4DEZA

Structure of msdpo4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
TKWVLHVDLDQFLASVELRRRPDLRGQPVIVGGSRKVVTCASYEAREFGVHAGMPLRAAARRCPDATFLPSDPAAYDEASEQVMGLLRDLGHPLEVWGWDEAYLGADLPDESDPVEVAERIRTVVAAETGLSCSVGISDNKQRAKVATGFAKPAGIYVLTEANWMTVMGDRPPDALWGVGPKTTKKLAAMGITTVADLAVTDPSVLTTAFGPSTGLWLLLLAKGGGDTEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase IV 1
publication title The PAD region in the mycobacterial DinB homologue MsPolIV exhibits positional heterogeneity.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 75
structure length 232
sequence length 238
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dezA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4dezA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dezA01
2I1RA 4DS5A 3ISNC 3Q8MA 4ECQA 4KLFA 4ECSA 2YNGB 1TK0A 3SZ2A 3KK3B 1RT1B 4J9QA 4ZP7A 3BQ0A 4O3NA 2RKIA 3RBDA 5F8NA 1S97A 4XA5A 2ZD1A 4O5EA 1S1WB 2FMPA 3LP2A 1QUVA 3M9MB 5J1EA 3H4DA 1VRTB 4Y34A 4QZIA 3BQ2A 2ZJ5A 5KFFA 4X5VA 4KFBB 4GXKA 3HP6A 3FYHA 3DOKA 1NK9A 4K4TA 1KRPA 2P6UA 2E9ZA 1SUQA 3N97B 4DSKA 3EZ5A 1HNVB 1NK6A 1XSPA 4F4WA 3OJSA 3PO4A 2WOMA 3V6JA 8ICYA 4RW8A 4B3OA 1JX4A 4QPXA 1U49A 3N6NA 4PHDA 4C8OA 4KN4A 1C0UA 1C1CA 4G1QB 3PW5A 2V4RA 4DL3A 4K4SA 2XCAA 5BPCA 5KT2A 4KITB 3QGGA 1N48A 3SYZA 3N4MB 4E0DA 2HHUA 3PY8A 4I2EA 2PXIA 3NAHA 2V0NA 3KJVB 4O3SA 4QZBA 2DPJA 4ED1A 2IM1A 4F92B 3V6DA 4Z6FA 5J2NB 1XWLA 4IH7A 3JPQA 4MFBA 1S9FA 1N56A 4O3PA 5EWFA 4MIAA 4MFCA 3MABA 3I0RB 3FQKA 9ICNA 2C2EA 4K4XA 2BQRA 3MECA 4ZP6A 4R65A 1RTJB 4JV2A 2IM3A 4HKQA 7ICPA 4EZ9A 4LSNB 4WXOA 2OPQA 3OL6A 3LALA 4IDKA 3DDKA 1U4BA 4ECZA 2XY7A 1ZQIA 8ICGA 1CUKA 4KLIA 4QZFA 5CJ7A 7ICTA 1DGSA 3EWAA 4UAYA 3EPIA 3MDAA 1X2IA 5KFJA 1S48A 4M04A 3BR9A 2R8KA 4MEXA 4ZPCA 3EYZA 2FJXA 3QIDA 4DG1A 3CVKA 2NRZA 1SL1A 1IKYA 5IIIA 1J5OB 3OHBA 3M8QB 1N5YB 3PW7A 1U48A 3TAPA 2HHXA 3KHGA 9ICVA 3QLHB 3TAMB 2ISOA 2GC8A 1SL0A 4I2AA 3RJGA 5J2QA 2RF2A 4PHEA 4IRKA 8ICWA 4K50A 3NGDA 1SV5B 5C24A 1JLFA 3V4IA 4DL5A 1WNEA 4YMEA 3IM1A 4ICLA 4MKAA 3MEEB 2BANA 3MEGA 5HNKA 3V7LA 1S6QA 5D3GB 2IJFA 4YR0A 1RYRA 4U6PA 4MEYA 1UA0A 4I2PB 5KG4A 4F4XA 3NBPA 2WTFA 3KTQA 2HHSA 3CWJA 3V81B 3MGIA 1REVB 1FK9A 3PX4A 8ICIA 5KFBA 1S6PB 8ICOA 2GIRA 1HMVA 1RXWA 4LVSA 3GV8B 5HP1A 4J9PA 3RH6A 3KLHB 1ZQJA 3KK1B 3RH4A 2ZUDA 3D5MA 5DG7A 3FSIA 2W9BB 4ECXA 5J29A 3QO9B 4U7CA 3T5JA 1UWBB 1ZQAA 2HWIA 2PFPA 3PO5A 4DL7A 4B9VA 4ELTA 2AJQA 2OPRA 1NJWA 4IQWA 2RDIA 1SL2A 4DL6A 3KK2B 4RU9A 5J0WA 4MFAA 4RQ8A 2UVRA 2YNGA 2BCQA 3UQ0A 1DLOB 9ICBA 4NCGB 1RT1A 1Z00A 2M9NA 3T5LA 2BCUA 1ZQXA 2ZTEA 1BPEA 1VRTA 1LWEA 3MF5A 1NK8A 1ZQZA 2OPPB 4RQ0A 3Q8RB 4KFBA 1BVSA 1S0OA 1IKXA 4NLGA 2YNHA 4NLXA 3VQSA 1T03B 1MSWD 3LAMA 3RJEA 2AGQA 4R5PB 4EBEA 1NKEA 1HNVA 4YD1A 4UQGA 4F93B 5DB9A 4GLXA 4PHAA 9ICSA 2QV6A 2CKWA 4ECRA 2HW3A 1JLGB 2A1JB 2WB4A 4JV0A 5JUMA 4NLSA 4GXJA 3QZ7A 1EETB 1S0NA 4G1QA 5IILA 4ED0A 3ISDA 5D46A 4M2YA 3D28A 3UXOA 2HAIA 5J0PA 2AGOA 1HQEB 4NLDA 3KLVA 1XC9A 3OSNA 4KLDA 2ZJAA 4ED8A 1MU2B 4DF8A 1LB2B 5KFOA 8ICEA 4KLUA 2F1HA 4WZQA 4I2BA 3PMNA 1GX5A 5J2NA 5J0YA 3C2KA 1S9EB 3BSOA 4C8NA 3HT3A 2V4QA 4B9NA 1BQNB 3QGHA 2ZTDA 4YR3A 2FJVA 9ICHA 3GIKA 4DSLA 1KTQA 4F91B 3CJ4A 3I0RA 1QE1B 3ORYA 4TQSA 2KFZA 3IG1B 4KLHA 2JEGA 4R63A 5F8HA 4PHPA 1RTJA 4QZDA 1ZJNA 3TQ1A 4LSNA 1LW2B 4RT2A 3EW9A 5JXSA 4RW9A 4QZGA 5CWRA 1IM4A 2IC3B 5HP4A 4WZMA 4KLEA 1KLMB 4KLQA 1RT2B 1ZQWA 2D41A 4NLRA 4RPXA 1D8YA 4PWDB 3G86A 2OH2A 1RTDB 2JZBB 4ELVA 3ISND 4Q0BB 1J5OA 9ICLA 2FVQA 1N5YA 5D4BA 4EO8A 3MTKA 4F8RA 1ZQOA 5L1KA 5KFIA 4UB2A 4F5OA 5D49A 4RUAA 3TAMA 8ICQA 1L3SA 1ZQBA 2PI5A 8ICHA 4LQ3A 1NHVA 5IIKA 1SV5A 4M6WA 5J2BA 8ICFA 1UT5A 4I2IA 5D3GA 3QYYA 3JPRA 4YD2A 5HMMA 1RT6A 1C2PA 3OLAA 5CYMB 4NM1A 1RTHB 3PX6A 1RZTA 4UBCA 4JWMA 3V81A 1REVA 1XU4A 2NRXA 3CJ0A 4O5KA 2BKEA 4EZ6A 4NLZA 1S6PA 2DPIA 5L9XA 1T7PA 4ZPDA 3DLKB 3K75D 5IINA 3ZD9A 4R0EA 2AQ0A 1HJPA 4WE1B 2PFOA 2HNDA 3KK1A 1TKZA 4P4PA 2W9BA 3QO9A 3CDUA 1UWBA 1S76D 4H4OB 3ITHB 4YVZA 3Q8PB 2B43A 4B9MA 2W9CB 8ICTA 4PPXA 3FFIB 1RA7A 1XSLA 5J2IA 2FVPA 4ZHRB 3DRPB 5EWGA 9ICOA 3UPQA 1JIHA 5J0XA 4NCGA 2FVRA 3QIPB 4LSLB 3IGNA 1RT4B 3C6UB 3CDWA 2ASDA 2ZKUA 4FO6A 1S49A 5J0UA 4P2HA 4F4YA 2JC1A 5I3UB 5J2FA 2YKMB 3LAKA 1B22A 4QW8A 4J9NA 4JWNA 4I2QB 7ICIA 1L5UA 3PHEA 1ZQNA 4MK9A 4MF2A 1T03A 3V72A 3TVKA 3FQLA 2R8IA 9ICQA 3TFSA 4R5PA 1NK0A 1CEZA 5J2HA 4O3RA 3H8JA 4DFJA 2E9RX 4QWCA 1JLGA 1Z3EB 2QE5A 2XI3A 2A1JA 1SKWA 3CDEA 2PFQA 4I2DA 4X2BA 2NRTA 1ZQMA 1EETA 2FLPA 8ICCA 2AWZA 3C5FA 2FLNA 2P6RA 1X9WA 8ICMA 1U45A 1N4LA 3HKWA 2KZZA 4KMUA 1HQEA 5F8MA 2F8EX 1S1UB 3ZDAA 3HVAA 4NRTA 4ELUA 4F2RA 3V6HA 8ICAA 8ICZA 5CHGA 1MU2A 4DOAA 4NZ0A 2WRMA 1BPXA 1HUZA 3DRRB 2KZ3A 3GQCA 1SKRA 2FJWA 1S9EA 4XPCA 4YMMA 1BQNA 3KMSA 2YNFB 1ZQTA 2JC0A 1LWFB 1S1VB 3OJUA 3I5BA 5DBAA 4F4KA 2ZUBA 4R66A 4YXMA 4I2GA 3QGIA 1JLEB 3TFRA 2AGPA 2IMWP 2C22A 2BDPA 1RXVA 1QSYA 3PX0A 1S10A 1TAQA 1LW2A 4TY8B 2O5DA 4KO0B 4O4GB 2UVWA 8ICSA 3M8PA 1JLBB 2C2RA 5HMLA 2FLLA 1KLMA 3DRSB 1RT2A 2I5JA 3OGUA 4YMNA 4M9HA 2HHVA 3BGRB 3BQTA 4DL4A 3ZDEA 1KHVA 4PWDA 4RW6B 2ATLA 4QZCA 1RTDA 4ZPBA 2JZBA 5CYQB 7ICQA 4Q0BA 3KHHA 1JXLA 1W25A 3RB3A 5KFCA 3RJFA 1SZPA 5KG6A 2ZE2B 2F1JA 2FVCA 2HNYB 3RAXA 3T19A 2R2RA 3ZDDA 4K4HA 3GYNA 3PJXA 1C0TB 4B9LA 1K1SA 5L1IA 2CJQA 5J2PB 2GWSA 1QAIA 2VG7B 4TN2A 3JSMB 9ICUA 4ZP9A 3QEAZ 2ASLA 4TYAA 4YN4A 4YP3A 1RAJA 5EDWA 4K4IA 2VG6A 3AU2A 1RTHA 2BCVA 3NTUA 5KT7A 5L1JA 2BE2B 1B43A 3DLKA 3E01B 4LZDA 4BXOB 4WE1A 4KN7A 4LQ9A 5J2CA 2YNIA 1JKHB 1XSNA 1BPZA 1ZYQA 5IIMA 1QSLA 5KT6A 4Q44A 4Y2CA 1MC8A 1D9DA 3CJ3A 5KT5A 3I5AA 9ICRA 3LP0B 1HNIB 4DL2A 3H5YA 9ICMA 3ITHA 1LWCA 8ICKA 4RT3A 2W9CA 2B5JB 3LK9A 3JPOA 2XGPA 5KFEA 4ZHRA 1KFTA 1NK4A 3PZPA 3BSAA 4KLMA 3IRXA 1N6QB 4UAZA 2XC9A 2FPMA 7ICEA 3QIPA 1RTIB 4DOCA 3IS9B 2BR0A 4LSLA 1RT4A 5F8GA 3DOLB 3C6UA 2FMQA 1QLNA 2NRVA 3PMLA 4NLWA 1JLQA 1HARA 2B6AB 4QZEA 2BHNA 3C2MA 3I0SB 5I3UA 1NK7A 3JPTA 4I2QA 3H7IA 4DQRA 1TQLA 4WYWA 1ZQDA 2ASJA 9ICTA 3JPSA 1KSPA 3MR5A 3OL7A 3Q8LA 5K14B 7ICNA 1UA1A 4PQUB 4F5QA 4TUQA 3N6LA 4O44A 4QWDA 4ECTA 3RJHA 3LP1B 1VRUB 4I7FA 4B9SA 4DSIA 3AUOA 2HHTA 4KE5A 1JLAB 4ZH4A 1JXEA 1A77A 4NY8A 1S1UA 2J6SA 3SV3A 4IRCA 4IQXA 4NXZA 4UB4A 1C7YA 3DRRA 3OL8A 2BPFA 3HW8A 5F8IA 3KK3A 4ECYA 2DFLA 2XI2A 1L3UA 5J2JA 5F8LA 2UUWA 2YNFA 2KTQA 1LWFA 1S1VA 1S1WA 2BQ3A 1PZNA 1COOA 4RQ3A 4IKAA 8ICUA 1JLEA 3CJ2A 3RJKA 4UB3A 1TL3B 4QZAA 3C6TB 2MUTB 2VA8A 1NHUA 2D3ZA 2UUTA 4YFKA 8ICJA 5KFDA 4O4GA 3B0YA 4MFFA 1ZQRA 2V9WA 1JLBA 3DRSA 4P4MA 8ICLA 4K4GA 3BGRA 1BPYA 5KFNA 9ICXA 4RW4B 4UB1A 4RW6A 2W7PA 2JEFA 1TK8A 5CP2A 5CYQA 4NM2A 4C8MA 3UPFA 4IG3B 1RT5B 2IA6A 4KLGA 2HNZB 4NLOA 3RB6A 2ZE2A 5DLGA 4DEZA 3KJVA 3TAQA 4PGQA 4J9KA 3MDCA 3B0XA 3GIMA 3HHKA 3JYTB 4TUPA 1HUOA 4J9RA 4PUOB 5C5JA 2R8JA 5J2PA 4YQWA 3MR3A 2VG7A 4XQ8A 4O3OA 3HVTB 3JSMA 1S1TB 3ZDBA 4KHRA 3RR8A 5HROB 2J6UA 3OSPA 1KFDA 4P4OA 3TARA 2AQ4A 2NRWA 1OS5A 5HLFB 1KDHA 5DG9A 4Q45A 3DLEB 4IFYB 5KFSA 4PGYA 1V9PA 2BE2A 4LZGA 1C1BB 5J2MB 2ILZA 1KHWA 2BCSA 3PR5B 1S4FA 1ZQPA 3MR6A 2MAXA 3KLFB 4TURA 1JKHA 4TQRA 1ZQLA 4NLKA 4C8KA 3DOKB 5DBCA 4Z6DA 4Q43A 3LP0A 1DTQB 4IH6A 1HNIA 1EP4B 2XY6A 1T4GA 5C42B 2JLEA 4EYHB 2WOMB 3M8QA 4RW8B 1KLNA 3OL9A 3V6KA 5BOMA 1XO1A 4RPYA 4MK8A 3THVA 3H5XA 3QLHA 1N6QA 4M9NA 4Q8EA 1RTIA 3H2LA 3V7JA 3JPNA 3IS9A 7ICVA 8ICBA 3DOLA 4IFVB 2R2TA 4R8UB 5KFHA 1TP7A 5KG7A 4TLRA 1ZQEA 3MEEA 2B6AA 3T5KA 1JMSA 1S1XB 5HHHA 3GILA 2OPSB 4M9GA 1SH2A 4IQTA 4I2PA 1HYSB 3V7KA 1D0EA 2HMIB 1XR6A 2JEJA 1D8LA 4RPZA 1DOQA 5K14A 4F5NA 4ZVGA 3T5HA 4PQUA 3KLHA 3KLIB 3LP1A 1VRUA 2H5XA 5DQGA 3GDXA 7ICUA 1SH0A 3ETLA 3RRHA 3OLBA 2I9GA 1TVRB 5DBBA 3BSCA 1JLAA 3DYAB 4C8LA 4FS2A 2WONB 5KFRA 1CSJA 4DFKA 5KFMA 1L3VA 3KK2A 2ZJ8A 2F1IA 3LDAA 5KFLA 3G6VA 3BDPA 2ZTCA 3QE9Y 1DLOA 3H8WA 5F9LA 5KFYA 1TV6B 4EBDA 4I28A 1SKSA 4MH8A 3ZDCA 3DLGB 1Y88A 1HPZB 1IKVB 7ICLA 7ICOA 4IR9A 3GV5B 2R2SA 3EZUA 4NLYA 7ICRA 2OPPA 5J2QB 5DB7A 2RF2B 4BWJA 4O3QA 1TL3A 4ID5B 3C6TA 1U09A 3RB0A 5J2EA 4H4MB 1QTMA 4RUCA 4O5CA 2IAJB 2Q0ZX 4KKOB 4Q8FA 3HPOA 4RW4A 1FKPB 4O4RA 1AROP 1HMVB 2AX1A 4KLOA 2VA2A 1RT5A 2IBKA 2HNZA 4ECWA 3T3FA 1ZQGA 2WHOA 4RQ2A 3UR0A 2JEIA 4Z6CA 4O9MA 4DSFA 3JYTA 3GIIA 4NLNA 4PUOA 4MKBA 4ZVHA 1ZTTA 3UQ2A 2OPRB 1WCLA 3H5UA 4JK1A 1K1QA 4YG2A 1S1TA 2BGWA 4K4VA 5KT3A 5HROA 4ZVEA 2C28A 4NLPA 1QE1A 5DB6A 3Q8SB 5HLFA 1DTTB 4ED6A 3IG1A 3PNCA 4NLQA 5DQHA 4ZMMA 3NAIA 3ISCA 3DI6B 3LWMA 2KN7A 3DLEA 3KLGB 1Z00B 4IFYA 2HWHA 1XR7A 4GC6A 4J9LA 4EYIB 4F4ZA 2OWOA 2KZMA 4KSEB 3ZD8A 4BDPA 1C1BA 2FPLA 5C25B 3HWTA 1ZTWA 2Y1JA 1LWEB 5J2MA 2IC3A 3ICLA 5KFVA 3KLFA 1ZQCA 1TKXB 1IKXB 5KFGA 2YNHB 1YVFA 1RA6A 2BPCA 1DTQA 1EP4A 1RT3B 2ISPA 5KFTA 5C42A 2UVUA 2I1QA 9ICPA 3EPGA 4KV8B 3KNAA 5EWEA 2XY5A 4IRDA 2ILYA 3KMQA 2ALZA 3SV4A 4QZ9A 5J0SA 2PFNA 3CO9A 2HHQA 4RNNA 1TKTB 3E2EA 9ICJA 8ICRA 1MQ2A 3C21A 5DDYA 4PGXA 4J9SA 5CA7A 3ISBA 4RZRA 4IG0B 3KLEB 4IFVA 4R8UA 2R8GA 4H54A 9ICKA 4RQ1A 5KG0A 4UB5A 1ZQFA 1KEJA 5IIJA 1S1XA 3NMAA 4HYKA 5F8JA 2BRLA 1FKOB 2OPSA 1HYSA 5DKWA 7ICGA 4K4UA 5CB1A 2XO7A 5CYMA 4DOBA 2HMIA 3UQSA 1TL1B 4I27A 3DM2B 3RBEA 5L1LA 5EUHA 2AU0A 4QWBA 2XCPA 4GC7A 2BCRA 4YR2A 2WK4A 1R0AB 4PH5A 1LW0B 3KLIA 4I2JA 1TVRA 4K4WA 4RW9B 1ZJMA 5J0QA 5J0OA 3BQ1A 3DYAA 2PI4A 4H4OA 4URSA 1IKWB 2WONA 4CCHA 3KOAA 4NLVA 5CR0A 4F5PA 1TFRA 3FFIA 4KHMA 3TI0A 4TXSA 4B9TA 9ICCA 1BPBA 1ZQYA 3DRPA 1ZQHA 4QZHA 5J0TA 3Q8QB 5IIOA 3KHRA 1HQUB 1TV6A 5KFWA 3G6XA 2VG5B 3N6MA 4RQ5A 1T05B 3H8SA 4DSJA 3DLGA 4NYZA 4RNMA 1HPZA 5DGBA 1IKVA 8ICXA 3PV8A 1X9MA 1KFSA 5KT4A 2Y1IA 3H4BA 3SFGA 2YKMA 1SH3A 4XO0A 5KG3A 1BQMB 2FVSA 3DMJB 2P66A 1JLCB 4FS1A 5DLFA 4KLSA 1X9SA 3UXNA 4ECUA 3CJ5A 4ID5A 1A76A 3LWLA 4M9LA 4M6WB 4WFYA 5KG5A 4F5RA 1D9FA 1TKDA 7ICSA 5J2GA 1NKBA 4H4MA 8ICVA 1U47A 5F9NA 1RT6B 2IAJA 3E51A 5I42B 4KKOA 3LANA 2BPGA 2FMSA 1QSSA 9ICAA 1FKPA 3H40A 5T14A 3QEBZ 2BRKA 5KFKA 3C1YA 4DQSA 3MFIA 4K4ZA 3RB4A 7ICMA 3KHLA 2HNDB 4FBTA 3GIJA 2UVVA 5KTQA 1TKZB 1JN3A 4RW7B 3M8RA 5J2KA 1S9GB 4UAWA 3H59A 1U9LA 1QAJA 3CIZA 1NOMA 2GIQA 1Z4UA 4ED7A 4ZPAA 1S77D 3PR4A 4NLUA 5DQIA 2IM2A 4R64A 4URQU 1ZQVA 4XPEA 3MFHA 1DTTA 3FDSA 1TV9A 2HVHA 2W9MA 3UXPA 3DI6A 9ICGA 3KLGA 1NJYA 1BPDA 4TY8A 4KO0A 1T94A 1RDRA 5J0RA 5C25A 3M9NB 4I2FA 1T3NA 4WXWA 4KTQA 1MMLA 3T1AA 2HHWA 1TKXA 4DQPA 3RJJA 1S0MA 5FDLB 2YKNB 4EEYA 4DFPA 3RTVA 1RT3A 1T8EA 2IHMA 1TVAA 4J9OA 1RT7B 4KV8A 4YXJA 4G3IA 5HBMB 4KAIA 2D3UA 4ZVFA 2HNYA 4ECVA 1H38A 3PW0A 3PJWA 9ICIA 3RRGA 4NLTA 1TKTA 4NRUA 2B21A 1C0TA 1RYSA 3MEDB 4DWIA 4IG0A 3KLEA 1ZQSA 5DGAA 2VA3A 4YMOA 4DLEA 1FKOA 2ZUCA 1NKCA 3Q8KA 4DO9A 4KBIA 4RQ7A 1TL1A 3G6YA 4B9UA 4MIBA 2KFNA 4YCXA 2RKIB 5DDMA 3H5SA 3DM2A 3NKYA 4F50A 2ZD1B 1BGXT 2R8HA 3LP2B 4XUSA 3MBYA 5J1EB 4XRHA 3E01A 4DF4A 2IHNA 3GV7B 4BXOA 3AU6A 4K4YA 1R0AA 4QW9A 1LW0A 2J6TA 1WCNA 4Y2AA 1TK5A 3SI8A 4WFXA 4URGA 3PVXA 4O0IA 7ICJA 1SUQB 1IKWA 4IR1A 3NL0A 4Z6EA 1UT8A 3M8PB 2B5JA 1XS9D 3QZ8A 2BQUA 4RNHA 4B3OB 2I5JB 1TAUA 4DQQA 4BGDA 2W7OA 2XWYA 1C0UB 1C1CB 5KFUA 3IHQB 3C1ZA 1I6JA 4EBCA 4M9JA 4F3OA 1HQUA 2VG5A 1T05A 3C5GA 4QWAA 3UDLA 4ED3A 1XR5A 1LV5A 1EXNA 4DLGA 1NK5A 3I5CA 4FBUA 3HX0A 3I0SA 2WCXA 3RR7A 2W9AA 4DQIA 3V6DB 1BQMA 4M0AA 3DMJA 4IH5A 1JLCA 4DFMA 4IQVA 3FRZA 2EC0A 5KG2A 4I2CA 4MFBB 2C2DA 4BWMA 5KFQA 1ZETA 8ICPA 4WFZA 1NJXA 5KFXA 3MECB 3TANA 5I42A 1GX6A 2VG6B 4TUSA 4J9MA 2OPQB 4UBBA 3OHAA 1RPLA 9ICWA 4IDKB 5TZVA 4F2SA 4IQUA 3H98A 3MGHA 9ICEA 3IGVA 2YNIB 5DG8A 3IN5A 2RDJA 2W8LA 2IM0A 4DSEA 4RW7A 2R2UA 1S9GA 1S0VA 1NNDA 4IOBA 4ED2A 4DG1B 1IXRA 3BJYA 4KLJA 1IKYB 1LWCB 3C23A 1ZQKA 5KFPA 3BREA 2W8KA 2HVIA 4I29A 4KLTA 4RQ6A 4MK7A 3IRXB 7ICHA 3JPPA 3M9OB 2MUTA 7ICFA 4EO6A 5C24B 5KG1A 2E9TA 3K4GA 2FPKA 4M47A 9ICFA 1JLFB 2IJNA 4Y3CA 3V4IB 1JLQB 4M95A 4KLLA 4ICLB 2BANB 3MEGB 3HVWA 1S6QB 4WYLA 3M8SA 4TY9A 5KFZA 4I2HA 3NBPB 4QWEA 2VANA 5J2DA 5FDLA 2YKNA 4MF8A 5J2AA 1FK9B 3SFUA 2LYHA 4DS4A 4GXIA 5KFAA 4KB7A 1RT7A 4IG3A 1ZQQA 4TYBA 3MR2A 3GFKB 4M94A 3BSNA 5HP1B 1ZQUA 3RH5A 3RAQA 2D7SA 4O44B 5HBMA 3C2LA 5BOLA 3RJIA 4OL8A 4ZP8A 4RQ4A 1NJZA 8ICNA 1D1UA 5HHIA 4I7FB 4RNFA 1L3TA 5EOZA 4JUZA 4QZ8A 4JV1A 3MEDA 1MQ3A 2AX0A 5DB8A 2XGQA 3PW4A 3HVTA 7ICKA 3PW2A 4RNOA
chains in the Genus database with same CATH superfamily
4P7VA 2I1RA 1BD6A 2DRBA 1U2FA 4ECQA 2GJ2A 2UXBJ 3UVJA 3VC8A 4XTTA 1RT1B 3OPXA 4J9QA 2DBBA 4XDDA 4O3NA 2KKPA 3RBDA 3J7YI 1YTYA 4O5EA 2FMPA 3M6VA 2P2CB 4LFAJ 3M9MB 2DHAA 5J1EA 2K1RA 1VRTB 3IBFB 4DR7J 4QNLA 2QA4S 4ZCKA 3CCQS 2HFVA 2LMRA 4GXKA 3FYHA 4OHVA 3VV2B 1FWEC 4K4TA 2P6UA 3IWNC 4DSKA 1HNVB 4F4WA 3OJSA 3PO4A 5ALDA 3ENVA 8ICYA 4RW8A 4B3OA 4C8OA 3UDVA 3FC9A 3HKZD 1U24A 2V4RA 2DKOB 3SYZA 3PEHA 4UB6U 2HHUA 1QAXA 1GTHA 1UFLA 2ZH3A 3HULA 2V0NA 1YI2S 1IBMF 1FD8A 3U7JA 4CNTA 2WVBA 4F92B 2CDRB 4YIWA 4Z6FA 2YX7A 2X51A 4IH7A 4QU6A 4PQAA 4MFBA 3D6JA 1WOOA 2VDHA 3MUMP 1XNRF 4LRBA 3I56S 4JV2A 2F4VJ 1APSA 2IM3A 3BBCA 4HKQA 4OYAA 4EZ9A 1LK7A 2CJKA 1N33F 4USVA 2A18A 4IDKA 3DDKA 5HQ8A 4OV6A 2XY7A 5AK3A 2DNPA 1EJVC 1CUKA 2WFAA 3BO2A 2KVCA 2E1EA 1E6YB 5G0RB 5KFJA 2P9CA 2MGZA 5ALTA 2XHWA 4MEXA 4P52A 4OZ1A 4GKKJ 2D9OA 3H0MB 1J5OB 3M8QB 2EKYA 2K4IA 1U48A 1EJSC 4FYVB 2HHXA 2YWEA 4DU8A 1RJQA 1LNQA 3V4MA 2ISOA 2GC8A 1NBEB 4I2AA 5CZXA 9ATCB 4CRXA 3RJGA 2EI5A 1ZD3A 1N5VA 1OPIA 1NSQA 8ICWA 2B56A 2X1GA 3V4IA 2AF6A 4YMEA 4MKAA 5AKEA 1VLYA 2BANA 4JI5J 3EGZA 1S6QA 2CPFA 5D3GB 5KG4A 4F4XA 1R8PA 3KTQA 3QGKC 4AXJA 3V81B 2XQCA 4KX5A 3PX4A 3BBBA 1FWKA 1Q95G 4CNYA 1S6PB 3QSYB 8ICOA 1S4EA 3RRKA 3GCXP 1U1MA 3VCDA 4HL9A 3GV8B 2QTWA 3KLHB 2ZUDA 5JVGQ 1T0TV 1WC4A 3D5MA 2GZOA 5DG7A 2ZH6A 3UCZP 5J29A 3QO9B 2IHR1 4ZLPA 4JI6J 5IXUA 1SJ3P 4OI0A 2RDIA 1SL2A 1C4AA 5E79U 4Y2MA 4RU9A 1VISA 1TFWA 5A8WB 1LOUA 2HHPA 6FD1A 1FE4A 3TWZA 5FJ4A 5G4HC 3I55S 1FDDA 1LWXA 2DNKA 1LWEA 1M90T 1IR2A 2RHFA 1X4GA 3RBZA 1DY3A 2DXEA 3Q8RB 1NPKA 1S12A 1U7LA 4F71A 4M5GA 2ZUAA 3LH2S 2AGQA 3G8SA 2AMCB 1NKEA 4UQGA 4F93B 3OFGA 3FMWA 2JH7A 1GO3F 3WKCA 2CKWA 3PRVA 2HW3A 1JLGB 3CF5Q 2MQQA 5ETKA 3KUEA 5J1NA 3QZ7A 4ED0A 1B0XA 3ISDA 5D46A 2RJZA 1CG2A 1NFGA 5FLXY 2AD9A 1CBKA 2EK1A 5J0PA 3KLVA 2UUAF 2ZJAA 4DXLA 3FEXB 4I2BA 3BZCA 3PMNA 5J0YA 2MQNA 1OQ3A 3B9JA 5ALMA 1CJKA 2FJEB 3QGHA 5LXYA 2ZTDA 4YR3A 3GTYX 2FJVA 3MM6A 1ICEB 2WVFA 2C42A 1AXQA 1QAYA 4CDIA 2G13A 2Z7JA 1JUDA 2E8MA 3HJFA 4KLHA 2JEGA 5F8HA 3P5TL 3NRBA 1V5IB 1UZDA 1GAOA 2GMJA 2DB1A 1ZJNA 1A6SA 5G5HA 2GAHC 3TQ1A 2H9ZA 3D2QA 1DRZA 2JHEA 4RT2A 3VALA 4RW9A 5ALRA 4QZGA 5CWRA 2K89A 2BYCA 1O12A 2ZEJA 4OLPA 4KLEA 1FXDA 2D41A 2IIHA 2GO9A 1U2RA 2PMWA 3ZZTA 1D8YA 5CZVA 4PWDB 4PL2A 2E8PA 1R8HA 2XNQA 1XBWA 4YUDA 2WVEA 2A1AA 1B0TA 2D3OR 4ELVA 2CVEA 2I2YA 4Q0BB 4CYUA 4U95A 1ZA1B 4P2MA 5CA5A 1EKSA 3MTKA 2QN6B 2VBYA 3T9NA 4DX5A 5D49A 2WAQD 3GYXB 1PJ5A 2PI5A 4QQBA 1NHVA 4GMKA 5J2BA 1KRCC 4UF4A 8ICFA 3W66A 1PUZA 1Q5VA 3QYYA 4YD2A 4ERDA 3VAKA 3LYSA 3BE7A 2AJ4A 5CYMB 4NM1A 2CQIA 1XU4A 5G4DA 3MMAB 3FBBA 3UMCA 3F53A 2FHOB 2VKQA 2WSEC 1V6HA 2MQOA 1NDCA 1UQVA 1SJ1A 2PFOA 2HNDA 3ELHA 5D15A 3KK1A 2ZKTA 4UASA 2J7KA 1TKZA 2BJ7A 2MQMA 2W9BA 4FXVA 2LLZA 4QIWF 3A8IA 4JB3A 3AN1A 2BACA 1KQKA 3Q8PB 1Q79A 1UJ6A 3CIMA 4PPXA 4JOUA 4LF2A 1O51A 1RA7A 2BZ2A 2R7VA 1XSLA 3W9HA 2ZVSA 2KJ8A 1BWEA 1TL7B 2ZITA 4NCGA 2IBOA 2PA8D 2FVRA 3DC2A 4W98A 3PIPQ 2NR0A 2HGLA 3US5A 4I0WA 1VQ9S 4FZMA 4FO6A 4M8LA 5GVQA 2JC1A 2NLWA 2CRXA 4JYAJ 5ETOA 3DLLQ 1OY9A 1WG4A 4I2QB 2V50A 7ICIA 2Y0SD 1LXJA 4FVMA 3G2XA 3PHEA 4K7QA 1PAEX 3V72A 4RWWA 1RWXB 2Z56B 1WF0A 4R5PA 3DXSX 4L6V3 2CQ0A 5HR6A 4O3RA 1T02A 4DFJA 1EX8A 2E9RX 1QDUB 3AOAA 1U1NA 1Z3EB 2A1JA 3ZFVA 4E2FB 3IGHX 3T6JA 3PFOA 2UXBF 1FA0A 3OUYB 4N7TA 3AD7C 4Q5VA 1D3WA 3C5FA 4M5NA 1U45A 1P9QC 1HQEA 2F8EX 3E74A 4ELUA 4F2RA 4BS2A 4QZVB 4RQNA 3V6HA 1JJHA 4DR7F 5HANA 4NZ0A 1BPXA 3OXFA 3DLBA 2KZ3A 3G87A 3BV8A 2DNNA 2YWFA 4XPCA 1Y5NB 2KNJA 1BQNA 4DN0A 3K2YA 2XSJA 2ABYA 3W63A 2RQKA 2DNZA 3I5BA 3THPA 4E8UA 2X3DA 1IE7C 3GIPA 4LRCA 2GLEA 4LR8A 2ES6A 1YG0A 1RXVA 2O5DA 4KO0B 1SV0A 1X0PA 2D9PA 3VGVA 1IM6A 2UVWA 3AJDA 8ICSA 4M5DB 1NAQA 1JLBB 3Q8VA 2C2RA 3HFVA 3LF0A 5HMLA 4YN3B 3BS7A 4FXWA 3HLUA 2G2YA 4GVBB 3ZDEA 1KHVA 2K4EA 3OR1B 5K9FA 2C2NA 2MSNA 4ZPBA 1PCAA 1IBKF 1FD2A 4ES1A 4NYOA 1VK8A 1W25A 3N79A 1YJWS 3CCJS 3D6HB 2WF5A 3RAXA 3VAIA 3ZDDA 3H42A 1FFSB 2FHJD 3PJXA 4RJVA 2F4VF 3J81Y 3KUHA 1N34J 3CD6S 4TN2A 4ZP9A 1F60B 3MTJA 3BO4A 1P7DA 5EDWA 4LH8A 3NS6A 3VWSA 1RWUA 4NZ7A 1RK8A 2LXFA 4EI2A 3NTUA 3OOQA 4UY85 2DK2A 1B43A 1EAYC 1IVZA 2IA0A 4FF3A 4F0RA 1N36J 2DY9A 5J2CA 3QUTA 1JKHB 3J80U 4Q44A 2OUGA 1MC8A 1D9DA 2U2FA 2Q79A 3CJ3A 1HNIB 1WHVA 2CZ9A 4GO5X 2NZ4A 8ICKA 4RT3A 5JRTA 3A3OB 4WK1A 1BNPA 4J9UE 4JI5F 2EH9A 5KFEA 1NK4A 1R3NA 3JTPA 4UW2A 4KLMA 4AQLA 3IRXA 1FNXH 5EN1A 4UAZA 3NWGA 2FPMA 3D1OA 2MZTA 3QIPA 2C2ZB 2GVDB 3IC1A 3F5EA 2BR0A 4LSLA 2JX2A 2FMQA 1HHQA 2AQVA 2YH1A 4NLWA 2KT3A 2B6AB 2U1AA 3I0SB 5I3UA 2XO6A 2VUGA 2DNMA 5BYSA 2D3DA 2BJ1A 3M30A 2B9EA 3K8VA 3CW2C 2G08A 3JSRA 4NXMJ 9ICTA 3JPSA 2R7OA 4QU7A 3TEGA 1N32J 3Q8LA 2OJ3A 1UA1A 3N6LA 4ZDNA 1GNKA 5ALWA 1R9ZA 1ZH5A 4DSIA 4ZH4A 1JXEA 5EHHA 4HI2A 2K8BB 2HBRB 1S1UA 3PTWA 1Z1VA 3IG8A 2WF8A 3MCNA 3SV3A 1A6LA 1Z19A 2NUUG 3DHXA 5F8IA 4ECYA 5J2JA 3MPDA 2UUWA 2GAGC 1RHJB 1RAHB 1S1VA 4DR2J 3WK4A 1COOA 1OUQA 1PK3A 1BC6A 5EE0A 1XTZA 3U27A 3K1ZA 2QLXA 3TP2A 2YX4A 3QU4A 1TL3B 1F3FA 2FY8A 2D3ZA 2UUTA 4F0HA 4OJLA 4YFKA 4KC5A 1HIYA 3BH6B 1ZQRA 5BYRA 4P4MA 1VHIA 3MM9A 2RRAA 3J7ZT 1SWVA 4CRJA 3BGOP 3HZGA 5M2PA 2BJEA 1SJRA 5CYQA 3UPFA 3MR7A 2Y9UA 2V68A 1UW9A 1GK8A 3C2PA 4NLOA 3RB6A 2OD6A 3MDCA 2HK3A 2AJ1A 2H48B 3SXLA 3WQPA 4TUPA 3M2VA 3Q86A 5AKXA 1XN9A 2ZFHA 1JJ2R 1X4FA 2D69A 5J2PA 4O3OA 1S1TB 4C11B 3ZDBA 3RR8A 2J6UA 5EE3A 3OSPA 2ADBA 2NRWA 1OO0B 3FCHA 4EX7A 1PG5B 2JH3A 4WU2A 4UAUA 3IV8A 2PMHA 3VQTA 3DLEB 1BMQB 4IFYB 3B78A 5HQLA 2P9GA 5HATA 3FK4A 2BE2A 1NB2A 1C1BB 2RQMA 1KHWA 3D6FB 1S4FA 2OODA 4CTAB 4TURA 2ZBPA 3VTIA 1ZQLA 4C8KA 3M6KA 5D4OA 5B7WA 5HAOA 4Q43A 1DTQB 2XY6A 5C42B 3I87A 3KXDA 4UBPC 2LPEA 4NPOA 4LJMA 2RE1A 2WOMB 3M8QA 1KLNA 3OL9A 3AY0A 4WP9A 4MK8A 4MIWA 2Z2MA 3H5XA 3HHEA 4B3RJ 4EWTA 3DGVA 3UD3P 2KJVA 2EZYA 3PEJA 3IS9A 7ICVA 4RUHA 2JMGA 2RU9A 4R8UB 5KFHA 1TP7A 5KG7A 2E1FA 3PRBA 4C60A 3QQCD 4B3SJ 5HHHA 3NCRA 3WC2A 4ZN3A 4OZ3A 4C9DA 1PBAA 4WIQA 3RZAA 1SXDA 2DKZA 4OYBA 3KLHA 3KLIB 2MXYA 4DPUA 2CWKA 2J9EA 3VAGA 3GDXA 2EFNA 3KG1A 1SH0A 4KH1B 2EFVA 3QAUA 2DRDA 4PAAA 2VU5A 5GTIU 1JB0C 1GMWD 2Z57B 3ETMA 2NCKL 3JQKA 1FDBA 1KRAC 5B0GA 3MUTP 2VICA 1U25A 1CJVA 2PUZA 3P5BP 2MKHA 5LMUF 5KFLA 2EC2A 1B0VA 1ZBTA 2VV5A 5AI5A 3MM7B 1LK5A 1Y88A 2HOQA 2ROGA 4DBQA 1HBUB 1IKVB 5IWAF 7ICOA 4AL6A 3MM5A 3NGKA 1FWGC 3EUB2 1YDLA 1H98A 5J2QB 2D3O1 3NUQA 2MDAA 3D66A 2F8KA 2L41A 4WCEQ 3DGPB 3CMQA 4KGKA 5HL7Q 4GKJJ 4G9BA 4AUKA 1G6BA 2Q0ZX 3HPOA 4ZVOB 4RW4A 1FKPB 2RB7A 2PN6A 2IRXA 1I94J 3V5RA 2AYGA 3SQOP 1GT8A 2M3DA 3O2IA 2HNZA 4ECWA 5DM6Q 3T3FA 3A13A 3CCSS 4L73A 1X4HA 2M8HA 4O9MA 4DSFA 3JYTA 1B99A 3SR6A 4MKBA 4CLPA 3JTNA 3R7NB 3UQ2A 1WCLA 4Z42C 4NWIA 2V69A 3H5UA 4YFUA 4YG2A 2V6AA 3VR1A 1HFEL 3HDSA 2V8VA 4WGXA 5DB6A 3Q8SB 1X31C 5MAOA 3FSYA 2RS8A 1DTTB 3EICA 1AB8A 4CNZA 4NLQA 5DQHA 1RSCA 3LWMA 3KLGB 2O67A 3HM7A 1XR7A 4NX9A 4GC6A 4EYIB 2OLWA 2OWOA 2KZMA 3R1LA 1XNSA 1VDVA 3PYGA 2VIXA 1ZTWA 3O5TB 1JALA 4FN5A 5J2MA 3CC2S 5KFVA 2NXEA 3KLFA 4EP8C 1TKXB 4DPXA 2E5LJ 2CJBA 4ZOSA 1YRRA 5KFTA 2UVUA 3BYPA 3LVWA 5D4LA 5EWEA 3P4UB 1N34F 3KMQA 2ALZA 2F3JA 3PFEA 4R0JA 2AYBA 1FRKA 2DXDA 1RJRA 4CO0A 3NNHA 2DIUA 3FNNA 2MB0B 1M5PC 4QZ9A 4YS2A 3MPWA 4DPYA 1X66A 3CO9A 4OHYA 3H90A 4A8QA 5CA7A 2CIMA 4IG0B 2OFGX 3KLEB 1KQQA 1J97A 3UMGA 1U1LA 2W03A 4RQ1A 1ZQFA 1N36F 5J1PA 1S1XA 1FKOB 1RGVA 2OPSA 2L3MA 5DKWA 1V4YA 2XO7A 5CYMA 4LFBJ 1YX2A 2O1PA 2G06A 5L1LA 2H51B 1N0UA 2A3VA 2XCPA 4GC7A 2BCRA 5KAFU 2LCWA 4WP8A 4YR2A 2ZC4A 2GJIA 2MKSA 1LW0B 2GCFA 1MW7A 2FPHX 1WC3A 3SMZA 4I2JA 4LUBA 1TVRA 1YRXA 2OTJS 5J0OA 2XS5A 3DYAA 4OZ0A 1SZHA 2QYGA 2WONA 3NRWA 4DX8H 3LO3A 4NI2B 2Y1LB 2QL5B 5AKZA 1T9XA 1W2BR 3SAHA 1B0PA 3TI0A 2C3MA 9ICCA 5J0TA 3CCZA 1VR6A 5IIOA 2Z8QA 4C8ZA 3G6XA 4CO1A 1T05B 3N7RC 1VYAA 1HPZA 2CNLB 4NXMF 1RHKB 1H7XA 2R7WA 1N32F 5LL6d 3TZWA 1I1GA 1YLXA 1BQMB 4WJBA 2CQDA 1CJUB 5KG5A 2AYMA 4F5RA 4F67A 3AH6A 5J2GA 1NKBA 5IC6B 2QLWA 4FP9A 4F02A 1JI7A 1YZ6A 2IAJA 2F9JA 3BGLA 2WVDA 4WIIA 3MTWA 1QSSA 3DFEA 5T14A 1NZPA 2BRKA 5CHCB 3HD1A 3C1YA 2ZJPQ 4DL0C 4F0MA 5AK5A 3JAMU 1OPZA 1ZM3A 5ALKA 2DNHA 3RB4A 4F72A 4M5JA 4J37A 2F8MA 4ZKAA 4C0HA 2MYFA 5J2KA 1X4DA 4DV2J 3UD5A 1QAJA 5CEHA 3CIZA 4UZBA 4MYUA 1NOMA 1JNRB 2GIQA 2RDDA 4ED7A 2KD1A 2CQ1A 4WPAA 1NB7A 3PR4A 3ET6B 4NLUA 5DQIA 1ZQVA 3I6PA 2XB2D 3FDSA 3IV6A 4OX9J 3CDAA 5KAKA 2HVHA 3DI6A 2HDOA 1J5EJ 1NJYA 1BPDA 1FO1A 3KG0A 4KO0A 1TL5A 3D2SA 3LGMA 3NVWA 4OV1A 3WX8A 3MUVP 1VQ4S 2JR5A 2FZCB 1XK8A 1LKYB 5C25A 3UFCX 4UB8U 2ZJQQ 3KFWX 2CG8A 2BW2A 1NXIA 1MMLA 2Z2YB 2MKKA 1RWVB 3CD7A 1S0MA 1I51B 4EEYA 1FWHC 1RT3A 2KYZA 2KKVA 5JTIA 3W1YC 1RACB 3LW5C 4J9OA 3J80Y 4QYRA 1OSCA 5IT9U 4L3NA 3RN6A 4UY8T 1R6VA 4ZVFA 2SXLA 1HBNA 1T9VA 1HW8A 2CDQA 1TKTA 2WHEA 4I69A 4KHPJ 3RU0A 4DDFA 4USJC 4S0MA 2R7RA 1NDLA 3QRPA 3HSDA 1K70A 3GCWP 4YMOA 4DLEA 2VQFJ 5HK4A 4DO9A 3B6BA 3R1HA 1VQ8S 1WUUA 5ADZA 1TL1A 1NH7A 4YCXA 2YB4A 5DDMA 2XLJA 3DM2A 1NU4A 4F50A 4NJ8A 1BGXT 1GXUA 3LP2B 4XUSA 3PJ9A 3UO0A 4DF4A 2IHNA 3GV7B 3VGTA 1JJ4A 2JFDA 3ZO7A 4Y2AA 1OYDA 1A5MC 2ICSA 4I56A 3PVXA 2ZXIA 3SQGB 4ZJLA 3M6WA 1SUQB 5IM0B 4IR1A 3NL0A 4Z6EA 3M8PB 3M1YA 1T11A 2GJFA 4BGDA 4ZCIA 1C0UB 1C1CB 3NS1A 5ALJA 4NCAA 1T9YA 3FM9A 2XMMA 2VG5A 2UXDJ 4NL5A 1AZSB 1XERA 4QOTA 3GWCA 2WVCA 1XR5A 1EXNA 1H2VZ 2RQCA 3NS7B 5I3QA 3HX0A 2FHMA 3I0SA 7FDRA 1FVSA 2WCXA 2O66A 2GHWA 2FJAB 4DR5J 1XNQJ 5LM7E 6FDRA 2N7CA 3LGHA 3G71S 2HBYB 2W2NP 4DV4J 2XBPA 1NJXA 2F8HA 2W25A 3IG5A 1YRUA 2VG6B 3QU9A 2OPQB 2M52A 2UV8A 4DUZJ 2VKRA 1TE2A 5CABA 2N7YA 1RWPB 3TZYA 4A8SA 2RDJA 1IXKA 1B7FA 2JSXA 3CJKA 5F3XB 1S9GA 1UZHA 4FZLA 2QIFA 2XIDA 4KLJA 4DI6A 3C23A 4W92B 4HI1A 4KLTA 4A8YA 3A8KA 4GKJF 4OQJA 1ZXIA 2HPUA 2UP1A 2FY1A 1UVLA 1SIJA 2PSZA 3M9OB 3E8OA 4HDHA 2JJ4D 4EO6A 2E9TA 4M47A 9ICFA 2HRUA 4M95A 1JLQB 2OHFA 4YOEA 3HVWA 2DO4A 3W7BA 3H7HB 5LOQA 4I2HA 3NBPB 4F0LA 4WKYA 4QWEA 2KSOA 5F0WA 2V2QA 2YKNA 1QJHA 4C48A 1WTFA 4G6VB 4MF8A 1FK9B 3SFUA 4DS4A 2JRSA 5AI6A 3MR2A 3GFKB 4M94A 1ZQUA 4CLYA 4O44B 3L7UA 1E6VB 5CD4H 1NDKA 2H54B 1YJTA 5AJ3F 5D0HA 2H5EA 5GAEI 3LA0A 2XGQA 2PIIA 7ICKA 4C11A 2JVOA 3EUNA 2QO3A 3ISNC 1EJWC 2YNGB 3CJRA 1OXJA 3O7UA 3WC0A 2E5LF 3BQ0A 5F8NA 4CO2A 3KUGA 2E7WA 2ZD1A 2F77X 1QUVA 1CI4A 3H4DA 3HHLA 2YTUA 4Y34A 3BQ2A 4CTAA 1Q8KA 4DJBA 1QH9A 3J7AN 4KFBB 2VJ4A 3TJAA 3MD3A 3KJQB 2CPXA 4USHA 1NK6A 1XSPA 3QT5A 2WOMA 3V6JA 4QPXA 3N6NA 4DPWA 2GGPA 2G07A 1WG1A 3MURP 1FWFC 3BYRA 5J8YC 3M05A 4CLWA 5AM2A 1N48A 3BEGB 4LFBF 4CLFA 3GFZA 2G3FA 4I2EA 3B4MA 2PXIA 2KXFA 3KBBA 3ZTSA 4AXIA 4QZBA 4ED1A 1G1XA 4C0ZA 2WSFC 3ONQA 4PPZA 2FTYA 1Y5IB 2HQCA 1NZ8A 1N56A 1VQYA 2HFUA 2DGWA 2L9NA 2L5YA 4MFCA 3G9CA 3MABA 4V1XA 3GU3A 2V94A 3FQKA 3G8TA 2BQRA 1X8DA 4FZVA 3MECA 3T1HJ 1FNOA 3C14B 1WG8A 4R65A 1F5BA 1RTJB 8AT1B 3QJJA 7ICPA 1QTNB 4LSNB 2EAPA 3LALA 2Y9HA 1U4BA 1UVIA 4KLIA 1JXVA 2LHTA 3ZZZA 2AW0A 5AXNA 4UAYA 3EPIA 4C7QA 3GP9A 2G4BA 1X5SA 8RUCA 2KG5A 1S48A 2KKHA 3TRGA 3BR9A 2R8KA 2R7TA 4ZPCA 3GLJA 5HMWA 3AODA 2W1BA 3JXOA 1IKYA 1S5ZA 3OHBA 2XMWA 1HBUA 1N5YB 1S5LU 3TAPA 4C5ZA 1F5AA 5B08A 2CQPA 1CULB 3TAMB 5J2QA 5AXMA 4PHEA 4IRKA 2RHQB 1WHWA 4JB8B 4OJ3A 1SV5B 5C24A 1JLFA 3CMES 1R0CB 4ICLA 3MEEB 5HNKA 2XYGB 2KP7A 4MEYA 1UA0A 4I2PB 1EJTC 2WTFA 1XMBA 4Z2XA 2F7VA 1REVB 4DV2F 4C4RA 3D6MB 4F0SA 1KVJA 5HP1A 1KR4A 3RH4A 2VL1A 3M2RB 2ZH7A 2J9DE 3T5JA 1WHYA 4DL7A 2HWTA 4B9VA 2HZAA 2KHDA 4CWBA 2P6SA 4HTIA 1OSDA 1TU0B 4LBPA 2E5HA 2KL8A 1GXLA 5ALZA 5ALPA 3MZIA 2DH8A 3IXQA 2UVRA 3UQ0A 1ITPA 4LF5F 2DBYA 4LRDA 1HI1A 4Y2IA 1KOHA 4CLKA 4F4AA 3T5LA 4A8MP 1ZQXA 2ZTEA 3RF9A 1NK8A 4FPIA 2MMYA 5AM0A 1JK9B 2HIYA 2ZBRA 1BVSA 1U0HB 3VQSA 1MSWD 3LAMA 3RJEA 2LU2A 4EBEA 2GV1A 3QJLA 4YD1A 4KHPF 4GLXA 3B82A 2QV6A 3U26A 4HR2A 2R9LA 5EE9A 4WK3A 2WB4A 1UBPC 4NLSA 2VQFF 4GXJA 1EETB 4G1QA 1S0NA 4P0PB 1FE0A 1WC1A 4QIFA 1X5PA 4HHUA 3D28A 1HNWF 4ZVUB 2HAIA 2AGOA 4NLDA 1POJA 1SI9A 1XC9A 1PO9A 2ZOFA 1FJEB 1RK6A 8ICEA 4KLUA 4WZQA 4L75A 1GX5A 1WWHA 5J2NA 3C2KA 4C8NA 2H3EB 1DFDA 2YKQA 5AE3A 1FNMA 1RK5A 5AKYA 5DETA 4DSLA 2HMXA 1KTQA 3CJ4A 3I0RA 1W2IA 1UTAA 1IQZA 2PMZD 4CO3A 4R63A 3A3NB 4PHPA 3GZ7A 3PG9A 2QLBB 1LW2B 4G65A 3EW9A 5JXSA 3V2UC 2QRRA 2UXDF 2KHVA 2DWQA 1IM4A 3C66A 1SIWB 3G96A 1RT2B 1BY9A 4PCQA 2UUCJ 3JAMY 4DR5F 1XNQF 2DD8S 2LDYA 3G86A 2JZBB 3ISND 2F65A 2FVQA 5GAHU 2IVMA 3GZFA 2CPIA 2MKJA 4DV4F 2VBXA 2BKNA 5KFIA 4UB2A 3F56A 4RUAA 1VQLS 2X3GA 4J91A 4TLQA 2BE7D 4P72A 4ZVSB 1MN9A 3AB4B 8ICHA 3EWGA 4PZVA 3NQBA 1CJUA 2DGSA 2VIHA 4DUZF 3BGUA 4I2IA 2HYIB 3AA9A 2H65B 3JPRA 5HMMA 2ODGA 4C7YA 3I4HX 1REGX 2FB0A 1WDTA 1U26A 1A7GE 5DM7Q 1RTHB 4ITSA 4UBCA 1HW9A 1FJGJ 1GMUA 4O5KA 4NLZA 2PT0A 5L9XA 4ZPDA 5IINA 3ZD9A 2AQ0A 5D4PA 4JV5J 3E0LA 3O0FA 2UXCF 1FHTA 5ETLA 5HQMA 4P4PA 1H3DA 2L48A 3A0HU 2HS3A 3UW1A 1UWBA 4P0QB 3U1MA 3N9UC 3R5CA 5IT9Y 2JWNA 1PILA 5AT1B 2B43A 1R8BA 4MJKA 4OI4A 2WF9A 2HBZB 1EHWA 2E1PA 3HI9A 4B17A 3E0FA 2FVMA 9ICOA 1AW0A 1ZAXA 5J0XA 3L4BC 3QRQA 5HJYA 4CLUA 2KEYA 3BKFA 4CH0S 3C6UB 2JL9A 3CDWA 2CXEA 2ASDA 1S49A 3MXHP 5J0UA 3GRIA 1LKYA 2K2PA 2VFVA 1B22A 1V3RA 2GQ2A 4J9NA 2ZDPA 4P6QA 1RAIB 3X1LB 3SCKE 2P9EA 2C3PA 4MK9A 4MF2A 1T03A 3ZNJ1 2OHDA 3EXCX 4AL7A 9ICQA 3TFSA 1P8GA 4CF3A 5KNIA 3ICXA 2ZIXB 4QWCA 4JMUA 2NXCA 1SKWA 2NRTA 2CUYA 2B7CB 2W2OP 2P9BA 2ZIVB 5L38A 3R9LA 1RABB 2P6RA 5SUHA 2LYBA 1WWVA 3WIVA 4KMUA 2ZWPA 4QBUA 3UDCA 1DK2A 2MSTA 1B3TA 1VK3A 4U9RA 1CJTB 2V4JA 1MU2A 4DOAA 2NXJA 4L9XA 2WRMA 4QJVA 2Q6CA 1Q3UA 1I3OB 1WF1A 3DRRB 1HNXJ 1KWMA 1S9EA 3H0PA 3R7BB 2VONA 2YNFB 3DDHA 3RG6A 1LWFB 1KONA 5THWA 2KRBA 4ETZA 5DBAA 4OZLA 1UCNA 1R8AA 4F4KA 4YB6A 3H2UB 4UQTA 1RADB 2AGPA 2WZ1A 4DN9A 2HBLA 4YEAA 3W2WA 2IOFK 3TX8A 3DOMA 2V8HA 4RBTA 4USWA 3M8PA 1KLMA 1RB0A 3DRSB 3GFXA 1VQOS 4DR3J 2HHVA 3BGRB 4HH1A 4AYBC 5B0FA 2ATLA 3N2CA 3LS9A 1Q0NA 1RTDA 4DCPB 1FRXA 3KHHA 1MNEA 1JXLA 5C2GA 1LKZA 1YRTA 5KFCA 4UARA 1SZPA 2B9XA 4NV0A 3MMCB 2FVCA 1AYEA 2W4DA 4LRAA 1VGYA 2PC6A 4J5OA 2R2RA 3R9KA 3T1HF 3GYNA 2E7XA 2M7SA 1YZ7A 4C4SA 3BF4A 5L1IA 2HBQB 2GWSA 3BBFA 9ICUA 4RUBA 3TUIC 4K4IA 2RS2A 1S7IA 2VG6A 1Y7PA 1VOMA 2DTJA 4MKVA 5C7PA 1IJFB 5JU5A 3DLKA 2CZ4A 1FWLA 5AIAA 2HHHJ 4LZDA 1ZAVA 4BXOB 3HSGA 4KN7A 4HHJA 4LQ9A 4WE1A 2MLZA 2XLIA 1BE4A 1ZYQA 5IIMA 5KT6A 1O8BA 3LP0B 3I5AA 2P50A 4DL2A 3Q2SC 3ITHA 4K2JA 4X4VA 2W9CA 3I31A 2OEKA 2E7VA 3LK9A 4CEXC 3FJ2A 2DGUA 3JPOA 3CYMA 2XM3A 4ZHRA 1KFTA 3PZPA 3BSAA 4YY3J 4ZJOA 1N6QB 2GNKA 1N5SA 2QZ8A 2FZKB 4KT0C 4CT8A 2XMUA 1RT4A 4HACB 4K2XA 1QLNA 2NRVA 3NS5A 1JLQA 4QIEA 1S59A 1H6KX 2BHNA 1G4CA 2QKQA 2NPIA 2O01C 3PNIA 3M32A 5E3RA 1U1PA 5B0CA 3MAQA 2BZFA 3L5KA 2KMDA 4NMXA 1JWWA 2J7UA 4U67Q 1KSPA 2BVZA 5K14B 1KL9A 3MDFA 4O44A 3MPGA 4ECTA 3RJHA 1Y0HA 2BEFA 1UWAA 1TR0A 4B9SA 2DGXA 3AUOA 2G0CA 2N4CA 4KE5A 2X1BA 1Y4ZB 3NVVA 1A77A 2V9KA 2J6SA 5LSLA 3K5LA 2FI1A 4IRCA 1MROB 3D67A 2FJDB 5LSRA 3D4JA 2IY5B 3ZC4A 2F40A 2R3VA 1EJXC 1Z1BA 2RIJA 3HKZC 5F8LA 2ZNYA 1VBZA 4C8YA 2ZIWB 2BQ3A 4A47A 2DYAA 1RTZA 4WFNQ 4IQMA 2Y1RI 1JLEA 1A5KC 4JI4J 3CJ2A 4M5MA 1RBAA 3RJKA 4UB3A 4QZAA 3C6TB 1UKUA 1NHUA 4A8KA 5KFDA 4O4GA 3H2VE 3P96A 3B0YA 4NE9C 2V9WA 1VS3A 2LBOA 2YQ0A 5IOLA 3K5PA 2DT9A 1U6BA 9ICXA 3TQEA 4UB1A 1QM9A 4RW6A 1KN6A 1FJ7A 1TK8A 4KH0B 4CLLA 3D0GE 4KLGA 3GU0A 1UEKA 5ALNA 3CTRA 2ZE2A 3BO3A 3I76A 3ISZA 4FXDA 4Y2XA 2B0GA 2I9UA 4C2MA 1FFUA 2C3UA 4PUOB 3FBEA 7AT1B 4KRWA 5HI7A 3KKFA 1PGZA 3MR3A 2VG7A 3JSMA 1K73T 4KHRA 3OD2A 5HROB 5K8PA 3RJMB 4RO0A 3BS5A 4DR6J 5HLFB 5AM5A 1OWXA 3K5NA 4X64J 4Q45A 1F0XA 2UUCF 3DU5A 1RDFA 1Q81T 1Z1ZA 2ATCB 2B6GA 3HK2A 2ILZA 1WHXA 3R27A 2BCSA 2JRZA 1ZQPA 1Q16B 3M2UA 4ID8A 4NLKA 3R6GB 5K20B 2J76E 2VFTA 1EP4B 2LQ9A 1T4GA 2DGOA 4Y2UA 3ZZRA 3AHPA 1RAKA 5AI8A 2VM8A 2DO0A 3V6KA 3HD2A 3C15A 2C3OA 2QA4G 3AD9C 5IQ6A 4WFBQ 4M9NA 1NCLA 1YKWA 1RTIA 3H2LA 3V7JA 3T1YJ 3DOLA 5G5GA 4UOCA 2XULA 5HMXA 4TLRA 1UPHA 2KV2A 5AXLA 1ZQEA 2OYYA 3MEEA 2ZVIA 2QB1A 1JMSA 4WTOB 1F2HA 5AKKA 1SH2A 2G0AA 4I2PA 3K58A 1Y9OA 2Q4TA 3FEQA 2HMIB 4LVNP 3SQIA 4MTPA 1ZS6A 4Z7CA 2ZOGA 3GR1A 1DOQA 4F5NA 4ZVGA 4PQUA 1UVMA 1UEVA 4Y2RA 3LP1A 4DHVA 1VRUA 3TACB 3M2RA 2H5XA 2ZC3A 2I9GA 2B8PA 1FWCC 2DCLA 3CCRS 1JLAA 1KVIA 4OLOA 4DU7A 5KL1B 3BPSP 1VQNS 3D1QA 5KFMA 4LBHA 2YKPA 1L3VA 2F1IA 3LDAA 4US8A 3BDPA 4QPTA 3H8WA 5A0YB 3M8WA 3QUCA 3ZDCA 2NO5A 1RXOB 3DLGB 3BDEA 3ZZYA 1IR1A 1UFKA 2F8LA 2BE9B 7ICLA 1Y5LB 1ZAWA 5A8KA 4IR9A 2GFFA 2FJBB 1KBRA 1WEZA 2QB0B 4ZCMA 1PYOB 4ES3A 3OR2A 4RLEA 5HO4A 1ZM4A 3MDUA 2GW8A 4BWJA 4O3QA 2VB6A 3NY0A 1HBOA 4OHWA 2OSRA 1FWBC 1PKUA 3RB0A 4LF1A 3K5OA 1LEOA 1UFWA 2CJAA 3JTOA 3HXMA 1N60A 1UEUA 2DNRA 3QAEA 3KKAC 1EIYB 4UATA 2Y8WA 2LI6A 1HNXF 1T9WA 1AROP 5AKIA 1HMVB 1FEHA 1HI8A 1RT5A 2J7WA 1AUDA 2IBKA 1UETA 3SEOA 3GJQB 4RQ2A 1ZD4A 3J81j 2JEIA 4B3ZA 4FNHA 2ZZNA 1FXLA 3CPWR 4NWBA 1XRTA 3B8HA 1ZTTA 3QT6A 4N47A 1WEYA 4K4VA 4ZVEA 3C16B 2C28A 4DFDA 3SDEB 4A46A 2N3LA 2DQNB 1IV8A 2QT7A 3PNCA 4ZMMA 3JB9k 4DR3F 3ISCA 1BWVA 2WAQC 2HEKA 3HJEA 4KSEB 3ZD8A 4BDPA 1F9EB 3I96A 2HBKA 5GADU 2R42A 2FC8A 4P7TA 2WF6A 1IKXB 5KFGA 4P10A 1UVJA 3QGAC 2ISPA 4OI1A 2DNLA 9ICPA 2IDEA 1S6OA 1JJCB 4KV8B 5DDQC 3SV4A 1K1DA 5AM3A 5AKJA 1T9UA 3LSCA 2C1EB 2HG4A 3I1YA 2LU1A 3GSIA 2Y9TA 1K6WA 3GJTB 3T41A 8ICRA 4PGXA 4J9SA 2BB0A 4LF9J 5FSEC 4OZ5A 4RZRA 3JQMA 1WELA 4IFVA 3L7PA 2BM1A 1RA0A 2R8GA 1XQIA 3HHDA 1L7NA 2KU7A 2R18A 5IIJA 4TNOA 4ZLJA 1HYSA 3WKEA 2Z30B 4I27A 1WSVA 3EZOA 3RBEA 5EUHA 4H4KC 2KK0A 4KGXB 4CZCA 2AU0A 1N5QA 4QWBA 3C46A 3NRZA 1VIOA 1IWAA 3EXYA 4YY3F 3POTB 4W90B 1ZJMA 5J0QA 5ETMA 2Y0SC 2EAMA 2B8QA 3NOGA 1FEZA 1T9TA 2BJ3A 1FEEA 4CCHA 4RZBA 4G7EA 2GSEA 3RUBL 4YHHJ 3IAM9 3BM7A 4F5PA 4KHMA 4TXSA 3E58A 1BPBA 1ZQYA 2GQCA 1F6TA 3SAFA 3Q8QB 3KHRA 5D0RA 1HQUB 3AA8A 1TV6A 2GA7A 3N6MA 5L8RC 4RQ5A 4ZIVA 3CP8A 5DGBA 3G77A 3ZZPA 8ICXA 2HBJA 4DCJB 2ZZMA 5M2RA 3MKVA 1DAXA 5KT4A 3SFGA 3KG4A 4AE5A 2FVSA 3DMJB 4LF4J 1JLCB 4FS1A 4G1PA 2K06A 3I4PA 1D8ZA 3QMQA 1KNZA 1X9SA 3UXNA 1Q7YT 4ID5A 3LWLA 2I6XA 4M6WB 1CS4B 4RBVA 3H0LB 4PRFA 1CVJA 1D9FA 7ICSA 4H4MA 3LGNA 1X7VA 3M8YA 4C4WA 3MAHA 5I42B 4KKOA 3LANA 2FMSA 3NOCA 9ICAA 4N56A 3H40A 5GMDA 3VAMA 3QEBZ 4CQ1A 4K4ZA 1SC1B 7ICMA 2HVZA 4FBTA 3FBCA 2VFSA 2OEHA 1DRGA 3RGIA 4RW7B 1U1OA 3H59A 4JI4F 2JDJA 2OEJA 2PFFB 2E1MC 2WB1D 1Z4UA 4ZPAA 1RZMA 5F41A 2I0XA 1JNZB 4JI7J 2IM2A 5EGYA 4CGZA 2EFPA 3PYFA 3IWLA 3MFHA 1TV9A 4OJ6A 2W9MA 1IUJA 2HAFA 9ICGA 1IIPA 2NYVA 3D54A 4CNUA 3C28A 2P35A 1KS2A 3Q22A 1RDRA 1AFJA 2HZCA 1BXNA 3M9NB 2K60A 1YSJA 4I2FA 4LBIA 1Q8LA 3PRDA 4KTQA 3NCPA 4UUXA 4O0NA 1PK1A 3AEVA 3QPIA 3RJJA 2B9YA 2QT3A 5FDLB 4MYTA 3NNCA 2ZM6J 4DFPA 2QSWA 4DV0J 2PDAA 1RT7B 4YXJA 4LR9A 4G3IA 4AYBF 4KX3A 3FZBA 4ECVA 1H38A 3PW0A 3PJWA 1AT1B 3MI7X 3WBZA 4DUYF 5AK6A 5DJBA 1TMJA 3MEDB 1RHRB 2Q6BA 1CLFA 2NREA 3NGRA 2QARB 2F3NA 5DGAA 4FPRA 1RG6A 2MKYA 2DR6A 1R31A 4NL9C 2MQLA 2ZUCA 3K5MA 3UVJB 1M5SA 1SC3B 4RQ7A 2OXOA 2J9DA 4B9UA 1U0SA 2G2ZA 4UOGA 1N62A 4BCAA 3NKYA 4RR5A 2JLFA 2RILA 3CD0A 1RAAB 2HQIA 3MBYA 5J1EB 5CCMA 2K1RB 1ZD2P 4BXOA 1R0AA 3MMBA 4QW9A 2MZ1A 3VVUA 4URGA 4NCBA 7ICJA 3T1YF 1KKXA 1IKWA 4Y6IA 1XS9D 4JI0J 2BQUA 4RNHA 4B3OB 4FYXB 4ED5A 2XHCA 2W7OA 1TTHB 5KFUA 3I32A 1I6JA 1ROFA 1DZ5A 4M9JA 4NLBA 4F3OA 3I9ZA 3OVBA 2FC9A 4QWAA 1LV5A 1L7PA 4DV1J 2UZAA 2QFJA 1NSAA 3BN4A 1NK5A 4FBUA 1RJPA 1PO6A 2CXYA 1NRKA 4DQIA 5AICA 3ZTQA 2CG4A 2OOFA 3WKAA 1FRLA 4HTJA 4I2CA 2XZTB 4MFBB 3X3UA 4X66J 2ZBCA 1BQXA 5KFQA 1ZETA 4OJGA 8ICPA 1S57A 3HRDD 4WFZA 2CQCA 5KFXA 2J5AA 4NXNJ 1CC7A 3D68A 2Y8YA 4TUSA 2DGZA 1RBOB 2WF7A 4ZOHC 1NHKL 3AXMA 4LFCF 3D3CJ 4J9MA 1RPLA 4IDKB 2CPZA 4F2SA 4EUVA 4IQUA 1SQFA 4PXBA 4IUFA 9ICEA 4JI8J 2YNIB 5DG8A 3D6TB 2IM0A 2MGZB 4IOBA 1RKJA 1FKAF 2C2KB 1RHUB 1FIQA 2W8KA 1O6XA 1O0PA 2ZIWA 4ED4A 4I29A 3OTBA 1M0SA 4OI2A 2ESEA 5DO2A 5U47A 1F9FA 4MK7A 3HKZF 1SQGA 7ICHA 1WKLA 2F76X 1WF2A 2PEHA 3F44A 1F5CA 4CE6A 2DHHA 2HOIA 7ICFA 5KG1A 3K4GA 3V4IB 4KLLA 4HT7A 2BANB 3W5YA 1S6QB 4WYLA 3M8SA 2YBVA 5ETPA 4C0OC 4TY9A 4B02A 2WSCC 2EFOA 2ZIUA 5J2AA 3CJTA 4KIAA 2LYHA 4USAA 2XNRA 3CC4S 4P2XA 3RAQA 5HBMA 3C2LA 5BOLA 5E3PA 4ZP8A 2F9DA 4M5LA 2FZGB 1D1UA 5HHIA 4I7FB 4OYMA 5A76A 2BKPA 2GVZA 2LKZA 3F2BA 3CCWA 4AT1B 2K4PA 4LFAF 1W7WA 4DS5A 5ETTA 4Z7YA 4C97A 3SZ2A 5D4NA 3G6ES 4GBDA 2ZOMA 3KK3B 5A8RB 1YITS 3GG0A 2AP6A 2PAJA 2J8AA 2RKIA 4DR1J 1S1WB 2LXIA 1V9OA 4QZIA 3Q83A 2ZJ5A 5KFFA 3Q8YA 2C2OB 3HP6A 2HK2A 1NK9A 1KRPA 3R2DJ 2QSFA 3N97B 2HSZA 3CCVS 1H7WA 4X65J 3EZ5A 2BXJA 4LF9F 2KHCA 4ZJQA 2FDRA 5AM1A 1JX4A 4PHDA 3PW5A 1SQEA 4DL3A 3KDNA 1GH8A 3MPYA 4OFZA 2IVFB 2XCAA 3N4MB 1M1KT 3F41A 3VAJA 4E0DA 1EB0A 2VHLA 1DQ9A 4M1KA 3ZTOA 4Z37A 4O3SA 2DPJA 4I64A 3V6DA 2QA2A 2DEIA 1X40A 1CJKB 2H3FA 2OGUA 3Q89A 3RAMA 1S9FA 5EWFA 3MM6B 2CJYB 1C20A 4MIAA 3P45B 2Q09A 2EG1A 2LA6A 1WACA 2C2EA 4Y2VA 4YHHF 4AD6A 1M1GA 2XMTA 2CAJA 4WXOA 4GKKF 2ZHBA 2ADCA 4ECZA 2G2OA 3DLJA 2UBPC 8ICGA 2W24A 2ZH8A 2UU9J 7ICTA 3EWAA 4L3KA 4M5KA 4FYDA 3MDAA 4B3MJ 4M04A 4LF4F 4D3GA 3QIDA 1GEHA 4DG1A 1F3VA 3CVKA 5A0YA 3OFFA 1N0VC 2FUG9 2H4YB 4CYUB 1VJWA 3PW7A 1CQNA 4AL5A 2ERRA 2W3SA 1ZZNA 1SL0A 2MHNA 2YY6A 1FWIC 2CRLA 2XMVA 4BC9A 1WTBA 3TA0A 4DX6A 4BLGA 4LVOP 4DL5A 3IM1A 5A6PA 3MEGA 1PJ7A 5IT4A 4ANDA 4YR0A 3A0BU 1RYRA 4OX6A 2XMAA 4U6PA 2LM1A 3QXGA 1E9YB 4JI2J 3OFEA 2HHSA 2V8GA 2QMUB 1F44A 3IR5B 3K57A 8ICIA 1OY6A 5KFBA 3W2VA 4JI6F 1HMVA 1RXWA 4RU2A 4TU9A 4PEOA 3AOBA 4J9PA 2M2BA 4JI7F 3UE2A 1ZQJA 3KK1B 3R3TA 5L39A 1FTRA 1HL6A 4M51A 4X84A 2W9BB 5MLCV 4U7CA 4BJHA 1ZQAA 1HBMA 3JQJA 1HIWA 2HWIA 2PFPA 2LKYA 2C3YA 2AJQA 1UVKA 1Q3VA 3F73A 1Q53A 2NZCA 3MM8A 2GX8A 4DL6A 2OD4A 4MFAA 1HA1A 4PYDA 1HKAA 2QA1A 2FD2A 2BCQA 2G1HA 4B08A 1LXNA 4R88A 4NCGB 1RT1A 2WBRA 2W01A 2E8NA 2ZM6F 2M9NA 5T7LB 2RRDA 2BCUA 4DV0F 5L1MA 1S6UA 1BPEA 1NPRA 1VRTA 5KOXA 3CULA 2RLTA 2F1FA 2YQ1A 2WAQF 1ZQZA 2OPPB 4QYZK 3NG8A 4RQ0A 1S0OA 1IKXA 4NLGA 4P75A 4NLXA 4WKRA 1VC6A 2YQ3A 4R5PB 2HVDA 2YTCA 2VASA 2ZHAA 1HNVA 5DB9A 4PHAA 5E3AA 2J8SA 2VOOA 4ECRA 3CJ8A 2A1JB 2RU3A 4JV0A 2DNYA 2ROEA 1B4FA 2ZNZA 2KOBA 3FEYB 3QUQA 3QWUA 2BUNA 1UPPA 3ED5A 3AFGA 1WYGA 2I5HA 1J6PA 1VQ5S 3G82B 1HQEB 4YDXA 4BUGA 2CN1A 1S99A 3AXKA 4KLDA 5DRKA 4ED8A 3P6YC 1YJ9S 1LB2B 5DZ7A 5KFOA 4OJ5A 3BSOA 3N0VA 1BQNB 4KPCA 4OZNA 4AP9A 3GIKA 2FLOA 3MOJB 1TFYA 2QLJB 4K8RA 1QE1B 3ORYA 4TQSA 4JI0F 2KFZA 1F9HA 4W4MA 3IG1B 3OW2R 3PSFA 2AIRB 2MLYA 3W62A 1P1TA 3SIPB 4KPYA 2GOKA 3TADC 4WBFA 4Y2TA 1YHQS 4UTGA 3I28A 3L7OA 3KNGA 2ZH5A 2IC3B 5HP4A 5J8YA 4C6AA 1ZQWA 2XWXA 2Y0SF 4NLRA 1E6YA 2E29A 5G0RA 4DZDA 1FDNA 1L8LA 2A3JA 1WI8A 3GFYA 3RYLA 4ANEA 2R4FA 3UN5A 3DLHA 4Y65A 5H2FU 3CCMS 1VMBA 3IO1A 1J5OA 4X66F 9ICLA 2FYXA 4X4NA 1HWKA 4F8RA 1ZQOA 4F5OA 2JLGA 1S8OA 4NXNF 2H3IA 1ZQBA 4EPDC 4ZLLA 4M6WA 2CJXB 5ALYA 3CJSA 3NEKA 5D3GA 3FMBA 3NGUA 4RWXA 4JI8F 2JV3A 3OLAA 1QQ7A 3V81A 3THTA 2QX0A 3CJ0A 4FVCA 2BKEA 4EZ6A 2IMOA 1S6PA 2DPIA 2J9CA 3VAHA 4PG8A 4BHQA 1HJPA 2DHXA 3QT7A 3JS9A 4MKYA 2J0QD 3QATA 3QO9A 2KYXA 3CDUA 2RQ5A 1B64A 1SB3C 2A6OA 4H4OB 1RWOB 8ICTA 2YX8A 3FFIB 3VHQA 3D7SB 5J2IA 5A8WA 3IR6B 4JYAF 3DRPB 5EWGA 3UPQA 3IWXA 1TUWA 2ZDOA 3QIPB 4A48A 4I6YA 4LSLB 3IGNA 2BKOA 3RFAA 4NA3A 4NMLA 4P2HA 4OYWA 2D6FC 5I3UB 5KAIU 5J2FA 1FRMA 4QW8A 4JWNA 1WWUA 2ZG6A 1ZQNA 3ZZ0A 1B4SA 4QIGA 1J2VA 5AXKA 4A8EA 4BKNA 5J2HA 4OJ1A 1NNLA 1XRFA 3LOUA 2V5HG 2XZWA 1JLGA 3CDEA 4I2DA 4X2BA 1BUXA 3WKDA 8ICCA 4I6WA 2AWZA 3SEIA 2Z00A 2FLNA 4J03A 2DR7A 2FDNA 2VHGA 1N4LA 3HKWA 4CDGA 4WWSA 5F8MA 1EJRC 4DR1F 1S1UB 2QARA 4NYPA 5GAGU 8ICAA 8ICZA 5CHGA 2JOQA 3GQCA 1F5SA 1SKRA 3AL0B 2FJWA 1JRPA 2HOFA 2YWGA 4YMMA 3KMSA 2JC0A 1S1VB 3AT1B 3SENA 3U1LA 4X65F 1PYSB 3DHWC 4R66A 4YXMA 4KIRA 4UT4A 5K8OA 3TFRA 2C22A 2BDPA 2PA3A 1QSYA 1TAQA 4QIWD 2EG2A 2A2DA 3KFUF 4LF8J 3AJ2A 1SKUB 4DX7A 1URNA 3K17A 3MM9B 4M9HA 3QJPA 3BQTA 4RX6A 2DITA 4PWDA 4CQBA 2G0IA 1RCXB 5CYQB 7ICQA 2LM4A 4Q0BA 1BLUA 4FYYB 4WJ3B 2HNYB 3T19A 4K4HA 3O8WA 1UL3A 3M2VB 2D1CA 4ZCLA 1IBKJ 3SSQA 1K1SA 1X5TA 5J2PB 1QAIA 3C3LA 2ASYA 2AHOB 3J7Z5 5FP0A 3QEAZ 2ASLA 1FT8A 2UU9F 4TYAA 3HHLD 4P2SA 4YP3A 2LEPA 3BGFA 2VKZG 1VBYA 4I1TA 3EJMA 4B3MF 1S72S 2HS0A 3MMAA 3TVYA 3EVMA 1B70B 5KT7A 1SVDA 5HMYA 3EGNA 2KXHA 5L1JA 2BE2B 1FWAC 5ITHA 3UNGC 1ELOA 2YNIA 1UP1A 1MA7A 1XSNA 1EKRA 4P74A 4Y2CA 2IYIA 5HMFA 5KT5A 9ICRA 2NYIA 4UZCA 3H5YA 3WK5A 5K8MA 3DN9A 1NH8A 2QFIA 2XGPA 1TL4A 3ENAA 2DNGA 4Q7AA 3GONA 1U1QA 1TL7A 4IO1A 2XC9A 4JI2F 4DOCA 3IS9B 5F8GA 5B0BA 1OQ6A 3PMLA 1IWGA 3Q24A 3AAWB 2B0CA 3JPTA 3DV9A 4I2QA 3H7IA 1WOPA 3I82A 3OTQA 3OTEA 4I6AA 2XVTA 4OJOA 1JQGA 1ZQDA 1YNYA 4LMZA 1R9YA 3FKBA 5L9NA 3OL7A 1RISA 4ZS6A 4ZVTB 7ICNA 3ILOA 3CRXA 4F5QA 4TUQA 1P6TA 4QWDA 3D2WA 4OYXA 1FF2A 3TZZA 5LSOA 4R85A 1RJJA 3OUYA 4K5RA 4I7FA 3UWTA 4ZVQB 5AKHA 2HKEA 3MOZA 4DR2F 4X62J 5KL8B 2KFYA 4CO5A 4RPFA 1CJVB 2VBWA 3A12A 4NXZA 2CNOB 1FFWB 3VGUA 4UB4A 4CH7A 3HW8A 3KK3A 2L9DA 2W3RA 1L3UA 5A8RA 4N77A 3VGSA 5GMKa 2KTQA 4OO1J 3HF5A 3IDWA 1S1WA 1L7OA 2X1FA 1PVQA 4RQ3A 2KICA 2QYCA 3MM5B 5D77A 4IKAA 2NO4A 3CD5A 1DQ8A 8ICUA 5ALXA 1R0BG 3GSDA 4AFFA 2MUTB 1H0HB 2VA8A 2XS7A 2QLFB 4V19J 4UB9A 2D74B 8ICJA 4KY3A 4Q2MA 2KJ5A 4M5DA 4MFFA 3IRWP 1JLBA 2MKCA 3Q0AA 4WP3A 4K4GA 4LSZB 3BR8A 4ZPTR 3W8GA 4GVBA 4RW4B 3OR1A 3HZEA 5LJ3Y 4Y2QA 4C8MA 2QL7B 4IG3B 2IA6A 3J7YU 1RBLA 1RUSA 3FUYA 1YJNS 2HNZB 1MN7A 1U6ZA 1T95A 2ACYA 4EMDA 4FF4A 2Q66A 5DLGA 3O44A 4NEZA 3TAQA 4PGQA 4J9KA 1R89A 5AI9A 3GIMA 4L72B 3HHKA 3JYTB 4RBUA 4J9RA 3MAAB 4IC9A 3TJ8A 5C5JA 1U8WA 2XS2A 3OVSA 1EQMA 1DBDA 1F0MA 1MN8A 2KVQE 4P4OA 3TARA 2AQ4A 1OS5A 2V2VA 1DK3A 5DG9A 1WORA 4HDGA 2Z4PA 1TELA 4MAKA 5KFSA 4PGYA 4CQDA 1V9PA 4LZGA 3DDIA 1G2EA 1UVNA 5C0YA 1WOSA 5J2MB 5D8HB 4P73A 4X4OA 3KLFB 3MR6A 2MAXA 1JKHA 5ALEA 4TQRA 2VD3A 3DOKB 5DBCA 3CJQA 4B3RF 4IH6A 2KHQA 1HNIA 5FD1A 5DS7A 3K8WA 3BN7A 1FWPA 4C7ZA 2JLEA 2ZH9A 2HLTA 1YQHA 5BOMA 2AKWB 1XO1A 4LT6A 4B3SF 4RPYA 2HQ3A 2DHGA 1G7CB 1X4CA 5HVGA 5ETNA 2FGOA 3U1NA 4Q8EA 5ALIA 2GVDA 2K3IA 3OFHA 8ICBA 2OSQA 2R2TA 4G1IA 3CNHA 2B6AA 2H4WB 1S1XB 2P8IA 2GIFA 3GILA 2OPSB 1KW4A 4CO4A 4M9GA 3WX4A 3V7KA 2CWXA 2A0FB 4DV6J 4BJQA 3IAS9 1D8LA 4LR7A 4RPZA 5CXTA 2GWNA 1XJWB 1XMOJ 2QGFB 5H1SV 3RRHA 3DNCA 4C3KA 1TVRB 3BKUA 3BSCA 3DYAB 4C8LA 2JHDA 1RU1A 2WONB 3O3LA 4LREA 5KFRA 4DFKA 2KJ9A 2W2QP 2ZJ8A 3G6VA 3HT0A 2BOPA 4QYZJ 1YJVA 2DGQA 2HBMA 1NSKL 2VQEJ 5F9LA 4A8XA 1R8CA 3R8YA 4EBDA 2KM8B 4I28A 1SKSA 4MH8A 3SSSA 3TYTA 1HPZB 5IS2A 5T7LA 4V19X 3GV5B 5LMUJ 2R2SA 4M63A 4EELA 3EZUA 3C29A 5K5MA 2OPPA 2MZQA 5DB7A 2RF2B 3QGPA 4FKXA 1TL3A 1J2MA 2VFUA 1I94F 3IA0A 5IWAJ 2HFOA 3FGVA 2VZ9A 8ATCB 4O5CA 2K7JA 2BBEA 2CFXA 2W54A 4L76A 2IAJB 1Q78A 4Q8FA 1LVHA 2GQQA 3H25A 3FZ2A 2PMZC 4O4RA 3SAGA 2VC1A 2AX1A 4K5SA 2VA2A 3G82A 3LVVA 4DCCA 4M5HA 3V7PA 1TUGB 1QCKA 1H74A 2YWHA 2WHOA 5B0DA 4CLZA 3PKYA 3GIIA 3BZKA 1EF2A 3IM8A 3L09A 1KOOA 4ZITA 3SD7A 2OPRB 1RU2A 4JK1A 1S1TA 3TO8A 2BGWA 5KT3A 4LF8F 2IJRA 3R2CJ 1QE1A 4ED6A 3GGMA 4LRFA 3IG1A 5ETQA 3EX7B 2A19A 4WHBA 3DI6B 2KN7A 3DLEA 4ZN1A 1Z00B 4IFYA 4WTYA 4J9LA 2EPIA 1WC5A 4F4ZA 2H1YA 2IRYA 3QNMA 5F3ZA 1C1BA 5C25B 3HWTA 3HO1A 3T8LA 2IC3A 4J90A 2OCEA 1NJIT 2BW7A 3UNYA 3NASA 2YNHB 1MG7A 2NQPA 2MJNA 1RA6A 1QVGR 1DTQA 1RT3B 3UN2A 3OTCA 3LQVA 4GVLA 5C42A 5E2QA 1KKHA 1Y00A 3ETRA 3D3BJ 1KRBC 3EPGA 3KNAA 2ILYA 2XY5A 4IRDA 2RRBA 4TU8A 2HGNA 3U02A 5J0SA 2PFNA 1HBNB 4RNNA 1DURA 1TKTB 1DARA 2EWHA 1MQ2A 1Q46A 3C21A 5DDYA 3MCMA 4R8UA 4MT1A 2OFHX 4H54A 9ICKA 4UB5A 3NMAA 2HCFA 5JVHQ 1VQ6S 4JP8A 4RDWA 2C2MB 4DOBA 2KVSA 1WEXA 1OYEA 3UQSA 1TL1B 1PIEA 1VBKA 3DM2B 4OD0A 2HGMA 5GAHI 4NZ6A 2LQ5A 1KN5A 2WK4A 2I9SA 1NSPA 3OQ2A 4PH5A 3KLIA 2ZH2A 2K8CB 1KCXA 2P5VA 2AH5A 3H8YA 4K4WA 3AD8C 4QIVA 4ILMA 1P1MA 2PI4A 4H4OA 3QUBA 4PXCA 5D78A 3KOAA 4NLVA 4RQMA 2DR8A 5CR0A 3M6XA 2XICA 3FFIA 3F5AA 2CJ9A 3DRPA 1ZQHA 4U96A 1UMJA 3MM7A 2NXNA 5KFWA 2VG5B 3H8SA 4DSJA 2JH1A 1IKVA 1DJ0A 3KZIU 4ATNA 3H4BA 3PIOQ 1SH3A 5KG3A 3ETOA 2P66A 1MWQA 5DLFA 1VQSA 1NDPA 3A4TA 2MZJA 3CJ5A 2ACMA 3DGPA 4M9LA 4K0KJ 4ALZA 3N01A 1VHFA 4Y2KA 4WFYA 1UJ5A 3LNPA 4PPDA 3T9ZA 5B0EA 1TKDA 5HR7A 1RT6B 4X62F 4ETXA 1EQ0A 3E51A 4ILLA 5D0GA 2BPGA 1ZRMA 1FKPA 5KFKA 1SPBP 2OTLS 3UMBA 3W9JA 1HHTP 3MFIA 2YN4A 3AQEA 5ETRA 3A8EA 2NV3A 4F04B 1SGGA 3KHLA 3TEHB 4USUA 3CJKB 1JN3A 1H2UX 3M8RA 4OX9F 1S9GB 1HHSA 4UAWA 1GQEA 2V67A 1U9LA 2J0WA 2E8OA 1J5EF 1FFGB 3QT8A 3UCGA 2RVJA 5LJ5Y 3MMJA 3OVAA 1S77D 4PG4A 3CDBA 4LF6J 2E5SA 1NUEA 1DTTA 3NVZA 3FRYA 3UXPA 3BH7B 3KLGA 3TKAA 3KKAA 2IOFA 4IOAQ 1FRJA 1FCAA 1S79A 1P27B 1Z2LA 1ZQ1C 3T1AA 2HHWA 1TKXA 2OMLA 2AYEA 2V2KA 4DQPA 2WW8A 3TX0A 2KSOB 3B54A 4Y00A 2YKNB 1BNOA 2RRNA 3RTVA 1PJ6A 4GFJA 3VVTA 4U7UD 1URJA 5SZTA 4ZVPB 3SFWA 1IBCB 4KAIA 3F2CA 4EPBC 2HNYA 3CE8A 9ICIA 3RRGA 2RSQA 4NRUA 2B21A 3EVOA 4USIA 2H3ZA 2W11A 2J0SD 4IG0A 3KLEA 2PLMA 4KJIA 5GTHU 3N5FA 5JMNA 2G09A 3QFHA 2ZH1A 2VJUA 1V51A 4QR1A 1FKOA 1NKCA 2PKEA 4KBIA 4ZA1A 3ICJA 4ANCA 2KFNA 1UPMB 1U8SA 2OI2A 1SB6A 2ZD1B 4USKA 2R8HA 1KQGB 4LIRA