DA 3OQ2A 2Y0SC 4JI3J 1SKUB 3AU2A 2D9PA 1T0TV 1N6QB 5AKGA 4LF9J 4KYZA 3I82A 3B78A 2BJ1A 3VQSA 1ZAXA 4B9VA 2C2ZB 1MU2B 4E8UA 4FP9A 4DUTA 1S0MA 4NA1A 2IVYA 2LKZA 2R7SA 5J8YA 2DGUA 4DPOA 2FJ6A 2VKQA 3BSOA 1O5JA 1SV5B 3D2SA 3GR1A 3HX9A 4NZ7A 3HVRA 2C2NA 4F26A 2Z30B 3LTOA 3N5FA 2I6XA 2VC1A 1YJRA 4KQZA 1LWCA 8ICLA 2K4PA 1R8BA 1PYSB 2PFDA 4DV7J 4RZBA 3K4GA 5EWFA 2YNIA 3I1YA 2CPHA 4OV6A 3N6NA 1ICEB 3NXZA 2W2NP 1ZM4A 1S0NA 2CJ9A 3MGIA 3RBXA 2XQCA 4TKTA 2ZH3A 3FSIA 4ZPCA 3BQ2A 2MQMA 2E66A 3CD7A 3I0RB 2ZOFA 4F0HA 4TURA 2QARA 2OO4A 3TEHB 1FWDC 5HQMA 2VC0A 3WK6A 1WCNA 1PKUA 4KSEB 2MKIA 2HMXA 1NUEA 2ZUCA 4OZ5A 2WF9A 2HEKA 5L9NA 4DV0F 3OGUA 1HQEB 1DQAA 4WZQA 1M1GA 3KNAA 2YNHA 3IM9A 1LWFA 3PCOB 2CPEA 3U1MA 1M6YA 4LQ3A 3V81B 1UKUA 2NYHA 5IOLA 4B9TA 2I5JB 1FRMA 2VG7B 3HHNB 4F4AA 4ZH4A 3AQPA 1NXIA 1YJUA 4J9NA 2R4FA 2G5IB 2DQNB 1N6QA 2RE1A 3IGHX 2CPYA 3NCQA 3I5CA 4YDDB 1KHVA 3OJSA 1MU2A 2UVVA 2IM0A 5B0AA 4CP5A 1WI6A 2OPRB 2EANA 1N88A 2HQIA 1FKPB 3HHLB 2YKQA 1R89A 4U7CA 2E5JA 2ZH2A 2OP5A 2GIFA 1CJTB 1TK8A 2A3VA 1SV5A 1LXNA 3RTVA 3L4BC 1SI9A 7ICTA 2I9UA 4NLQA 5ALNA 1GT8A 1IQTA 3CYMA 2RUGA 3A12A 5FIIA 3JPRA 2M52A 1TV9A 3RG6A 4NLCA 4DX5A 2WHOA 1B70B 2DNNA 2LEBA 2DNKA 3ZO7A 2PMHA 4DU8A 2V9WA 1F5AA 3MM6B 1NHUA 2PMWA 5JTIA 1HEKA 1KW4A 1MN9A 4UW2A 5AE2A 9ICWA 5ETOA 1JK9B 4HDGA 3I0RA 4U6PA 5HNKA 1RISA 2BVZA 1D0EA 3I9ZA 1LKYB 4EBCA 3KG0A 2AGQA 3QJLA 2DGZA 7FD1A 3DM2B 1VQ4S 3Q89A 3I4PA 3NP5A 4OQJA 1FKOA 4BDPA 3A3NB 4U8YA 1HQEA 2RRAA 2W9AA 4JV5J 1RUSA 2A2CA 2BB0A 4CF4A 1UZDA 3GYGA 2GMLA 5D78A 2MKJA 4L74A 3V81A 3ZTSA 4ZP8A 4R65A 1S77D 2XHCA 2J0SD 2K1RB 4CO1A 2I5JA 4IQWA 1IE7C 1RCOB 2FPHX 9ICLA 2VG7A 3W8PA 4QZVB 3C3LA 1RAAB 1LV5A 1QJHA 5DM7Q 5KFDA 2F5GA 3HVWA 2RUSA 1LW2B 1QAXA 5KFPA 2KRBA 4I68A 2KG1A 3V6JA 1RU2A 4C7QA 2OGUA 3GIQA 2KG0A 4QWCA 2OPRA 5CEHA 2H48B 4P74A 2R7RA 1FKPA 3HHLA 3QNWB 2AJ4A 1RT3B 1CJTA 1MNEA 4DYKA 2HZVA 3M2RB 5BJRA 1HHQA 1DK3A 4NLSA 2QL7B 1KN6A 3PXGa 4NLDA 2HGNA 2X3GA 3CIMA 2CNLB 2C3PA 5ALMA 3MM6A 4JI0F 2GC8A 3GPAA 1PK3A 2CDQA 4NMXA 1IR1A 4EPDC 1ZS6A 2HS3A 2RJZA 4RPZA 4M8LA 3A8EA 4WIQA 3CD0A 4UB4A 3DHXA 1DAXA 4P7VA 1LKYA 4DX8H 5H9FK 4WYWA 1JNRB 4TQRA 2FLPA 3VCDA 2WF8A 3DM2A 2M4MA 4P4PA 2BX6A 1CSJA 4JI7J 4LF4J 1X6JA 3MTWA 3H42A 3N5BA 3H0MB 5J2HA 3NWRA 3NVYA 1SCJB 3UW1A 2JH7A 4KJIA 4XDDA 3CGIA 3FVYA 3EJMA 3EUNA 3P96A 2ALYB 3RH4A 5AK3A 4WPAA 4NLOA 4UB9A 2UP1A 2K1RA 3UMGA 3FJ2A 3D4JA 4LMZA 4X66J 3I76A 3T5LA 5K14A 1SKRA 2VKRA 3GV7B 2LDYA 3FBBA 2K8GA 4KLFA 2BQ3A 4DV6F 1WOPA 1FWBC 1BMQB 3N01A 1XC9A 1NK0A 4LRDA 2NXEA 1EP4B 1LW2A 4ZS6A 1EAYC 1IG6A 4JI8F 5CCLA 3C8YA 4ITSA 1F60B 5ALZA 2FZKB 4BHQA 2PFFB 3O5TB 1L7OA 4WTOB 4JI1F 2CRLA 1PC5A 2VM8A 1RT3A 3OFEA 3JS9A 1FXRA 4MEYA 1XS9D 2HAFA 2KT2A 3M2RA 3GU0A 4MJKA 1VQKS 5ETVA 4DR1F 2DR5A 4GKKF 2G1HA 4MKVA 3MM8B 2JRZA 2PI4A 2RF2B 3V7PA 2Z2ZA 3BS7A 4PXBA 5D3GB 1TAQA 4QZEA 3QATA 2IYIA 2WTFA 2VG5B 1T3OA 3PSFA 5J2DA 1X4AA 5ETRA 2NPFA 2ODGA 1H98A 4M94A 2JVRA 5BXIA 4KLGA 2B0GA 4NRUA 2DHHA 4ID8A 4LRBA 3SFGA 1RAEB 3F53A 4Y2CA 5L8RC 3D6NA 3CCWA 1ZD3A 1SB6A 4IOAQ 3IXQA 2AEJA 1WSVA 2HOQA 3T5KA 5BOMA 1ZZFA 1S4EA 2OM6A 3HF5A 2RILA 1UA0A 4NLGA 2PFQA 1X4FA 1BXNA 4CEUC 3C6UB 1VQNS 5GADU 3MFIA 1G1XA 1FJGF 3F41A 2ZC4A 3G96A 2ICSA 3MM5A 5DETA 2RH3A 1NDCA 3M7DA 2IMOA 2L5YA 2P6TA 1EJSC 1TMJA 4DSFA 2B4UA 5LJ5Y 1D9FA 4FZLA 1EP4A 4LREA 4NPOA 4J9UE 3PFOA 4UZBA 3R6GB 3BDEA 3KJNB 3DNCA 1V9OA 3GFXA 2W04A 4KO0B 4USTA 2LYBA 3EVOA 4V1XA 2MQLA 4C97A 4YCXA 1FT8A 1YJVA 3DLLQ 1XK8A 5GAGI 2V2ZA 1RA5A 1UHUA 4F3MA 1K70A 5CCMA 2AKWB 4CM0A 1T3NA 4C8ZA 3KYLA 4I2CA 3VVUA 3ILLA 1KQFB 1ECWA 5D3GA 1YLXA 3HD1A 5KFIA 2MB0B 2VG5A 2WVFA 3T41A 2KE7A 4KH0B 1V3SA 1TAUA 3OL7A 3LNPA 2C2MB 1UVKA 1FTRA 3VC8A 1NHVA 3DDIA 4IO9Q 4EYHB 2J9DA 4UAUA 1YSJA 5C24A 3W3SA 1Z3EB 2ATLA 3DU5A 3SCJE 4Y2VA 4WF9Q 4YVZA 1B4SA 5ALDA 2BABA 2VOPA 1C7YA 3KD3A 1NSKL 3R2CJ 2E1AA 2BJ8A 3Q8VA 1S1VB 2KXHA 2CQ1A 4RZRA 2HBQB 3I96A 5DG8A 3ALRA 4DF4A 3HSGA 2KM8B 5J8YC 3EDQB 4I6AA 3CXCR 2JHDA 1CLFA 5ALWA 3VR1A 1IUJA 1GO3F 4MKYA 2PIIA 1KS2A 1WC5A 2HQDA 5DDPC 2VZ9A 2H5IB 4DLEA 1VLYA 3AJ1A 4LF1A 4KO0A 3RJMB 4CO4A 1BNPA 3FSXA 4KHPF 3ZNUA 1OSDA 4YHHF 1Y5IB 5J0XA 4USMA 1U1LA 2RHFA 2VQEJ 2KH9A 4DR7F 2FYXA 1JMSA 4RJVA 3NRWA 1RT1B 2E7VA 2CVEA 5M2RA 1V51A 2ALZA 3KUGA 4WK1A 1WWVA 2W9CB 2CIMA 2DBYA 1OQ6A 3KUEA 2WW8A 2VH7A 2ZIWA 2RU9A 1IKYA 3F2CA 4K5RA 2HGLA 2JL9A 4URGA 3OVSA 4EENA 3EGNA 3KJQB 1C0TB 4G3IA 4CTAA 1J27A 3HFKA 5KT3A 4HHJA 1U1PA 5DDQC 5CP2A 4PUOB 5K9FA 3GFHA 2DGQA 2WVCA 2ZOMA 2ZXIA 3MD3A 5DG9A 1QM9A 4YD1A 5AKLA 3HJFA 3EPGA 4OYXA 3PFEA 4IRCA 1YBTA 1RWUA 4Q0BB 2DIVA 1J2VA 4BS2A 2FY8A 3MUTP 3R7BB 9ICBA 2MY8A 3MC1A 2YTUA 2QA1A 3HKWA 2JEGA 1X42A 3S8SA 5ETMA 4NWBA 5AI0A 2V69A 2I5HA 4GOAA 3G86A 2PN6A 3ICXA 5KL1B 1FWGC 5D77A 2RP5A 3Q8RB 2W7PA 2V0NA 4H4KA 1YWXA 1DTQB 1RWNB 3BB5A 1VR6A 3SV3A 3MEDB 5G0RB 3HKZD 4BJHA 1Y5NB 3CD6S 1VI7A 4E0DA 3GG1A 4Q7AA 2VKZG 5CHCB 9ICMA 3QWUA 2XMMA 1E6YB 3LALA 4O3QA 2P8IA 4NL5A 1RT1A 1HNVB 3NOCA 2C3UA 1FJEB 5A6PA 2QFIA 3AH6A 2W9CA 2P6SA 5E0OA 2VG6B 2HHWA 3FAHA 4K8RA 4M2YA 3IBWA 4GMKA 2F8LA 5LMUF 4DOBA 3IO1A 8ICYA 5EOZA 2ZH9A 1C0TA 4C11B 4FFDA 3ISNC 1OWXA 4FZVA 1AUDA 4PUOA 1LXJA 4QU6A 4LT6A 4IC9A 3FRZA 2FMPA 2B51A 4RQ1A 1PJ5A 2KKPA 1A6SA 3BQ7A 1A5MC 4R0EA 1FFVA 1UAWA 1CC7A 4Q0BA 4UAWA 7ICIA 1EB0A 3L95X 3HPOA 3B4DA 5BOLA 4NYOA 4ECYA 5J2JA 3DRSB 4X84A 2Z8QA 3HHLC 3BF4A 2AQOA 4X5VA 2MZRA 3JTNA 2LYHA 3GSIA 3VQTA 3VAJA 3SBMA 1KRBC 2B9WA 1OY8A 4B17A 3CCQS 5IT9Y 1MW7A 2DWQA 1FE0A 1N5YB 1HBNB 2HKEA 4AE5A 2N7YA 3K5MA 5KG2A 4WU3A 4ED5A 1QTNB 4JI0J 2RQ5A 1XWLA 2L9DA 5G0RA 3QT8A 3LAKA 2LQ8A 4FKYA 3BO3A 2LQJA 4C8NA 2GHVC 1Q46A 3V4IB 3TR5A 5B0FA 3NVVA 4LSLB 3CMAS 4CNUA 3IM1A 8ICWA 3NCRA 1XERA 2HPUA 3PM9A 3BSNA 4HEA9 4FVMA 3MGJA 4ZLNA 3ZD9A 4AT1B 1JJ2R 4FYWB 3ELHA 3QZ7A 1HNVA 9ICOA 3TUPA 3FBEA 1NPKA 3X3UA 5ETPA 1V38A 1NDKA 2VG6A 3JPQA 3MPVA 2B21A 2AMCB 1NNDA 3PMLA 2YPZA 3K59A 4M6WB 3WDOA 3A8IA 5TISU 4ED2A 1XR5A 3BYRA 4KB7A 3WK5A 1BPYA 2H3FA 1C2PA 2LEPA 1JJCB 4X4PA 4ZIVA 4C11A 2CJYB 4RU9A 3J81U 4O3SA 2LXFA 5AKZA 4RQ6A 3C2MA 4DV6J 5G4HC 2KG5A 4N5SA 9RUBA 3DLGB 1RHUB 1Q86T 3NAIA 2B43A 1XQIA 1IVZA 2JFKA 1O12A 5KFFA 2YXLA 1WG5A 3MM7B 5AE3A 4JI1J 4C9DA 1WF1A 4KFBA 2YB1A 2C3YA 2XZDB 2KXNB 2IM1A 3DRSA 4DR1J 1PBAA 3PO5A 1RSCA 2Z7JA 1GMVA 1X9MA 1UJ5A 1FFSB 1MQ2A 4P0PB 2GJIA 4DSJA 2V68A 1YT3A 5IIJA 3FC9A 1UVIA 4PG7A 5HATA 1N5YA 2FJAB 1L3UA 3FCWA 4PZVA 2A1AA 1P1MA 2D3UA 4EP8C 1N5WA 1S0VA 5DB6A 4MMOA 1QSYA 2LDIA 3RJJA 3TYTA 3MXHP 2O6KA 1U47A 1UWAA 3RUBL 3TJAA 3V4IA 4UB5A 3ZZRA 1F2HA 3SCLE 4Y2XA 3T1HF 4LSLA 2ZUBA 3PNCA 2ZVIA 3AJ2A 2VICA 3P6YC 5E41A 3UD3P 5EGYA 3ZTQA 1WD6A 2QMXA 1JKHB 1K9MT 1HI0P 2XS2A 4HT5A 2HHPA 1RTIB 1QSLA 2ZBPA 1WHWA 1PJ7A 4M5DA 4LUBA 1GXTA 3AD9C 3UN2A 2PD1A 4ZVHA 1HWKA 4M6WA 1WI8A 3OTEA 1NHKL 9ICVA 1PC4A 2J8SA 1L8LA 3QZ8A 2JC1A 1REVB 1K0TA 4CQDA 2HIQA 2DBBA 1DBDA 2IM3A 3DLGA 4HKQA 4FBUA 3QJPA 4M63A 3N28A 2AP6A 2GOLA 4R66A 4JI2F 2H51B 3MM7A 2CUYA 8ICQA 1KLNA 2PMZF 2FQQB 2YY3A 3M8ZA 2ADCA 1R9ZA 4OYZA 1QAYA 1YX2A 1T9WA 3CJKB 1DQ9A 2YX8A 4M0AA 1FDNA 3CCUS 1WHYA 2F1IA 2V9KA 4GVBB 2LI6A 3HVTB 4I56A 4P0PA 4CZCA 4Y2RA 1ZETA 1NI3A 3ZZTA 3SIPB 2V5HG 3KNGA 3PIPQ 3TP2A 3GE9A 2L41A 3CC7S 3MBYA 2JZ5A 3GFZA 3IBFB 3OTBA 4P72A 4DUYF 1YTYA 3A1YG 5A2QY 4WYLA 4OYMA 4WBFA 1AYEA 3HT3A 4GXIA 4OLOA 4OFZA 2UXCF 1HUZA 2CXYA 4B3RF 2ZUDA 5J2IA 2BRLA 1NRKA 1S59A 3LSCA 3W61A 8ICGA 3AQEA 4PXEA 3NMRA 1BPXA 3LP2B 1GMWA 1KD1T 4DR6J 2LXUA 1FDDA 1RTIA 4LR9A 2JV3A 5ALSA 1S12A 3CCES 3THVA 3SYZA 9ICRA 4OX9F 2GNKA 2HHHF 4NJ8A 4YFUA 3A0BU 3T1YF 2G3FA 1IM4A 2B6GA 1JLFB 3M4XA 1REVA 2H65B 3FM9A 4A8WA 4FXWA 1FWFC 5F0UA 3QFHA 4MFBB 2DGOA 3HX0A 1FX2A 4U95A 4NLBA 3W2VB 5DBBA 3H7HB 2L48A 5AKJA 2Y0BB 1K6WA 2L08A 1SQGA 1SWWA 1R31A 3CJKA 2EG2A 4C4RA 3E0LA 3MEGB 4GVBA 2E8MA 4ZJLA 4DR7J 3JPNA 1VJ5A 2ZD1B 4BWJA 2J9DE 2QL5B 4NLWA 2E5HA 2ILZA 2EH9A 4TYAA 4R85A 2IJFA 3DRPB 4YDXA 1JXLA 4LFBJ 2F8EX 3F0NA 3J7A1 2XYHB 4F2RA 3UMBA 2DXFA 5D0RA 2UUWA 4EELA 3T6JA 1D8LA 3W5YA 2K4EA 4I2EA 4N8OA 1TKTB 3PACA 1HWUA 4US9A 2IVFB 3LP2A 3ZTRA 1X5TA 2BDUA 1VQ6S 2KHCA 1P8GA 2KMDA 4NLNA 1RXOB 5F41A 3BGFA 2BKNA 3UQ2A 4J9OA 1SGGA 4A47A 3HT0A 2ZH6A 1HYSB 3ULHA 9ICAA 1ZD5A 5ALGA 2QT3A 1U26A 2B3TB 4DG1B 3SI8A 3SQIA 2FI1A 1T9UA 8ICKA 2UVRA 3T6BA 7ICGA 3T8LA 3GWCA 3NLCA 1JLFA 4QPXA 1X4BA 1JXVA 2Q0ZX 2KVIA 2K2PA 2KM8C 5IQ6A 5HVFA 2YMLA 3MR2A 2HNDB 4MFBA 3VAGA 2XICA 5IIMA 2LQBA 4M5HA 1D8BA 3ZTOA 1ITPA 4H4KC 4OJ6A 3U26A 4K4SA 3ISCA 4KH1B 4RW9B 3PEHA 4LIWA 2BM1A 3TZXA 3MEGA 2YWFA 4HLBA 2MMYA 4ECWA 4ZCMA 2GFFA 4RPYA 1Q4RA 2ZD1A 4ICLB 4K59A 2VHLA 4M9JA 1BPZA 1FWPA 8ICFA 3DRPA 1Q8IA 5FLXY 4UTGA 1WG1A 2I6WA 2R8JA 3ED5A 3K7RA 2W9MA 4MK8A 5LMUJ 3OJUA 2CQBA 5F9LA 4RNNA 5KFYA 3FSYA 3RJEA 4GBDA 3OPXA 1N36F 4YB6A 3EM1A 3UCZP 1ZRNA 4ES3A 2HVHA 1YGYA 1LK7A 1N52B 4HHUA 1N63A 5ALTA 2BZFA 2AU0A 2AQVA 1NKBA 3QGGA 1KQSR 4C3LA 1FERA 2VDHA 1OQ3A 3BPSP 4X4QA 4DG1A 3HWTA 1Y3JA 4OHXA 1J6PA 1FRLA 2EAOA 3QE9Y 5J0WA 4WFAQ 4ZPVR 5ALLA 4BCAA 3N79A 2FPLA 2XS7A 4DZHA 2FMQA 1RAKA 3PX4A 3HSDA 3X1LB 2E1MC 1ZQGA 2VB6A 5L1LA 1LW0B 2IM2A 1S79A 1OXJA 1R8PA 5IZHA 2CFXA 1ZQFA 1WDDA 2AWZA 1HNZF 3LSBA 2P9GA 3UR3C 2HK2A 4RW9A 1FRJA 1WWHA 3WIUA 3D0HE 3ZC4A 3NS6A 3MOJB 1TR0A 2JRSA 3GJTB 4ICLA 3KMQA 5IS2A 3TARA 2XNQA 4YP3A 4DFDA 4Q5VA 1KVIA 4KGVB 1XIQA 4C48A 1QLNA 3ISZA 2VHGA 2B56A 3F56A 1A9NB 5HBMA 4PZNA 5JVGQ 1TAMA 3FGVA 4PZOA 3IRXA 4PYAA 2KL8A 5AJ3F 3K1RB 2J6TA 4P0QA 1ZQUA 2KP7A 3J7AN 1KFTA 1K1SA 3QJJA 4ERDA 4Y2UA 3QT7A 2M9NA 2MLXA 2VONA 2XZWA 3KWMA 4DQPA 1H2TZ 1HWLA 3UE2A 2XWYA 2XO6A 4V19J 2E8NA 3EXCX 2B4PA 3DRYA 1HA1A 2WVBA 3E8OA 4YB1P 4Q45A 2IA6A 1FTCA 4CEXC 2EPIA 5KFXA 4F5PA 2BPFA 3DMJB 3H8WA 2H5EA 5KFQA 3AHPA 4OO1J 4IUFA 4C0OC 4DJBA 5AKQA 4CO5A 2OTLS 4JB3A 4WGXA 4QNLA 2D69A 4OX7A 2VASA 5BR8J 1RAIB 4X4TA 4F92B 1GX5A 4RQ2A 2MUTB 3UVJB 1SV0A 3RB0A 2H3ZA 3T1HJ 2HG4A 2ZJ8A 5GAGU 4DFPA 3ZZ0A 4ZP9A 2WB1C 4ECVA 2G0JA 4DEZA 1FEHA 4URQU 3TEGA 1WTBA 1UCNA 1B3TA 1X4EA 1PBUA 4WK3A 1BPEA 2R18A 5AK6A 1VRTB 2FZGB 2YWWA 2C42A 1GXLA 1XO0A 3KLFB 1VHIA 3QEAZ 2J0XA 1SL1A 5KFLA 2DNLA 4OJPA 1ZQZA 4QIWF 4E2FB 4NCBA 4GVLA 4QZIA 1TL7B 1F2GA 2WOMB 1X4CA 2CN1A 4UAYA 4YB5A 1RHKB 3ENWA 1JLAB 4QU7A 2MZSA 7ICRA 4OI0A 3G9CA 3Q8LA 2QIFA 2NRZA 1RM6C 1KRPA 1OSCA 3JSYA 4C5YA 4KT0C 4OZLA 4C98A 4CO0A 1VISA 1WWUA 2B9YA 2IMRA 4ELVA 3DMJA 2XY5A 3TFRA 2CPRA 3H2UB 4QIVA 5THWA 2JVOA 1T9XA 4JBCA 4A8FA 3W9JA 3ZD8A 5HK4A 2WSCC 1L3VA 5A8KB 3B9JA 3MHYA 3IP4B 2Y0SD 3O6QA 3W65A 2FPMA 2HWTA 5KFHA 4PPXA 1X7VA 2AEFA 2MUTA 2DYAA 3UVJA 1U45A 3EWGA 2UXCJ 2R7VA 4B3RJ 2DGXA 3Q8QB 2ZJAA 1FRXA 4OX6A 2IIHA 3NMAA 4Y0FA 2J6SA 4ER8A 4CF3A 4YMMA 4J37A 2K4IA 1KEJA 2JEFA 1RB0A 1RJJA 4DSEA 4M9LA 3GJQB 2QLJB 3OTOF 3WK9A 1ZQNA 7ICEA 1BHNA 2BXJA 4KLQA 1VRTA 3EWAA 4IDKB 2BW2A 5K8PA 3QRRA 5D0HA 2UVWA 2VJ5A 3KLFA 8ICHA 2D3OR 3I31A 2RRDA 2HS4A 3T1YJ 1DZ5A 1YBQB 3ZTPA 4C80A 1NFGA 3E58A 1CQMA 2HS0A 1ZH5A 4KLUA 1TL7A 3NS1A 3DHWC 2FTRA 3LVVA 2J6UA 4RQ3A 2ZHAA 2DT9A 2JC0A 1JLAA 4RUBA 5LSOA 1N0UA 2BOAA 2YKNB 3PSIA 3MZIA 2AXTU 2U2FA 3RZAA 2RRNA 1SJ4P 1HBMB 2QA4S 2D8CA 5D4LA 1E9YB 3M9MB 3RJHA 1Y10A 1H72C 4NE9C 1RHJB 3UDLA 4Y2MA 2JOQA 3VGVA 2MYFA 3D28A 1A0PA 2XI2A 4ZJQA 9ICQA 4QZDA 4LH8A 1F0XA 1WTFA 5EE1A 2YH0A 3OLAA 1NB2A 4B3MJ 1NPPA 1N33F 4ED7A 5A8KA 3S1TA 2X1GA 2AJ1A 1KVJA 4LFCJ 3RH5A 3D2NA 4DCJB 3R97A 4PR6A 4FKXA 1DOQA 1VQ9S 5GAHU 4QZCA 4YR3A 5LM7E 4K4IA 1XRTA 2EXUA 2LHTA 4I2GA 2RHQB 2P9EA 1FNXH 5IIKA 2HHVA 3D9BA 3DGVA 5B66U 4ELUA 4K4ZA 1JLQB 2YX7A 1S4FA 3QX7A 2YNGB 4Z6FA 1RGVA 1ZRMA 2KN4A 1HI1A 1T9YA 2BQRA 4K2JA 9ICGA 4IDKA 3GFKB 1UW4A 1URRA 2YKOA 4DWIA 1U2CA 2XSFA 1SJ1A 2K8AA 1YHQS 1YBQA 4KY3A 3MDFA 3ONNA 1RQLA 4B3TF 4Y00A 8ICNA 2AJFE 1Q0NA 5I4MA 2KOBA 3C16B 4WKYA 3QMQA 4BX9C 2EBEA 3KZIU 2G13A 3D68A 3IGVA 3CCRS 4LFAJ 2CPZA 1UFWA 5RUBA 2LQ5A 3BBBA 1HBMA 1ZQAA 5CYQB 4OHZA 4M1KA 2IJRA 2BQUA 1VBZA 3FEQA 2PC6A 2UU9F 4C8MA 1X9WA 5AXNA 3CEDA 2MQ8A 3WHIA 3AMZA 5KFWA 3WK8A 3NGTA 4DN9A 4G1PA 1NMEB 4NLUA 4DU7A 1JX4A 4UB8U 3FNNA 3H4DA 6FDRA 4FYDA 5L39A 3PW2A 4UW9A 3G87A 1JN3A 2Z2MA 5SZTA 3MAQA 4DR3F 5CRXA 2JX2A 3MM9B 4LF8F 1RLDA 2LU2A 3UDCA 2A3JA 4L6V3 4ZHRB 1IKVB 1SIZA 2HBKA 3PYGA 2LLZA 2ABYA 1IN0A 1CEZA 4USAA 3PHEA 2RMLA 4A8KA 1JXEA 3FC4A 3DDNA 5AI4A 3WC2A 2I0XA 2YNGA 4NLTA 5DDMA 7AT1B 1FWIC 1R0CB 2DUYA 2QMUB 2E1PA 3ZI4A 3KHHA 4AQLA 4A46A 2CNOB 4ZDNA 4WP8A 1O08A 4DL3A 1F5SA 2A2DA 3N2CA 3HSZA 4U7UK 4KPYA 1N5VA 1FEEA 1QQ5A 2CPJA 4Z2XA 4LZGA 1N54B 2BR0A 1WHXA 4J7CA 2KJ8A 4WE1B 4DR2F 3UCUP 3CD5A 4F4ZA 4FZNA 2O67A 4K4YA 1UL3A 2VU5A 4QR0A 5D49A 2MDAA 2AZ3A 4NEZA 3N7PD 3S01A 1Z2ZA 2IHR1 5DB9A 1RJRA 3I56S 3R6LB 4DS5A 5CYQA 4USKA 1HNZJ 2ISPA 7ICUA 2EZZA 2DF4B 1WORA 2EFPA 1NO8A 4I6WA 5J1PA 1ZQDA 4F93B 3QAUA 2XMAA 4QYZJ 2MQQA 1CJKB 3GJRB 1NK5A 4K4WA 1VQMS 1ZQEA 3TA1A 4LJXA 2EAMA 4F3QA 5DZ7A 2QO3A 4QIEA 4CNSA 1NNLA 1JJHA 1B99A 3SEOA 2FHJD 5DB7A 1LB2B 5B7WA 4AXJA 3ILJA 4BC7A 4NV0A 2K7JA 4WZMA 3D0IE 1S48A 2U1AA 3MM9A 2MQNA 1RT2B 4ZHRA 1IKVA 2XNRA 3JQJA 2ZFHA 2E9ZA 2ZH5A 2I8EA 5CA7A 5ALUA 2CQ2A 2DB1A 1H7WA 2W8KA 3LGMA 5HQLA 1WKJA 3G8QA 4ECUA 2ZIVB 1N5TA 5ALYA 3TAPA 3N7SC 1N32F 2M0NA 1F9HA 3KKAA 3GV8B 1EKSA 4RNHA 4WP3A 4TU9A 4GC6A 4WE1A 5DQGA 2K8BB 1EIYB 2C28A 1B7YB 1PAEX 1ZJMA 4HT7A 1S9FA 2E1EA 1HQUB 1H7XA 3C2KA 1S6OA 3F5EA 3D1HA 4KIAA 5AT1B 1RYSA 4C8YA 2UV8G 1GX6A 2RB7A 4PGQA 5CH7B 5DBCA 4G1IA 2VIXA 4DL4A 2GQQA 3A3PB 1HNXF 5H1SV 4KTQA 2XY7A 2DH9A 4KLLA 4KX5A 4O0NA 1FWJC 4Z6DA 1CJKA 3N4WA 4K4UA 2CJAA 1V97A 3GIRA 5LOQA 1SV0C 3BGUA 4O3RA 3PVXA 4JOUA 3IFEA 4U9RA 3SDEB 1J97A 4ZVOB 2QYCA 5KT7A 4UQGA 3I55S 1HR0F 4ZCIA 2R8KA 1VRQC 3RJFA 2QB0B 2LYAA 1XBWA 3RBDA 2VBZA 1TL4A 2V8GA 1RT2A 4ANDA 1OYDA 2KSOB 4F5OA 1GFWB 3CCZA 2DJWA 2UXDJ 3JXOA 5J0YA 2LMRA 4PCQA 4DCPB 4OHYA 4OZ2A 4RW8B 2ZM6F 2H5XA 4ZOSA 1N8RT 3H8YA 2B0CA 2NV3A 1OY9A 2ZC3A 3ORYA 2ZIVA 4DUZF 1XEZA 3E51A 3HD2A 3IN5A 1NBEB 5HMLA 3IDWA 1T11A 2A6OA 1VQLS 3V5RA 4IH5A 4NY8A 1FX4A 3RFAA 5F3XB 4AD6A 4KIRA 3R5CA 5B0EA 4OIXA 2VFVA 4O0IA 2EK6A 1WC4A 3CJ5A 3M05A 4EMDA 3O44A 3MTKA 3FZBA 1U6FA 4IO1A 2GGPB 4IFYB 1R6VA 1NJWA 2ADBA 1F9FA 1N56A 2MLYA 3J80Y 1V5IB 1VMBA 5CYMB 4CO3A 3KZXA 2DPJA 3H5UA 3D3BJ 2O01C 1RHRB 2IDEA 1JUDA 3PW4A 5K20B 3NS5A 2Q1LA 3O3LA 2ZIXB 1CC8A 4F0RA 4MF2A 4DQRA 1UJ4A 1BC6A 3Q83A 1DGSA 3SDEA 3OTOJ 5CD4H 2XMWA 1YJ7A 5K8NA 5KFZA 4K0KF 4QR2A 1PYTA 1FDBA 1GQEA 3Q8UA 2QB0A 5ETSA 2W54A 3MGHA 4IL6U 1RI7A 4Y2PA 4KE5A 2KJ9A 1CPZA 3UXNA 5KFSA 2WAQF 4DL6A 4U7UD 1N60A 2KSOA 3VAKA 3FRYA 3MD1A 2P66A 3NTUA 3IWNC 2V8PA 1S1WB 3UNGC 3IC1A 2OEKA 2DRAA 1BUXA 3A8JA 3QUBA 2LFVA 2E5LF 3BGRA 4Y6IA 1DGJA 1RT7B 3K17A 4MH8A 2DGSA 4QYRA 2YNFB 2HHSA 4B02A 3W9IA 3IWXA 4ZKAA 3QGAC 7FDRA 4I2QB 1X4DA 1FFGB 2BMBA 3LO3A 3SMZA 5DO2A 4WJBA 4AYBF 1RTDA 1XNRF 2KN7A 2BCUA 4V19X 1DLOB 5E3QA 2ASJA 1M5OC 1B0XA 4LRFA 4MEXA 2D6FC 2DEIA 4YN4A 1WG8A 5IILA 2Z57B 2GGPA 2BGWA 2XZTB 1S97A 3OTQA 1FD8A 5H2FU 1RQ0A 4YUDA 3IRWP 2R42A 2XTJP 1J5EF 2FPKA 3TX8A 3M8PB 5CYMA 3AOAA 4ZITA 2OD6A 3VF0B 2HOIA 2H54B 2HOFA 4JV1A 2F76X 4RQ4A 4C7ZA 2GW8A 2OEMA 4IYQA 1UFKA 3CCLS 4LF7F 3P3DA 3M9NB 4HDHA 4I2IA 3G6ES 1N34J 2XGPA 2MU2A 4B3SJ 3UXOA 9ICNA 1YNYA 2W11A 2CJKA 1XMOJ 3KLHB 4OZNA 2XULA 4B3TJ 3V6KA 2ZBRA 1PK1A 4UASA 1ZQOA 2NRVA 2ZDOA 3KLGB 3SCIE 1S1WA 4NM2A 4DR4F 1XSPA 3AA8A 4ZK7M 5HP4A 1PUZA 3RB6A 1NK6A 1YK9A 2HBRB 4DFMA 1HWJA 3KLIA 4PWWA 4ED4A 4UZCA 2NUHA 1ED1A 2YNFA 2UU9J 1TU0B 2BE9B 4WFZA 4I2QA 1SL0A 3I5BA 3L7OA 2AV5A 4J9VA 1Z00B 3IR6B 3LH2S 1DLOA 4KLEA 2LM4A 1U4BA 5HP1A 3ENQA 5KNIA 2PI5A 1RA7A 1Z1BA 1U0SA 3ISND 1KQQA 2R7UA 1OYEA 3TQ1A 2HFOA 4C3KA 2H4WB 1LFWA 3VWSA 3M8PA 9ICKA 2CZ9A 2PFOA 4LF8J 2HFZA 2KRRA 4PH5A 3L3FX 4GO7X 5HVGA 4DO9A 2J76E 1P1LA 1KDHA 4K4XA 2M5YA 3JAMY 3BQTA 1GEHA 2VQFF 4I2AA 2BKEA 2EFQA 3HHLD 3MWBA 1KOOA 1FXLA 2ASLA 8ICMA 2BEFA 4QYZK 1EARA 4PJ0U 3HM7A 1O03A 3BM7A 3DRXA 3NRZA 2I2YA 2MZ1A 4RDWA 2N3OA 2OD4A 3KLHA 4BC9A 1TV6A 2CZ4A 3W62A 3G71S 3KLGA 2RVJA 4KKOB 2IOFA 2KD1A 5EE9A 4J9MA 1R0BG 1G4CA 4ZN3A 4KLIA 2JMGA 2UUTA 8ICTA 1VK3A 1V3RA 2MSTA 4XUSA 2D3ZA 2YKAA 3BZCA 3JQMA 3JTOA 2FDRA 2KJWA 4IS7A 2QL9B 1JALA 2XCPA 4CLPA 4CO2A 1HIYA 5ETNA 1Q8LA 4DZDA 5MAOA 2EK1A 1HWIA 2H9ZA 4CLKA 1Z00A 1KEKA 3M6XA 5KFGA 2HRUA 3ZZYA 5AHXA 2MEWA 4NLYA 2EVZA 3FEZA 4G7EB 1KL9A 1R8AA 1YIJS 3ETMA 4A8OA 3W8GA 3K5LA 3Q8SB 2HGMA 3S7RA 1B43A 4R0JA 2R7TA 1S0OA 4I27A 4UUXA 2R7OA 1MMNA 4OJGA 3Q8YA 4S0MA 4I6YA 3A3OB 2UXBJ 2ZJQQ 1HIWA 5L9XA 4ZVUB 2Q4TA 4DSIA 2AD9A 5J0SA 4ED3A 2FVQA 1MWYA 3OSPA 2OMOA 4P73A 1T8EA 4DV2F 1K1DA 3QAEA 2KNJA 4CGZA 8ICCA 4CQBA 1VGYA 2FE9A 2W24A 8ICOA 4RQNA 1KNZA 2CQGA 4Y2TA 1U1NA 5D8HB 3HLUA 2BYCA 2E3TA 3M1YA 4QZ9A 1FESA 3KKAC 4GLXA 3C2LA 2MSSA 5J0OA 1SIWB 4KKOA 1BWVA 4M9GA 4IKAA 3HPAA 2Y8WA 1UPPA 4DLGA 3CDWA 3MPUB 3N4MB 3QYYA 1N48A 3IM8A 2HVIA 1QQ7A 1EJWC 2G08A 3DXSX 1XSNA 3BKTA 3LP1B 1HNXJ 1ZTTA 3W63A 1GKPA 4TLRA 4NLRA 1SQFA 4M04A 5GTHU 1L7MA 3P49B 1RADB 3FK4A 1V3ZA 4CLTA 1TK0A 3MEEB 3VCBA 3QXGA 4W98A 2PSZA 3ADAC 4G7EA 2KB2A 1O0PA 4UOHA 2EKYA 2OPPB 1DTTB 2YQ1A 4I2PB 4U8VA 4DL0C 9ICEA 3BZQA 1K73T 1DARA 4KLDA 4PWUA 3ITHB 5A2QU 1Y3KA 1P6TA 5B5EU 1O8BA 3OXGA 1JLEB 3TX0A 1NKCA 1HW8A 1NJZA 9ATCB 4DV5F 4ZVEA 2GHPA 2GH1A 4QZAA 2FLOA 3DCAA 3H25A 2N7CA 2IHNA 3F44A 2JHEA 4B9MA 4LVSA 3VAFA 1B64A 5BYSA 3D1QA 2ZH1A 2QKQA 1ZQBA 3GIPA 2J9EA 5A76A 3H20A 2E44A 1DRZA 4IRKA 5HJYA 2K7KA 3VTIA 4C8OA 2CQHA 2WF6A 4US8A 2VFTA 2GO7A 3CCJS 4EGLA 3GYXB 3PRDA 4N56A 4CI0B 1T9VA 4ECZA 4XAKA 5E3AA 3ICJA 1NM2A 4M5JA 5K4LA 2OTJS 1H38A 4ICAA 3TNVA 3T3FA 2KYXA 1S1UB 2V8DA 1YBAA 3LP1A 2VFRA 2AYEA 3WX4A 2GMHA 2JDJA 1PVPA 2BKPA 2Z0GA 3RJIA 4AC7C 4Q8FA 5F9NA 3OR1A 2HZAA 3FDSA 4ETZA 3MEEA 1FHTA 4O9MA 1SVDA 1LFPA 4XDCA 4CM2A 1AA1B 4DPYA 2PA3A 3CDUA 2OPPA 1IBMF 4RNFA 1DTTA 4I2PA 3BS5B 4K0KJ 4WTYA 4DOAA 1TUWA 5AKEA 1UW9A 4F4YA 5D15A 3ITHA 3PSPA 7ICFA 1X0PA 5G5GA 1FKOB 4G1QB 1JLEA 5IC4B 4ZN1A 4IOBA 3MURP 5IQQA 3RB4A 4YR0A 3BN7A 2KVCA 3RAMA 2YPYA 3NQBA 4LSNB 2M3DA 3KOOA 4RQ0A 4IQXA 2N82B 4B3OB 3LA0A 1HUOA 4Y3CA 4UOCA 3CP8A 4QW8A 1KP6A 5DQHA 2CG8A 2M70A 2Y1RI 1NZBA 2Y3YA 5KT5A 3R5BA 1IR2A 2OEHA 3ISBA 2P9CA 1PG5B 5CHGA 1MQ3A 2K3IA 1XNRJ 2ZTDA 4K7QA 1Z4UA 4ZVTB 2GS8A 1PO6A 2HFNA 4Z6EA 4IG0B 5E3RA 4ZPBA 2QN6B 1HD0A 3OLBA 4EX7A 3GMGA 4MFFA 2DNGA 3Q2TC 1S1UA 1ZYQA 5DLFA 1FXDA 3KG1A 1D3WA 2OH2A 2NZCA 1Q81T 5G4DA 2DCLA 2GV1A 3QWPA 4YXMA 2NYIA 1U48A 5IWAJ 1PO9A 4JP8A 1PYOB 4DV4F 4YN3B 1RLCL 3EICA 3ZXWA 4AUKA 4LF6F 1NH8A 4EI2A 1I94F 4YS2A 4LF7J 3L9ZA 3BS5A 2H5JB 1CUKA 3Q86A 5HMXA 3PY8A 3ILIA 2ROPA 5FLXU 4N47A 3AY0A 1D8ZA 4EX6A 4YD2A 2PUZA 3PIOQ 4G1QA 3PR5B 5F0WA 4WFXA 3PYEA 5J2AA 4LSNA 4OX8A 4ALZA 2HQFA 3R27A 4JWMA 2FVCA 4B3OA 5KOXA 5K14B 1EQ0A 2G5HB 5J2FA 3DLBA 3CB4A 4FF2A 1GKQA 1MMDA 2IAJB 2VODA 2VPZB 2YWGA