4DEZA

Structure of msdpo4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
TKWVLHVDLDQFLASVELRRRPDLRGQPVIVGGSRKVVTCASYEAREFGVHAGMPLRAAARRCPDATFLPSDPAAYDEASEQVMGLLRDLGHPLEVWGWDEAYLGADLPDESDPVEVAERIRTVVAAETGLSCSVGISDNKQRAKVATGFAKPAGIYVLTEANWMTVMGDRPPDALWGVGPKTTKKLAAMGITTVADLAVTDPSVLTTAFGPSTGLWLLLLAKGGGDTEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PAD region in the mycobacterial DinB homologue MsPolIV exhibits positional heterogeneity.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords DNA polymerase IV 1
total genus 75
structure length 232
sequence length 238
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dezA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4dezA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dezA01
4C8KA 1UA1A 2R2UA 3FFIA 3IS9B 3QYYA 3UQ0A 4RPXA 5J0QA 1JLGA 4ELUA 4TQSA 4KLHA 1L3VA 4M94A 3CVKA 4NLOA 5CA7A 2XI2A 4I2PA 3H5XA 4RW6B 3GFKB 1JLEB 4MFBA 4WYLA 1PZNA 4KLMA 5C24B 3OJUA 3QLHB 3MFHA 3G86A 2BRKA 1JXEA 4EZ9A 4ECRA 1YVFA 1KLNA 2VA3A 4E0DA 4LZDA 4EEYA 1GX5A 8ICTA 5DBAA 2W9CA 2BGWA 4PPXA 2AX1A 4B3OB 4I2DA 1HNVA 2WB4A 1XS9D 3MEGA 4WZMA 3NTUA 7ICMA 4DF4A 3ZDDA 2C28A 4FBUA 3E2EA 4O44A 3NAHA 4QWAA 1LW0B 4MFCA 9ICHA 5DG9A 1NK0A 3QGGA 4DEZA 1TFRA 5KFOA 9ICNA 8ICOA 4G1QA 5F8GA 1HPZA 1IKYB 4K4YA 3DOLB 2IJFA 1NJZA 1C1BB 4ED0A 4ECYA 4B9TA 4KTQA 2AWZA 4Q45A 1BQMB 2IM0A 1WNEA 2AGQA 2RF2B 1NOMA 2W8LA 5J0RA 2Y1IA 1NJXA 2ZTCA 2P66A 3CJ4A 1OS5A 2BRLA 5DLGA 2UUTA 3PW2A 1Y88A 5KT2A 3RR7A 1C0UA 1QAIA 3KJVA 4DFJA 2FVCA 3HVTA 8ICSA 5DDMA 7ICRA 1U48A 3DI6A 2YKNB 3DMJA 4O4GB 1S6PA 3ZD9A 4B3OA 1JLCA 3PO5A 3KK1B 1HMVB 3DRPA 3ISDA 4KLTA 4F5QA 1Z3EB 4QZ9A 4PQUA 3PJWA 3V7JA 4RW9A 4PGQA 5KT3A 1LWFA 4FO6A 1ZQUA 4F4ZA 1ZQTA 2KFZA 1RTHA 4I2EA 1RAJA 4IR9A 3RAXA 4RPYA 2ATLA 4I2GA 2HNDB 2OWOA 7ICVA 3LALA 2IBKA 2RKIA 3DLEB 5C42B 3MFIA 2FPKA 3DRRA 3V6DB 1ZTWA 8ICEA 4Y2AA 3UR0A 4O0IA 3C5FA 1ZQNA 4DL4A 4J9KA 1BPZA 3UPFA 4ZVFA 5HP1B 2FJVA 3I5CA 4RT2A 3H4BA 1RT5A 2FVPA 3PW4A 3OGUA 3CJ5A 2HHXA 1NK8A 3NMAA 1MMLA 1C1CB 3FYHA 2ISPA 2GIRA 5KFTA 3V4IA 4QW9A 3OL7A 2ISOA 2R8GA 4LVSA 3TI0A 3OSNA 4I2FA 3PHEA 4TY8B 4I2QA 4ZVGA 4GXIA 4DQSA 2PFPA 4M6WA 2XCAA 1HYSB 1C7YA 4F50A 1VRUA 2JEIA 2WHOA 1RYSA 3PX6A 4JK1A 1NHUA 2KFNA 1SUQB 1ZQKA 1A76A 2XO7A 3V7KA 1S9EB 2YKMA 5KFIA 1S1UA 4ZPCA 4NXZA 3EYZA 5C24A 2FJXA 3CDEA 5KFQA 4IG3A 4ED3A 3Q8MA 3MDCA 1UT5A 3H4DA 4QWBA 1TVRB 4KFBA 4RQ0A 4MEXA 4K4TA 1FKOB 4PWDA 8ICYA 2W9MA 4B9MA 2VG5A 1KLMB 4DSEA 3SFGA 5J2CA 4NLPA 4NLNA 1IKXB 3AUOA 2F1IA 5IINA 8ICAA 3M8PB 3CJ3A 3DYAA 4KBIA 3DLKB 2ALZA 4RW4A 4NRTA 1C1CA 5F8LA 4J9LA 4Y34A 1D1UA 1T05B 4H4OB 2IM2A 5K14A 2XGQA 4XPCA 4YMOA 3IGNA 2W8KA 5J0OA 1W25A 1ZQQA 3KHHA 1SUQA 2OPQA 2HVHA 9ICEA 2W9BA 5CYMA 1HQUA 2C2RA 3OL9A 1S9GA 3MEDB 4DQQA 3RH5A 2QV6A 3BGRB 3K75D 4UAZA 3OLBA 1TQLA 4JV1A 2HAIA 4DFPA 2ZJAA 3HP6A 4GXKA 4UB5A 2VG6A 4K4SA 4NLZA 4KLOA 4R0EA 1X2IA 3RR8A 3Q8RB 3JSMA 1QAJA 4RW4B 1KSPA 4O4RA 1S1VB 3HVTB 5L1KA 2ZKUA 2FPLA 2W7OA 7ICNA 4DG1A 1JKHA 3D28A 1L5UA 1TVRA 4KFBB 3V6JA 2V0NA 3EZ5A 3H2LA 4PWDB 2XC9A 4UB2A 5HBMA 3DYAB 3G6XA 4IRKA 1N5YB 1S6QB 1TL3A 4F93B 2H5XA 1RTDB 3RB0A 2ILYA 1XO1A 1ZQXA 9ICLA 4M2YA 3I5BA 3HX0A 2F1HA 3G6YA 3HW8A 5KFNA 3NBPA 3AU2A 4M9HA 3PMNA 3MR3A 1X9SA 2KZMA 1TKXA 5I3UA 5CP2A 3UXNA 3DRSA 1KHWA 5CB1A 1S4FA 4J9PA 5J2MB 3T19A 3KLIB 3KLVA 2ZE2A 2NRXA 1HUOA 1DLOA 3GDXA 1ZQCA 4H4MB 9ICIA 3C6TA 7ICOA 4EBEA 1JLAB 2HHWA 2C22A 4RQ6A 4RQ2A 2P6UA 4IG0A 3HWTA 2B43A 2XI3A 3DOLA 2YNHA 5C5JA 2IJNA 5DQGA 5HMLA 1ZYQA 5J0TA 4TUQA 4URGA 1S1XB 5DQHA 2HNYA 3NL0A 2MUTB 1RTIA 3M8SA 4Q44A 4XA5A 3CDUA 4J9QA 4WE1A 5IIKA 4F4XA 2NRWA 4LSNB 9ICWA 2LYHA 1ZQOA 3KLEA 2AGOA 4RQ8A 3BQTA 1S48A 1REVA 4RW6A 1MU2B 4OL8A 4XRHA 1S77D 2B21A 2ZD1A 4O44B 3K4GA 3D5MA 5JUMA 3C6UA 3N6MA 4U6PA 8ICPA 3H5SA 3RJJA 2B5JA 3CWJA 2OPRA 1COOA 3BSAA 5J2MA 2ZE2B 2IMWP 2C2DA 5CHGA 4F91B 1FKPA 4YR3A 1NKCA 4Q43A 2IA6A 2E9RX 3T5JA 4ICLB 3EW9A 1NJWA 1ZQMA 2JZBB 3DLEA 3OHAA 1U4BA 4ECXA 4QZCA 1X9WA 7ICFA 4BWJA 2JC0A 4M04A 2BCRA 5KG3A 3OJSA 2Y1JA 3NKYA 1RT1B 1IKWA 3IS9A 5D46A 2W9AA 3QO9A 1T05A 5HMMA 3N4MB 3AU6A 2WOMB 4WXOA 5J2NB 4TUSA 1MU2A 2FPMA 2HWIA 4J9RA 3BSNA 2BPCA 2BCSA 2HHUA 3Q8LA 1L3SA 3KK3B 4ZH4A 5KTQA 1N6QB 4BXOA 4DSIA 2HHVA 2HW3A 1B22A 1RTJB 2B6AB 3MR6A 4DOCA 2O5DA 4NLKA 4IH7A 3HVWA 5I42A 4KLLA 3PX4A 1NK9A 1KTQA 1KFTA 1BQNA 5DDYA 2M9NA 3I0SA 2BQ3A 3KLFA 2IC3A 4JV2A 3CDWA 4YQWA 1RA6A 2FMSA 2A1JB 4X2BA 4XQ8A 3ETLA 1LW2B 5KT6A 2W9BB 4R66A 5KG4A 4IQXA 5L1LA 3T5KA 2FMPA 3DM2B 2HHSA 1S1TB 4RT3A 2R2RA 4K50A 4QZGA 5CWRA 4ECZA 5DB8A 3THVA 3KK2A 5DLFA 4MIBA 2BQUA 2D7SA 1RTJA 1TK8A 1KLMA 4YR2A 4QZIA 5J2NA 3M8PA 4XO0A 4R8UB 7ICGA 4I2JA 2OPPA 3QIPA 3KK3A 5EWEA 2WRMA 1X9MA 3E51A 4RQ1A 5HLFA 9ICJA 4ZP8A 3KLGA 2XCPA 3RRHA 3DMJB 5DBBA 1S6PB 4YXMA 2BQRA 1JLQB 9ICVA 4M47A 7ICKA 1DOQA 3DOKB 8ICQA 4DLGA 4C8OA 3QE9Y 5KFXA 5DKWA 4PHPA 4ELVA 3LAKA 4KV8B 1VRUB 4F2RA 2XWYA 1EP4A 1DTTB 4BDPA 4NCGA 3RJKA 1RT5B 4O3SA 4NM1A 4U7CA 1AROP 1V9PA 4O3NA 2OPSA 4LSLB 2C2EA 1L3UA 3KTQA 5BOLA 3H8SA 4DSFA 1S1TA 4NLRA 1C0TB 5IIOA 9ICQA 3CJ0A 2HHQA 1UWBB 4NLGA 1S49A 2UVRA 5F9NA 1QSYA 5T14A 8ICZA 3KK2B 3RJHA 3JPQA 2UVUA 2YKMB 1HUZA 3IG1B 4R8UA 3C23A 1XR7A 3KHLA 1JMSA 1ZQFA 4Y3CA 1J5OB 3JYTB 4TY9A 1TKDA 4CCHA 2OPPB 4I7FB 5DG7A 1T4GA 4K4WA 2HNYB 1JIHA 3QLHA 1SH3A 1KRPA 5KT5A 3C5GA 1JLCB 4JV0A 4B9UA 5DG8A 1NKEA 4ZHRA 3PJXA 5F9LA 4RW9B 1RPLA 3M8QB 4JUZA 2HVIA 5L1IA 2IM1A 3MEDA 3RB6A 1C0TA 1BQMA 1SL1A 2BCUA 4HKQA 1RT3A 2BDPA 4ELTA 2JC1A 5DB7A 5J2JA 1SV5B 4NLDA 5J0SA 3QO9B 2IM3A 5KFEA 3GYNA 2E9ZA 5CR0A 3EZUA 4R5PA 5C25B 3GV7B 1NK6A 3JPOA 4IKAA 4M9GA 3DI6B 3BJYA 1UT8A 4IRCA 4YR0A 3C1YA 1ZQVA 4DF8A 9ICAA 4P4MA 4M9NA 1RT6A 1T03A 8ICHA 5DBCA 3IM1A 4MFFA 4YMMA 4UB4A 1J5OA 1RT7B 4ECSA 4PGXA 1Z4UA 4YN4A 4I2AA 3Q8QB 4PUOA 5J2IA 4NLXA 5FDLB 2XGPA 1QLNA 2GIQA 4ZVHA 1N5YA 1XR6A 4XUSA 4IFVB 2B5JB 4KLGA 5C42A 3T1AA 4H4MA 1S1VA 3MTKA 5JXSA 2I5JA 4RNMA 3TAPA 3IGVA 4DSJA 8ICXA 1SH2A 4DSLA 9ICUA 2VG6B 5KFWA 4FS1A 5BPCA 4K4VA 4MF2A 2MUTA 4H54A 3V81A 4JWMA 1JLAA 1SKWA 3H59A 4MF8A 4F5PA 1D8YA 3VQSA 2QE5A 3C2LA 1S6QA 1TL3B 4LSNA 3ICLA 3JPNA 3DOKA 5J2PA 4H4OA 1ZQGA 1RT7A 4QWCA 1QE1B 4ECQA 4B9SA 1JLBA 4NLWA 3PW7A 7ICUA 3C6UB 3MECA 4I28A 4KHRA 3TAMB 4NY8A 2OPQB 1WCNA 1BPXA 5HLFB 1S9EA 1KHVA 4URQU 5KT4A 4URSA 4KLJA 2CJQA 1T3NA 1EETA 1XC9A 4RQ4A 7ICEA 5KFPA 1SH0A 4DL6A 1DLOB 4YCXA 8ICBA 4M6WB 3LK9A 3LAMA 4IQTA 2J6TA 1Z00B 8ICGA 4R64A 2RDIA 4NLQA 3DM2A 3BQ2A 1XU4A 5L1JA 3H8JA 3KLHB 4IFYB 2BE2B 2V4RA 2YNHB 3EPGA 3IRXA 5DGBA 5F8MA 2I1RA 3JYTA 4QW8A 1BPYA 1TKTA 1N4LA 4ZPBA 1LB2B 2V9WA 2R2SA 4DG1B 3I5AA 4LSLA 5DB9A 5HNKA 4QZBA 4TLRA 4DQPA 3TAMA 3RBDA 4RQ7A 4RW8B 1C1BA 5F8JA 2XY5A 3EWAA 2YKNA 5DB6A 1IKWB 5BOMA 4IDKB 2B6AA 3KLGB 4ZP7A 9ICTA 2R8JA 3BR9A 5J2PB 4QZAA 3BQ1A 1NK4A 2HWHA 4DL7A 7ICJA 3DDKA 5J2AA 5IIMA 2EC0A 4QZ8A 4PHDA 5I3UB 3RB3A 3H5YA 4TYAA 2DPIA 3KLFB 1SKSA 1QUVA 1S1WB 2P6RA 4FBTA 3M8RA 1RTHB 2F8EX 4ZVEA 1S0OA 3IRXB 3SFUA 1B43A 1DGSA 4DL2A 4YMEA 3PVXA 5KFFA 5CYQB 4DOAA 2GC8A 4DQIA 1TK0A 4J9OA 1FKPB 1SZPA 9ICSA 5KFVA 4DS4A 4QWEA 4PQUB 3OHBA 4I2BA 4KLFA 4DQRA 2BHNA 2FVRA 4KN7A 4RUAA 5KG0A 1S0NA 8ICWA 3DLGA 5IIIA 3GV5B 3KMSA 1BPEA 5J0PA 2KTQA 2DPJA 4TN2A 1HJPA 1RT4B 4O3QA 3ZDCA 3ISNC 2BCVA 2D41A 5I42B 4IH6A 3IG1A 5J0XA 1HARA 8ICKA 1ZETA 2YNIB 3DRSB 4RW8A 1BGXT 4WFXA 2BKEA 3MDAA 3I0RA 4C8MA 7ICQA 4J9SA 3M9MB 5J2QB 4WYWA 4RQ5A 3MABA 3LP0A 3BDPA 5KFCA 2PXIA 3RTVA 4KLSA 4I2HA 1T8EA 2R8IA 3KHGA 4KSEB 4TXSA 3NBPB 1ZJMA 2IC3B 4ZP9A 4ID5B 4LZGA 3Q8KA 5EDWA 1SV5A 3PR5B 2OH2A 7ICIA 3JPPA 5FDLA 3T3FA 1XR5A 1BPDA 1LW2A 4Q0BB 2ZUBA 5KG6A 2YNGB 1JLFA 4KHMA 1D9FA 4KITB 4I27A 5KFZA 1TKZA 5KFBA 1S76D 4RW7B 3KOAA 1S10A 3PY8A 4B9NA 4QZEA 4TUPA 3HPOA 1RT1A 2RF2A 4QWDA 2AX0A 1JN3A 4O4GA 4C8NA 2D3UA 5J2QA 5J0UA 4KO0A 1LWCB 2AU0A 1RT4A 1JLQA 2I9GA 1HNIB 4LQ3A 2IAJA 1ZQLA 4ZMMA 1LWEA 3JPSA 2YNFB 4NLUA 1D9DA 7ICSA 3I0RB 1ZJNA 3OL6A 4UB3A 1R0AA 1ZQAA 4ZP6A 1JLFB 5KFKA 3SI8A 4NYZA 1MQ3A 5HROA 2ZTEA 3C2KA 4QZDA 1Z00A 3NGDA 3Q8PB 1LV5A 1UWBA 5K14B 9ICPA 1S9GB 1TAQA 3UXPA 3IHQB 3TFSA 2WONA 1SKRA 2JEGA 5KFAA 3RBEA 4NZ0A 4YD1A 4UBCA 4ECWA 2HNZA 3FQLA 3MEEA 1LWCA 3MGHA 2OPRB 2ZTDA 1NK7A 4Q0BA 4DL3A 4KE5A 1RA7A 2BR0A 3RJFA 1CSJA 3H8WA 1KFDA 5F8HA 4MFAA 4KAIA 4ZPDA 4LQ9A 1NK5A 7ICTA 4PHAA 5KFSA 1U9LA 1JX4A 4F4KA 3ZD8A 1RT6B 2FVSA 1ZQWA 3GQCA 1ZQIA 1RTDA 4ECTA 3JPRA 3C2MA 3UDLA 4EO6A 4QPXA 3MBYA 4RNHA 1HNIA 4YG2A 4UQGA 3I0SB 3C21A 3V4IB 2E9TA 1JKHB 3RH4A 9ICKA 3OLAA 5CJ7A 4KKOA 3FRZA 2MAXA 4TY8A 3KNAA 3M9NB 1MC8A 4PH5A 4RU9A 5J2DA 5EWGA 3ISCA 4B9VA 5DQIA 1U09A 3LP2A 4I2IA 4M9JA 4G3IA 3N6LA 4WFYA 4KLUA 3CO9A 3LWLA 2I5JB 1HNVB 3ISND 1TKXB 4MH8A 4O9MA 2HNZB 4UAWA 5J0YA 3QEBZ 5KFDA 1S1WA 1SL0A 4RQ3A 2JLEA 3TVKA 3QZ8A 4KB7A 1T03B 1XWLA 3BSOA 3FFIB 3M9OB 1K1QA 5J2HA 4R5PB 1U45A 4JWNA 1ZQZA 2DFLA 4I29A 1TKTB 1L3TA 1S0VA 4IOBA 3ITHB 1FKOA 5TZVA 3PZPA 1QSLA 3FDSA 3V7LA 3T5HA 2BANA 1HQEB 2ILZA 5J1EB 3OSPA 5L9XA 1ZQYA 5EOZA 3QIDA 5D4BA 1TP7A 1DTQA 3LP0B 4EBCA 3T5LA 5J2GA 3KLEB 3LP2B 3MF5A 2HMIA 5KFYA 3PMLA 3GIIA 1C2PA 4EBDA 5KFMA 4O5CA 1C0UB 2AQ4A 4DWIA 2W7PA 4PHEA 5KFLA 1TVAA 1D8LA 2NRZA 2ZUCA 4Z6FA 4WE1B 4KKOB 1ZQDA 4Y2CA 2FMQA 3B0XA 4NLYA 4WFZA 1RT2A 4DO9A 1TV9A 3QZ7A 4EYHB 4RW7A 5CYQA 4GC7A 3V81B 3ITHA 4RPZA 1XSPA 4EO8A 4P4PA 4G1QB 1SL2A 5EUHA 2KZZA 4NLTA 5J0WA 5HHHA 1CUKA 5HBMB 2KZ3A 3GV8B 1ZQBA 5IILA 4TQRA 1EP4B 2IAJB 4DSKA 3ZDEA 3GILA 9ICRA 3NAIA 2YNGA 8ICUA 1HQEA 3LP1A 3KJVB 4IQVA 4EZ6A 3EPIA 4FS2A 3C1ZA 4KLEA 8ICVA 2PFNA 2BE2A 4F4WA 3H98A 4F5OA 3TQ1A 3H40A 1U47A 1CEZA 4RNOA 3TARA 3BQ0A 3C6TB 3KK1A 3OL8A 2FLLA 2WONB 4ED7A 2JEFA 4QZHA 4HYKA 5D3GB 9ICCA 1T7PA 2Q0ZX 4MIAA 4DOBA 3RJGA 2A1JA 2PI4A 1S1XA 1R0AB 2HNDA 2PFOA 2ASDA 4F8RA 3FQKA 1S0MA 4M0AA 1N48A 4YFKA 1QTMA 4QZFA 2R8KA 4O5EA 2BPGA 4B9LA 4RUCA 1IKXA 1LW0A 1HYSA 3RRGA 3H5UA 2WK4A 4M95A 3PX0A 1ZQHA 4DL5A 4UAYA 4F5NA 3BSCA 2ZD1B 1RTIB 2PI5A 1RXWA 3LP1B 5DGAA 2FLPA 4KLQA 4NM2A 5CYMB 3Q8SB 3LDAA 3DLGB 4YXJA 4DLEA 9ICMA 4K4HA 2JZBA 4NLVA 2VG7B 2R8HA 5D3GA 4KV8A 4F4YA 3TANA 4RNFA 2I1QA 2BCQA 1VRTA 1HMVA 5J29A 4F3OA 1BPBA 3ISBA 3LWMA 1K1SA 3GIJA 2ASJA 5HHIA 7ICHA 1ZQSA 2VA8A 9ICGA 4ZPAA 1NHVA 1ZQRA 1RXVA 5F8IA 2R2TA 1JXLA 4MKBA 5J2FA 4RNNA 3UPQA 3HVAA 2NRVA 5IIJA 1ZQEA 4NCGB 9ICXA 2KN7A 2J6UA 3PW0A 8ICRA 1XSLA 5KFHA 1JLBB 4ED2A 4TURA 3IN5A 1TL1B 1TKZB 4IH5A 4YD2A 4F2SA 1MQ2A 4DFKA 4K4ZA 5KFRA 1RDRA 2RDJA 4UB1A 7ICPA 4IDKA 1RZTA 4O3RA 8ICNA 2BANB 4X5VA 3ORYA 3E01A 3RB4A 3CIZA 4KO0B 3UQ2A 2CKWA 1DTQB 3TAQA 2RKIB 2ZJ5A 5D49A 3DRPB 3GIMA 1BQNB 8ICMA 1H38A 4O3PA 3N97B 3MECB 1RT3B 4IQUA 1BVSA 3V6KA 8ICCA 3MGIA 3TFRA 4GC6A 5F8NA 4IQWA 2FJWA 3RH6A 4TYBA 5C25A 5J2BA 4ZHRB 5KFGA 1IKYA 1IM4A 2AGPA 1TL1A 3JSMB 1TV6A 4R63A 1IKVA 4Q8FA 3HKWA 5HP1A 2D3ZA 2W9CB 4GLXA 4BWMA 4EYIB 1ZQJA 3V6HA 3QIPB 4I2QB 4IFYA 3QGHA 3V72A 4O3OA 3JPTA 4KMUA 4WXWA 1JLGB 4UBBA 4NRUA 1I6JA 4DFMA 4IRDA 2F1JA 5KFUA 3E01B 4I2CA 1TK5A 1RYRA 1TAUA 3MEEB 4IR1A 3RJEA 3ZDAA 1KFSA 4M9LA 5KG5A 8ICFA 1XSNA 1NKBA 1S9FA 2AJQA 4ID5A 4F5RA 2XY6A 1DTTA 2VG5B 4KLIA 3MR2A 3MR5A 3RJIA 4ED6A 4P4OA 3DLKA 4P2HA 2UUWA 5KG2A 2ZJ8A 3RAQA 4GXJA 3FSIA 3ZDBA 2WTFA 2NRTA 4ICLA 3BREA 1HPZB 3CJ2A 1N6QA 1IKVB 3HHKA 1S97A 1FK9B 4F92B 4ECUA 1KEJA 4Z6EA 3PW5A 3SV3A 1MSWD 4ED1A 1NNDA 2JEJA 3UQSA 1UA0A 2FLNA 2UVWA 3M8QA 1N56A 4MK7A 2VG7A 1LWFB 2WOMA 3HT3A 4I7FA 2YNFA 4K4GA 4BGDA 2YNIA 2ZUDA 2GWSA 4MK9A 4J9NA 2FVQA 4YMNA 4Z6DA 4BXOB 4YP3A 3SV4A 3LANA 2HMIB 4K4XA 3V6DA 3N6NA 7ICLA 4K4IA 1QE1A 5KG7A 3BGRA 4IG0B 3PO4A 3KHRA 1FK9A 2WCXA 4Z6CA 4WZQA 4O5KA 5J1EA 4YVZA 2ASLA 3PV8A 3GIKA 4DS5A 1RT2B 4IG3B 4MEYA 3KLHA 3KMQA 2IHNA 4C8LA 1EETB 3KLIA 8ICLA 4XPEA 1NJYA 1KDHA 1VRTB 5J2KA 1U49A 4KLDA 4KN4A 2V4QA 2HHTA 9ICBA 4RZRA 8ICIA 3G6VA 4Q8EA 2VANA 3H7IA 3DRRB 9ICFA 3QGIA 3UXOA 5KT7A 1GX6A 4J9MA 5KG1A 3PR4A 8ICJA 4ED8A 4PGYA 2VA2A 4MK8A 1D0EA 3PNCA 5HROB 5EWFA 3B0YA 2BPFA 3QEAZ 2UVVA 4I2PB 1JLEA 2XY7A 4MFBB 4NLSA 4PUOB 1ZTTA 4MKAA 2J6SA 4K4UA 3MEGB 5KFJA 3SYZA 5J2EA 1ZQPA 1EXNA 2OPSB 4IFVA 1LWEB 2IHMA 1S1UB 3SZ2A 1HQUB 1IXRA 1TV6B 5HP4A 2AQ0A 1REVB 4R65A 1WCLA 2PFQA 1A77A 4ECVA 1QSSA 1T94A 9ICOA
chains in the Genus database with same CATH superfamily
6AT1B 3LH2S 1BQXA 5AK5A 3UD3P 1QTNB 2YY3A 4A8QA 4FYXB 1IM6A 2WVEA 3A3PB 4NLOA 5CA7A 4I2PA 2RILA 4MFBA 1PZNA 2FVKA 1O51A 4KLMA 4LF8J 1FJCA 4P74A 1X4CA 3I28A 4R85A 3D2QA 3DN9A 5LJ3Y 2PFFB 2ZITA 4HL9A 1CULB 4E0DA 4N8NA 3TACB 2EANA 5ALQA 3M2RB 2BGWA 1FJEB 2LQBA 5LXYA 4JI1J 1XS9D 3MEGA 3EGVA 3NTUA 7ICMA 4FBUA 2CADA 2C28A 3G8TA 3UO0A 4MFCA 5DG9A 4LR7A 5THWA 3QGGA 3AD9C 4RWWA 1TFRA 3MTWA 1Q1KA 3FMWA 1S12A 4E2FB 4G1QA 5F8GA 1IKYB 2H4YB 2JXJA 1NJZA 4ECYA 4KTQA 2IM0A 1BQMB 3B82A 1NOMA 1KR4A 1OIAA 2E5LF 3HJVA 1OS5A 4L6V3 4NA2A 3HD1A 1RJPA 5DLGA 2UUTA 4DU7A 3PW2A 2R7UA 2NXJA 1UVLA 1C0UA 1R43A 5AKLA 4PABA 3N79A 4NWBA 5G4HC 3RAMA 3QRPA 3QYPA 1U0SA 2MKJA 1NPPA 2G0IA 3DI6A 4P0PA 2PMHA 1M7JA 1F2HA 2LU2A 2NXUA 4OJ5A 1QM9A 1DAXA 1JLCA 3PO5A 3WC0A 4OQJA 2LFVA 3DRPA 2P2CB 4USKA 2QYCA 3QXGA 5CZVA 2VF3A 1NJIT 3H2VE 5I4MA 1HW8A 4PGQA 5A6WA 2P9GA 1LWFA 1SV4A 3SDEA 2XHCA 1RTHA 1RAJA 5AM4A 4L74A 2HZVA 7ICVA 2IBOA 2IBKA 3PHTA 2RKIA 3DLEB 3SSQA 1F44A 1FERA 5H9EK 1FJGJ 3LA0A 3MM8A 1ZTWA 3CJ8A 4J9KA 1WORA 3HSDA 1BPZA 3WZ0A 2QARA 1RT5A 2FVPA 3PW4A 4J5OA 3OGUA 3SBMA 4I0WA 2O66A 2HHXA 1NK8A 2FJ6A 3FSYA 2GIRA 3FYHA 3TNVA 5AKJA 2I5HA 2MYFA 3O3LA 1HLWA 4LVSA 2HBKA 3FEXB 2NO4A 2MZTA 5ALPA 4ZOHC 4I2FA 1FT8A 3PHEA 2XMWA 4TY8B 1OPIA 3M8WA 2ZDOA 4C5YA 3KZIU 3MI7X 4F50A 1VRUA 4OLOA 4HR2A 1V6HA 3PX6A 3SAGA 2I2YA 1YJRA 3GE9A 5KFIA 3UW1A 4IG3A 5AI0A 2IY5B 3OQ2A 4ZA1A 4ED3A 3W65A 3H4DA 1JI7A 3OXFA 4MEXA 2CFXA 3G9CA 4PWDA 4G1PA 8ICYA 3H7HB 3SFGA 2OTJS 2F1IA 1UZDA 1HI0P 3CJ3A 3DYAA 2UU9F 2ZBPA 2RSQA 1J2VA 2RQKA 4Y6IA 4H4OB 2AHOB 2W2PP 2BJ1A 1P7DA 5ETNA 4DPYA 1W25A 4DX5A 3KHHA 2WAQC 2GIFA 4LH8A 4FPRA 2ZH1A 1G6BA 2GCFA 5SZTA 1Q7YT 2EFQA 2WVBA 4L76A 2L9NA 5JVHQ 3NVZA 2VBXA 4K59A 5U47A 2VJ5A 2F8KA 3MEDB 3RH5A 3NVWA 4UAZA 4JV1A 2HAIA 2YWEA 1RQNA 4K4SA 3B4MA 4KLOA 2X1AA 1X2IA 3RR8A 1NSKL 1XNRJ 2JVOA 2KO1A 4W98A 4I67A 2ZUGA 1U7LA 5F41A 4LRFA 4B3SF 3UWTA 4EEKA 2F9JA 3CCLS 2G1DA 4F93B 5AXLA 5JU5A 5GADI 2H5XA 2CWKA 4F71A 1Q79A 1ZQXA 3TQEA 2DRDA 4A4JA 4JI8J 2F1HA 2DXDA 4DV2J 1VHFA 1U6ZA 1X4BA 3J7A1 3AU2A 1UP1A 4C48A 3MR3A 2KZMA 3M6KA 3DNCA 3UXNA 4ZVOB 3I55S 5CB1A 4GVBB 4XAKA 1VQSA 2ADCA 2QKQA 4C60A 3PKYA 1AZSA 3MOJB 2WVFA 3KLVA 1DJ0A 2ZE2A 5I3PA 1DLOA 2MY8A 1NCLA 3QFHA 4EBEA 3KDNA 2HHWA 5A76A 1KP6A 1VQ8S 1Q0NA 1AXQA 2YNHA 1W26A 2Z4PA 1KKHA 2W4CA 2YQEA 1ZYQA 4URGA 2HNYA 2MUTB 3NS1A 2EPIA 3M8SA 4OX8A 3ULHA 2WW4A 2G5HB 2XS2A 2I8EA 4J9QA 2DNRA 3SEOA 1WELA 2ZH4A 1NDLA 4F4XA 4O3MA 2V8HA 2CA9A 3GCXP 4B17A 4DUZJ 3UE2A 2RU9A 4EX6A 2LYHA 2LKZA 3IP0A 2KHVA 2AGOA 4LUBA 3BQTA 1S48A 2R7VA 5E2QA 2C3OA 4AYBF 5CD4A 2KJWA 2YTCA 5HI7A 4HVZA 3N6MA 5ETSA 2RQCA 4UAVA 4N47A 4OI0A 1COOA 3W2VB 3BSAA 5H9EJ 1RI7A 3DXSX 2H54B 4X62J 3ZZTA 2XM3A 1FKPA 4P0QB 4Q43A 5HMEA 4ICLB 3F56A 1NJWA 1RUSA 3ZNJ1 1MROB 1U4BA 4ECXA 1X9WA 3QAEA 4BWJA 4M04A 4WGXA 1RJJA 5KG3A 2UXBJ 3NKYA 5KL8B 3K58A 3O5TB 1T05A 2WOMB 4WXOA 3AU6A 5LSLA 5J2NB 2FPMA 3LYSA 3VC8A 1NXIA 4K5SA 1T95A 4F0KA 4JYAJ 3VGVA 1YSJA 1WACA 2UUBF 3FC4A 2EZXA 1PIEA 4PL1A 2J7WA 3H25A 2UZ9A 1UEKA 4Y2VA 2XG8A 1AFIA 2HHVA 5B66U 1RDFA 5ALGA 2B6AB 4DOCA 1ZM4A 4ZN3A 4NLKA 3HVWA 1I5OB 3BS5B 1KTQA 3F5EA 3NS6A 3KFWX 4CM0A 1X4FA 4YQWA 5DDRC 3R2CJ 1LOUA 3W64A 1VRQC 1FD8A 4XQ8A 1LW2B 2CG8A 2CPDA 4CLSA 5KT6A 4R66A 5KG4A 1FJ7A 3OW2R 1ZA1B 1Q3VA 3IWNC 1IBKJ 4K50A 2HQIA 4OHYA 3OTEA 4DN0A 1HR0J 2D7SA 3L7PA 4WF9Q 3OTOF 1V4YA 3CF5Q 4BLGA 2V8VA 4YR2A 2HKEA 4CWBA 3CCMS 1TL7A 1A0PA 2MSSA 3M8PA 1FWBC 3WX8A 3CDAA 1S7HA 5B0AA 2M8DB 3T8LA 3E51A 3J81Y 4RQ1A 2AIRB 4YY3F 9ICJA 4ZP8A 2Y0SC 3CJRA 3RRHA 3DMJB 3THTA 2Q66A 4DX6A 4P2XA 5DBBA 1S6PB 3UNYA 4C97A 4C4WA 1NZAA 4M47A 1DOQA 3ZTRA 2K3KA 3KNGA 1ULRA 3CGIA 8ICQA 2XQCA 2HHHJ 4DLGA 3LS9A 5KFXA 4C2MA 4PHPA 4ELVA 1VRUB 3BKUA 4F2RA 4B3SJ 1OY8A 1EP4A 3WKEA 1JJHA 3RJKA 1PUZA 1YBUA 1A6LA 1GXLA 2W04A 1FIQA 2R42A 2WF6A 3H8SA 4DSFA 4LFAJ 3HT0A 3B54A 4NLRA 2DGZA 3HDSA 5IIOA 1VC6A 2HHQA 1UWBB 1X60A 2VODA 3WX4A 5F9NA 2RRNA 2Q4TA 5T14A 8ICZA 1WF1A 1XEZA 3NRZA 3M2RA 2KXNB 2J0XA 3IG1B 4R8UA 3K8WA 1JMSA 1J5OB 2HEKA 2M5YA 2MQLA 2OPPB 3AMZA 4KPCA 2UUCF 2OHDA 2AXTU 3AM9A 4C4RA 5LSOA 4DCOB 4N7TA 3M1VA 4B9UA 2UXDJ 2A10A 5A2QY 4RW9B 5CQGA 1RPLA 3R6LB 2QS8A 3MEDA 1E6VA 2D3DA 2BJ9A 3G2XA 1BQMA 2BCUA 4BUGA 3M2VA 5IT9Y 3CJKA 2JC1A 1M0SA 2GGPA 4NLDA 4GO5X 4UUXA 4NL9C 2RRBA 2F65A 2IM3A 4RBVA 3JB9k 1DRGA 3NMRA 1CBKA 2E9ZA 2NLWA 3C46A 1NSAA 3JPOA 1FI4A 3EICA 4M9GA 3DI6B 2GX8A 1A6SA 3I9ZA 2L08A 4C3LA 1ZQVA 4ZJQA 1HQ2A 2OP5A 2DNMA 2ZXHA 1ZAXA 1RT6A 4USAA 2J8AA 2RUSA 4LF1A 3MAAA 3IM1A 2GFFA 4MFFA 1RT7B 4ECSA 2ODGA 3B6BA 4YN4A 4CEXC 2BKPA 4GKKF 3MDFA 5HANA 4NLXA 3UBPC 2W24A 4G7EA 2XGPA 1QLNA 2V4JB 2M3DA 3IO1A 2H3FA 2ZUAA 4HAIA 3CC2S 2YQ1A 3OFGA 1RCOB 4NEZA 2EEYA 3A8JA 1S3TC 3M30B 3MTKA 4HT5A 2GW8A 3SQGA 2MZ1A 5JXSA 2AEFA 1O12A 8RUCA 1X0FA 5KFWA 2U2FA 4FS1A 3BB5A 2ZBCA 4K4VA 1IV8A 2BACA 2QYGA 3MPWA 2FHMA 2MUTA 2QLFB 5ETLA 3L3FX 3H59A 4NXMF 1D8YA 2IOFA 3MD1A 2DBBA 3R7SB 2QE5A 5BYSA 3FC9A 4WFAQ 4CDGA 4ICAA 3DOKA 2MLZA 3M30A 1ZA2B 4C98A 1J6PA 3MM9A 1UMJA 3PW7A 5ETRA 3H0PA 5CCMA 5HLFB 4URSA 3W2VA 3RRKA 2VFVA 2KE7A 1T3NA 3SEIA 1EETA 2JHDA 3O2IA 1IBLF 1KN6A 3KBBA 3R27A 4P6QA 7ICEA 3JQJA 3QJJA 5IS2A 2XYGB 3LK9A 2J6TA 1Z00B 2G0AA 8ICGA 4U8YA 4NLQA 4JI2J 3FGVA 3DM2A 4MJKA 2FD2A 5ALUA 3QFWA 5DRKA 2BE2B 2V4RA 1R7IA 3P96A 1KCXA 1WWUA 4F0RA 1WUUA 1N4LA 4OHXA 3IA0A 4LSLA 3MM9B 2Z57B 3DHXA 3Q0AA 4RDWA 4YIWA 4TLRA 3EGNA 4RQ7A 1WOSA 2EK1A 1U1QA 2YKNA 3M6ZA 2FHJA 5DB6A 5BOMA 2WBMA 2B6AA 3KLGB 5FD1A 2QFIA 4ZP7A 1RGVA 9ICTA 1KBUA 2R8JA 4QZAA 2FLOA 1NK4A 2HWHA 4DL7A 2NREA 1D09B 5J2AA 5IIMA 1SKSA 4QR2A 1VLYA 2CXYA 2E1MC 4DYKA 1T9YA 4RZBA 4FZVA 5DZ6A 2LYVA 1B43A 1DGSA 4DL2A 3D6NA 4YMEA 4DR5F 4DOAA 4OX9F 3NNHA 2O01C 4ZS6A 4DQIA 2WB1C 3M6VA 1PJ6A 1PC5A 5HQ8A 9ICSA 3HD2A 3UN5A 2BKNA 3EDRB 4AT1B 4ZPVR 2COLA 4I2BA 3J7YU 2BHNA 2FVRA 8ICWA 2HK3A 4KQNA 2QZ8A 2KTQA 1TL7B 2RRDA 3D2NA 5I42B 2MQQA 5J0XA 8ICKA 1MWYA 3IV6A 2QL9B 1SWVA 1TUVA 4RW8A 4WFXA 2BKEA 2EKYA 4MTPA 3GIPA 2ZOMA 2DNLA 7ICQA 1MWZA 1CQNA 2H51B 5JVGQ 3AQFA 1X4HA 5G5HA 3HILA 3NBPB 4ZP9A 4LZGA 2GJIA 3BPDA 2HSZA 1XN9A 2ZBQA 2WB1F 2L5YA 4Z37A 4UARA 1VQNS 1BPDA 5BYQA 3NY0A 4ES1A 4HHUA 2WW8A 4KT0C 4KITB 4WPAA 1GAOA 1ITPA 4B9NA 3HPOA 3G8QA 1RT1A 4CNTA 1RHQB 4WP9A 2OOFA 1M1HA 3ENWA 1FDDA 1ZAVA 4LIWA 5AKHA 4KO0A 3WQPA 2K8GA 1RT4A 3GFHA 1FNOA 4EFAC 3TX8A 2BMBA 5FSEC 1FRIA 2NSCA 1JUDA 3HPAA 2YNFB 5A8WA 4NWIA 2Y0SF 1KS2A 1NZ8A 1XIQA 4QOTA 3UFCX 1RHJB 2MDAA 4Q2LA 3A1YG 2PMWA 5GTHU 1R8CA 1VBZA 2ZTEA 3C2KA 3CCVS 2YBVA 2XZDB 5D77A 4QIGA 1LV5A 5K14B 9ICPA 2JDJA 3TFSA 5KFAA 3QU7A 4LF7F 5ALDA 3R9KA 4NZ0A 2HNZA 4DUYJ 3SD7A 3VAJA 3MGHA 2OPRB 2ZTDA 2KIWA 3H8MA 3PTWA 4Y2MA 1OUQA 1Z2LA 5HMDA 2OD4A 4OYAA 1FNMA 4MFAA 4QNLA 3Q89A 1R9YA 7ICTA 1N0UA 3I9V9 3N7RC 1RSCA 4F4KA 2Z00A 1RT6B 1EJVC 3QJLA 2ROPA 4FXDA 2MHNA 1SCJB 2FVSA 3MAAB 1ZQWA 2B9EA 3JPRA 2P9CA 1KQGB 4QPXA 3MBYA 1RWVB 2V5HG 2HLTA 5ETPA 4YG2A 2CNNB 2NCKL 1LXJA 3KKAA 2W43A 1B4SA 4ATNA 5L38A 3S7RA 3FMBA 3KOOA 3L7UA 2MAXA 1Q8IA 2C3MA 4TY8A 3MAHA 2E7VA 3DLHA 2VC0A 2KOBA 4RU9A 2YKOA 5J2DA 5EWGA 2CQIA 5H9FJ 1U0HB 2V2QA 3J80Y 5DQIA 4I2IA 3N6LA 4LREA 1EF2A 2YMPA 2Z2ZA 3D9BA 1TKXB 2V8PA 4MH8A 5J0YA 5KFDA 1S1WA 3M05A 4U95A 2JSXA 3TVKA 1BWVA 3CCTA 3NGRA 2ZHAA 1N36J 1T03B 1FWKA 1XWLA 2JJ4D 4LR8A 2LXIA 3BSOA 1K1QA 4UATA 5J2HA 4JWNA 2DFLA 5TZVA 5BR8J 2HOQA 2BANA 3M1YA 1G2EA 4H4KC 3OSPA 1EJ7L 1RTZA 5D4BA 4NXNF 2RNEA 1F9FA 3E0LA 2NPIA 4UOCA 1J97A 4FYVB 5J2GA 4RLEA 3MF5A 2HQDA 2QT3A 1H6KX 4EBDA 2V8DA 3KFUF 2H48B 2FHJD 4M5KA 2W7PA 5DS7A 2ZUCA 4Z6FA 1QD1A 4KKOB 1ZQDA 4Y2CA 3RN6A 3B0XA 4WFZA 3IR5B 1R8AA 2DH9A 1X5SA 3W5ZA 4ILLA 2X7IA 3V81B 3GGMA 2L9WA 4V1Ak 1XSPA 4G1QB 4JB3A 3IM9A 2KZZA 3TZZA 5J0WA 2GQQA 1Z1ZA 2KZ3A 1FFUA 5IILA 4TQRA 3FZBA 1N52B 5ETOA 5K9FA 1FA0A 3ZDEA 1H98A 3NAIA 2FI1A 3ILIA 1S72S 1NSPA 4B3TJ 3EPIA 4GKJJ 1UWAA 2BE2A 4F5OA 1PJ5A 4D3HA 2JOQA 2CJ9A 2KT2A 3C6TB 4E8UA 2WONB 4PPZA 4QZHA 1JB0C 3R7NB 2WSCC 2F44A 5E3CA 2QLJB 4CLTA 1EKSA 1RAOA 2PI4A 4Q2MA 1S1XA 5ETVA 4F8RA 1FX4A 8AT1B 2MKCA 2GVDA 4QZFA 2J0QD 4QYRA 1AYEA 4JI1F 1ACMB 1LW0A 1HYSA 2WZ1A 3RRGA 5D4LA 4WIQA 2WK4A 2C2MB 4KGXB 3P6YC 4RX6A 1T9VA 4F25A 3CMES 4HI1A 3BSCA 3PDNA 4ZPTR 3LP1B 2P8IA 1RG6A 4DN9A 1BE4A 1FCAA 3A3NB 4DUYF 2FZGB 2DIVA 1WTBA 4YXJA 2XMTA 2HS3A 2HZCA 2C2ZB 4FDFA 2UBPC 3WDOA 4NLVA 4LSZB 2VG7B 2R8HA 1HHQA 1XTZA 4CRJA 2RIJA 3VAGA 4UOFA 4LBPA 3QWUA 2I1QA 2BCQA 1VRTA 3AXMA 1HMVA 3FSXA 4F3OA 1BPBA 1RACB 4PXDA 3GIJA 1DZ5A 5HHIA 1RKIA 2OFGX 4ZPAA 1M5KC 4UW2A 3FCVA 3VGSA 4RNNA 3HVAA 1EKRA 3I96A 2AQVA 1M5HA 2IPOB 2KN7A 2GOKA 2EI5A 3DOMA 1XSLA 5KFHA 2EAMA 4TURA 3D6TB 1TL1B 2A18A 2DKOB 4AXIA 4OYOA 1MQ2A 1OYEA 4PYAA 4G1IA 4P71A 1SC1B 1S6OA 4UB1A 3CNQP 3ZZZA 4X5VA 2AKWB 3HSJA 3T9NA 3E01A 3N28A 4KIRA 5CAAA 4KO0B 3PXGa 1CJVB 1FKAF 4X64J 4M5IA 2VKRA 3QUQA 1RABB 2K8CB 5L8RC 1NM2A 2V8GA 3VGUA 4LR9A 3MECB 4IQUA 1BVSA 2Q3PA 2P9EA 2F8HA 3VV2B 2CDRB 4GC6A 3AT1B 5F8NA 4IQWA 3K1ZA 5A0LA 3RH6A 3MCNA 3NCPA 4ZHRB 3BDEA 1IKYA 2OYYA 1IM4A 1TL1A 1HWLA 2CPRA 2QA4G 4CLZA 1Q5VA 3DCAA 2B51A 1GH8A 5HL7Q 3QT7A 1LKYA 2EWHA 3HKWA 2DNGA 4I2QB 4IFYA 4O3OA 5EE0A 4KMUA 4WXWA 2WB1D 1IR2A 4UBBA 2KJVA 2N4DA 1KBRA 5GAGU 1TUGB 1I6JA 5KAFU 1FHTA 5DETA 4IRDA 2F1JA 5KFUA 1TK5A 5DM6Q 2HPUA 1TAUA 1RHMB 3MEEB 4IR1A 3TVYA 4BHQA 2RS8A 3BPSP 8ICFA 2MKSA 2W7AA 5B0DA 5T7LB 2H3VA 4LBHA 1S9FA 4AQYF 2EQYA 3NS5A 2E8OA 3SQIA 1VIXA 4PZNA 2E8NA 5JMNA 2KJ8A 1B3TA 1NMEB 1EJRC 3RJIA 3HZGA 1Q86T 3G71S 4C4SA 2Z2YB 4KYZA 4DV7J 3JAMU 3BS7A 2WTFA 2JLFA 2JH3A 2CJXB 2JNJA 3BREA 3HM9A 1S97A 1FK9B 4ECUA 1FXRA 3SV3A 3ET6A 1MLAA 1UA0A 4DL0C 1V9OA 1WJ9A 4I7FA 1YZ6A 4JI6F 3OFHA 1FRJA 4YFUA 4NA3A 1DGJA 2K89A 5C2GA 2KJ5A 4YMNA 5J8YA 1Y3KA 3SV4A 3WBZA 4K4XA 2JFDA 4ZVQB 4K4IA 2KVQE 5HQLA 1TZ0A 3VGTA 4IG0B 1FK9A 3EMTA 3R2DJ 2WCXA 4WZQA 4FVMA 1WDTA 4GBDA 1YJ7A 2A1BA 2A2CA 3OR2B 3GIKA 4DS5A 1S7IA 4IG3B 1QCKA 4ZCMA 1K8AT 2UUAF 2A0FB 1YBQB 1BMQB 1NJYA 4AE5A 2HHTA 9ICBA 3G6VA 1SJ1A 2EAOA 2YWKA 2C2KB 1HBNB 3MM8B 3U26A 9ICFA 3ED5A 1GX6A 5KG1A 3PR4A 2AV5A 8ICJA 2R3VA 3QUCA 4PG7A 1U8WA 2FB0A 1D0EA 4HHHA 3PNCA 3W2WA 3D7SB 1L7NA 3QEAZ 1JLEA 2XY7A 2QX0A 3UM9A 2OEMA 2VKQA 3OXGA 2BE7D 1X5PA 4USWA 4K7QA 2OPSB 1B0PA 4R25A 2JZ5A 3MMBA 1S1UB 5LM7E 2W2OP 1VK8A 3CCWA 4QCLA 1TV6B 4CRXA 3D67A 5HP4A 2K3IA 3ONNA 2FDRA 1REVB 3TA1A 4I6YA 1QSSA 3DLLQ 4C8KA 2LI6A 5ALRA 4K2XA 2R2UA 3FFIA 1EB0A 2KSOA 3IS9B 3QYYA 2G09A 4RPXA 1JLGA 3SFWA 4KLHA 2LEPA 1L3VA 3EJMA 2E5SA 2W2NP 3CVKA 4CH0S 4X64F 1C4AA 3VAHA 2IRXA 3GFKB 1JLEB 2F63A 1T02A 4WYLA 2DNZA 3QLHB 5D0RA 1U1MA 1PJ7A 1PO6A 3GR0A 3BH6B 1YVFA 1KLNA 3C2PA 2VA3A 2MGZA 1Y00A 8ICTA 3CJTA 3D3BJ 2I6WA 5DBAA 2W9CA 2NS1B 1NUEA 4AYBD 2AX1A 2W01A 2MEWA 4WZMA 2E3TA 4O44A 1JJCB 4ZVTB 1SJQA 2CQCA 3VTIA 5CYJA 4OHWA 1VBYA 3CC4S 3P49B 3GJRB 2B7CB 2KXFA 3LW5C 1SC6A 2ZC4A 4USTA 1SIWB 9ICNA 2DHSA 1HPZA 5AI8A 1AUSL 5KAKA 4MKYA 1ZD5A 3VWSA 1N8RT 3GG1A 1SZHA 4B9TA 3EUB2 1EQ0A 2V69A 2AGQA 2RF2B 1VJWA 5IFMA 2MGZB 3CJ4A 2PT0A 2POKA 2CRLA 5LJ5Y 1KVJA 2VD3A 4ZITA 5KT2A 3Q8YA 3RR7A 1QAIA 2MJNA 4DV6J 1LEOA 1XERA 4DFJA 5GAEU 5HATA 5DDMA 4NA1A 1U48A 4P2FA 1NO8A 3R1HA 3PSFA 1J5EJ 1U26A 3AFGA 4RWXA 4B3OA 4UOHA 4QIFA 1D9AA 3ISDA 4LFBF 4DR3J 2ZIVB 4RW9A 3V7JA 1T11A 2VKZG 4FO6A 2E8PA 1PCAA 3CD6S 3MPUB 1ZQUA 2KFZA 4IR9A 1WHXA 5B0GA 3DGPB 2RQ5A 4IUFA 2ATLA 1R3NA 3RFAA 2G2YA 2OUGA 4KH1B 1IJFB 3W7BA 2Y9UA 1Y3JA 2B9WA 5C42B 2K7KA 4JI6J 3ETMA 2FPKA 2EFNA 8ICEA 4OZ1A 2HHHF 1P1TA 3GU3A 1KONA 2EXUA 1ZQNA 3T81A 4YOEA 4ZVFA 2FJVA 1FEEA 1FEZA 1P8GA 4PWUA 2ZIXB 1O03A 1MMLA 2B8QA 6FD1A 4FZMA 1FE0A 3V4IA 3FAHA 4LFAF 3D0IE 3RU0A 3H2UB 2OODA 3OSNA 2AYBA 2KN4A 3CNHA 4I2QA 4ZVGA 1R89A 4GXIA 2M4MA 3UR3C 3MAQA 1DRZA 3T1YJ 1HA1A 2AP6A 2VDIA 2KHQA 1HYSB 1RJRA 3RG6A 2M9KA 4IOCQ 1RYSA 1ZS6A 1SUQB 1FWHC 3W3SA 1ZQKA 1A76A 2QRRA 4JP8A 2XO7A 4XK8C 2YKMA 5HR7A 4KC5A 4RUHA 4N56A 4V1YA 4NXZA 5C24A 4CH1A 3DHWC 1ZD4A 2HQ3A 2HGLA 3Q8MA 2WAQF 3W1YC 2HFZA 1TVRB 4USJC 3AB4B 4ILRA 1PBUA 1IKXB 3AUOA 5IINA 8ICAA 3M8PB 4KBIA 3U1LA 3QGAC 2ALZA 1FFVA 4C4TA 2YKQA 4FZLA 3O0FA 5F8LA 4J9LA 4Y34A 1T05B 1SB6A 2DH7A 1R0BG 3Q8VA 4C7QA 5AE1A 2V2ZA 3IGNA 3PYGA 1SUQA 1NNLA 2DO0A 3X3UA 1QH9A 3Q22A 4Q5VA 2KVCA 4JI5F 2EZZA 3S01A 1NU4A 2W03A 4IQMA 4XTTA 1YWXA 4HTIA 1TQLA 4DFPA 2ZJAA 4K0KF 1AQ6A 5HVHA 2VG6A 4DOZA 4DCPB 1VQ6S 2QSFA 3C3LA 2JHEA 1YMYA 1FWPA 4NL9A 3FUYA 1S1VB 1MNEA 3HVTB 2FPLA 1IJEB 5B0FA 2W7OA 7ICNA 2QLWA 1JKHA 3D28A 1L5UA 5FP0A 3LSBA 3OV7A 4PWDB 2ZNZA 4CE6A 1S6QB 2PGCA 4WK1A 1RHKB 3F2BA 1RTDB 1SXEA 2HFNA 2AEJA 1GKRA 2BB0A 9ICLA 4M2YA 3O6QA 4M5JA 4IO1A 4M9HA 3IRWP 4HACB 4B3MJ 1KRAC 4ZN1A 3DRSA 2AYMA 2VUNA 3OTDA 2IOHA 1S4FA 2WSFC 5E3PA 3T19A 3KLIB 3AOAA 4X65J 2SXLA 2NRXA 2P9BA 1HUOA 3GDXA 4H4MB 4OJ1A 7ICOA 3ETRA 5RUBA 1LKYB 1QQ6A 2B43A 3CW2C 3DOLA 1KTVA 4C5ZA 2OIHA 3R7BB 3FKBA 5HMLA 1PK1A 1R6VA 5D6GA 1DQAA 3HMJG 1VBKA 1N5WA 3VZHA 5DQHA 1HD0A 2XHWA 2IFXA 1RTIA 4Q44A 1H7WA 4DR1F 1X4DA 2VU5A 4J90A 2HVEA 3T1HJ 5IIKA 2KSOB 3K5LA 2OKQA 4QIEA 2ZEJA 2NRWA 1SV0C 4P73A 1UFKA 4LSNB 4FKYA 1PYOB 9ICWA 1UVJA 3WC2A 1ZQOA 1NZPA 1Y7PA 3MURP 1S77D 2Q6BA 4O44B 3K4GA 3N7SC 3D5MA 3L9ZA 4DX8H 8ICPA 3BGFA 1CJTA 2P50A 3RJJA 1WG5A 1N5TA 2JH1A 1N5VA 1CVJA 4CO5A 5CHGA 4UOGA 1Q3UA 3JQMA 2IA6A 3T5JA 2VJVA 3BR8A 1ZQMA 4DV2F 2JZBB 4Y2YA 4QZCA 7ICFA 5CHCB 5AXMA 3DKDA 3PEHA 3OJSA 1RT1B 1DQ9A 2JH7A 1PVPA 4ACOA 5D46A 2FC9A 4ZIWA 4OYMA 5HMMA 1VS3A 3WHIA 3I4HX 3R5JB 4M5NA 3QUTA 3BSNA 3AQPA 2BPCA 3Q2TC 4I68A 2VONA 1Y4ZB 2VIHA 2F9DA 3EM1A 2VBWA 3DGVA 3MR6A 4IH7A 2EG2A 1NK9A 1FWCC 2GH1A 1B0XA 2IC3A 1FVSA 5CEHA 1UCNA 4PG4A 4DR7J 4JV2A 1RA6A 4RL1A 2FMSA 5M2UA 5E0OA 4DUZF 5HMZA 2DY9A 3MGVA 2GVDB 3SCIE 4IQXA 3T5KA 1GMWA 1M5VC 3CO0P 1FRKA 4AFFA 1U1KA 3UMCA 3DM2B 2QGFB 4I4BA 4QZGA 5CWRA 5AK3A 2VOPA 5DB8A 1R8HA 3LGNA 1JNZB 3OVBA 5B09A 2VZ9A 3NOCA 1KD1T 1TK8A 1KLMA 3TZWA 3TZYA 3GYXB 2YKAA 1RBOB 4QZIA 5J2NA 2GWNA 2DY1A 7ICGA 4I2JA 3QIPA 4USIA 3N5FA 4NV0A 1RQ0A 2KL8A 3KK3A 3I1YA 3KG1A 1X9MA 3PIOQ 1SB3C 2DNNA 4QR0A 2PD1A 3MCOA 3KLGA 1WI6A 1HBMA 3LGMA 3E8OA 1NLKL 2L41A 4YXMA 2VHLA 2HVZA 2Y0SD 2MKHA 9ICVA 1A7GE 3DOKB 2WF8A 4C8OA 1X42A 5AXNA 1GKQA 1FRHA 3QU2A 1OSCA 1GFWB 1RAFB 4MAKA 2Q1LA 2GVZA 3HHLB 1DXSA 4ZCIA 4BDPA 3GTYX 2DHGA 2PLMA 4U7CA 1RT5B 1AROP 1B99A 1V9PA 2HFOA 4ANCA 3HFKA 2C2EA 3KTQA 3HI9A 5BOLA 2KFYA 3R1LA 1FWDC 2CQGA 1S1TA 3IDWA 3UCZP 9ICQA 2E1AA 3CJ0A 2FVMA 3IG5A 4B3RJ 1S49A 2UVRA 5ALFA 2X3DA 3M32B 3JPQA 2UVUA 2YKMB 2DCLA 1HUZA 4U7UD 2DH8A 5L1MA 1TKDA 4ZLJA 3UVJA 1T4GA 2HNYB 2F40A 2KP7A 2I6XA 5F3TA 4M5DA 1KRPA 2P35A 3C5GA 2RVJA 4JV0A 4V1XA 1NKEA 4LF2A 3PJXA 4OI6A 2UV8G 4JUZA 5L1IA 4DR1J 3L5KA 1HI1A 2BDPA 5DB7A 4LIRA 4PXBA 1FFSB 4YY3J 2WBRA 4ED5A 3QO9B 5B0CA 4R5PA 5C25B 2QLBB 1Y10A 5DJBA 4IKAA 3VCBA 3JSYA 2V68A 2ZIUB 4WFBQ 4A46A 2GHWA 1UT8A 1Y5IB 3TA0A 3C1YA 4M9NA 5AIBA 3ZTSA 1PILA 5DBCA 3HHDA 2K60A 1J5OA 3NVYA 2HRTA 4WU2A 1DK3A 4DPUA 3ISZA 1WG8A 4Y2TA 4I2AA 3Q8QB 4PUOA 4AYBC 3MM7A 2DT9A 1R6YA 4LMZA 5G5GA 5BR8F 3OFEA 4BX9C 3HSGA 4IFVB 1G4CA 2B5JB 4NXNJ 4KLGA 5C42A 3T1AA 1NBEB 4H4MA 2Y9TA 2YH0A 4DXLA 3T41A 2AH5A 4X4UA 2XTJP 2W2MP 1L6NA 4RNMA 3TAPA 1N34J 3CJKB 4X4SA 3EGZA 2HBRB 4OYWA 3G8SA 2E7WA 1FTCA 3MM6A 2VPYB 5BPCA 2DR8A 1Y5LB 4MF2A 4LBIA 1RLDA 3F41A 2EZYA 2A2DA 2KH9A 5K20B 4GRSA 3I82A 1RU2A 3QQCD 2LDYA 1SKWA 3OVAA 3MM7B 2OELA 4DR7F 5K8OA 3BBCA 1N5SA 3VQSA 3C2LA 4MYTA 4UW9A 1COKA 1TL3B 4LSNA 1WOOA 3JPNA 5J2PA 1YITS 1ZQGA 2XZWA 2K7JA 1QE1B 4ECQA 2VV5A 4NLWA 3JTNA 5JJBA 4I28A 4PG6A 2MY7A 5AT1B 1V38A 2OPQB 3AHPA 2DWQA 2J9EA 1BPXA 4ENOA 2HBJA 2DR6A 4J9UE 2VDHA 4P7VA 5SUHA 1C4CA 4GKJF 4UTGA 2OTLS 1QJHA 4QIWF 1SH0A 2VASA 1F3VA 4YCXA 8ICBA 4YUDA 4M6WB 3LAMA 4IQTA 2FGOA 3N2CA 4GKKJ 5L1JA 3H8JA 2W55A 1RBLA 3IRXA 3US5A 2K8AA 5DGBA 3OXLA 5IC6B 5AM5A 2M70A 3B78A 2FQQB 3ZZ0A 1LB2B 2V9WA 1SIZA 4DG1B 3QBCA 3I5AA 3DU5A 2GO7A 3JAMY 1KEKA 5HNKA 3CIMA 3TOQA 3K7RA 3OBIA 3HZEA 4DQPA 2VQFF 2ZH9A 5F8JA 4C3MA 2ZOGA 3EWAA 2B4UA 2W4DA 1HIYA 2LKYA 4DPOA 3U27A 3BQ1A 2OFHX 7ICJA 3DDKA 4C80A 1HL6A 4QPTA 1URNA 5I3UB 2BW2A 4B3RF 3RB3A 1CPZA 4TYAA 4FBTA 1RTHB 1YJTA 2W1BA 1BLUA 1S0OA 3IRXB 4JV5J 4UBPC 1V5IB 3PVXA 5KFFA 3IMQJ 2DR5A 2WF9A 2GSEA 3JSRA 2AYEA 2DF4B 4QWEA 3QGPA 5ETTA 1R9ZA 1EJXC 1S99A 5KOXA 3GMGA 1BC6A 5KG0A 4HDGA 2AJ1A 3GV5B 3GCWP 1SVDA 4C7YA 3ZDCA 3G96A 3MTJA 1VQPS 2YNIB 5AI6A 3DRSB 5CCLA 1BGXT 4JMUA 1I94F 3WKCA 4C65A 2LU1A 2F3NA 1OY9A 1KWMA 3G77A 2ZIWB 2KU7A 2RT3A 5J2QB 4RQ5A 4KQZA 1LK5A 3BDPA 3EZOA 3FRYA 4KSEB 3MM5B 4TXSA 2C3YA 2B8PA 3SENA 1U25A 2NZCA 2W4PA 4DV3J 2DNOA 3OUYA 2D9PA 2KKPA 4GY7A 1IWGA 1WEXA 2OI2A 4Q0BB 2ZUBA 3SIPB 5F3ZA 4I27A 5KFZA 3HRDD 1TKZA 5KFBA 1S76D 1S10A 3PY8A 4O0NA 4QU7A 5ALIA 4TUPA 2H3IA 3THPA 2QLTA 4PZVA 5IT0A 4QWDA 2AX0A 3LO3A 1N32F 3OOQA 4O4GA 4WFNQ 4IC9A 5J2QA 1X9XA 5J0UA 1LWCB 4DR5J 4DV1F 4K5RA 3TZXA 1HNIB 3KUHA 4GOAA 3KWMA 2JL9A 2BV3A 2CJAA 4ZMMA 4ZOSA 3JTPA 2XIDA 4FPIA 5ETKA 1LWEA 3DC2A 1Y0HA 3PKMA 5HN0A 1D9DA 4ZKAA 1ZJNA 2GQCA 3OL6A 2B9YA 1ZQAA 1WF0A 4KHPF 5GAGI 5EGYA 3SI8A 1RXOB 1MQ3A 2C2OB 2JR5A 1CS4A 3Q8PB 2V2VA 1N62A 1B64A 1UWBA 2WONA 3RBEA 2ZJPQ 5T41A 4ECWA 1RWPB 2VL1A 5AIAA 1LWCA 1Y11A 4DL3A 1RA7A 2M8HA 4A8XA 2BR0A 3H8WA 2AF6A 4TU9A 3IP4B 4ZPDA 1WWVA 1NK5A 5AXKA 4NLCA 2BJ3A 1JX4A 2F7VA 3TUIC 4ECTA 3UDLA 2U1AA 2HOIA 4ES2A 1UW9A 4RNHA 1R27B 3W9JA 3C21A 4DV7F 2LEAA 2E9TA 1UHUA 2JMGA 9ICKA 3OLAA 1LKZA 1IBCB 2FJAB 2KIVA 4F0HA 2QEXS 1MC8A 2FPHX 1TR0A 1EAYC 3GSDA 1AZSB 1YG0A 1YLXA 1U09A 4AP9A 1OO0B 2DEJA 1T3QA 4WFYA 2VQFJ 3CO9A 2HS4A 2FDNA 3I6PA 1HNVB 3B9JA 4N8OA 2QLXA 4KX5A 3ISND 4RR5A 5A8KA 3QEBZ 4U7UK 1SL0A 2MKIA 4IYQA 3EDQB 1M5OC 3HLUA 2MPUA 1XJWB 3FFIB 3DDHA 1TFWA 1ZQZA 2EC2A 4LF9F 1S0VA 4IOBA 2XSJA 1IUJA 2OMOA 4DR2F 3ITHB 4YHHJ 3FDSA 3NGUA 3V7LA 4JI3F 1HQEB 2ILZA 3W62A 5J1EB 2MB0B 5L9XA 2HBZB 1GMWD 3QIDA 3LP0B 3TP2A 3QRQA 3T5LA 2DIUA 4HH0A 8ATCB 3PMLA 1WC1A 1TMJA 1DY3A 3DOMB 5KFMA 2CVEA 2DUYA 4DWIA 5HVGA 5KFLA 1D8LA 1W2BR 3MMAA 3C66A 5T7LA 4PG5A 3QZ7A 4LVOP 2CDQA 4CYUB 4EYHB 2KG1A 1ZOLA 3MKVA 3ITHA 4EO8A 1Z19A 3D4JA 1MROA 1RP5A 2A3JA 5EUHA 3TO8A 4NLTA 1KOOA 2EW9A 1CUKA 1WKKA 5HBMB 3ELHA 5LSRA 1EJUC 2F5GA 3LQVA 3K5MA 3GV8B 1RAIB 2KHCA 1T9WA 3R6GB 4DSKA 5TISU 3RYLA 3SMVA 2B56A 4ER8A 3GILA 2B6GA 1XO0A 4P2MA 2HQFA 3TR5A 2E5JA 3U02A 8ICUA 5B0EA 2LDIA 5IZHA 4EZ6A 2YX1A 3C1ZA 4KLEA 8ICVA 2PFNA 1KL9A 2M52A 4PG8A 5K8MA 3AOBA 4LF4F 2EBGA 4HYKA 1EHWA 1Q81T 3PRVA 2F8MA 2DCUB 4MIAA 4UAUA 4DOBA 1U2FA 1W7WA 3NCQA 1RLCL 4DHVA 2KAUC 5LT5A 3KDOA 3AY0A 2ZIUA 3FQKA 1YRUA 3IBWA 1S0MA 4M0AA 1N48A 3CC7S 1QTMA 2R8KA 4FF2A 1FWFC 1JALA 4CF3A 2E8MA 1YQHA 3PX0A 3NEKA 1IE7C 3LF0A 3NP5A 3VALA 4KGMA 2MQPA 2ZD1B 1Z2ZA 1BNPA 2NZ4A 2MQMA 4KIAA 4FYDA 1YTYA 4KLQA 4Y2UA 4YEAA 2DK2A 1RAEB 3Q8SB 4KRWA 2E66A 3KUGA 1VFJA 3W8GA 5IQQA 2XNQA 2KKVA 4E98A 3MM5A 4Y2PA 4ZK7M 4UQTA 4KV8A 1IN0A 1WHWA 3MEKA 2LXFA 4B3TF 1Q8KA 3NRBA 1OSDA 2XO6A 4W4MA 4KPYA 3NUQA 2R7XA 1CC8A 3R5AA 1EJSC 1VGYA 2GA7A 1ZQSA 2VA8A 5MLCV 3TJ8A 1ZQRA 5F8IA 2CWXA 1NHKL 2R2TA 4MKBA 5J2FA 4L72B 1VI7A 5IIJA 1GTHA 1ZQEA 3OUYB 4PJ0U 2J6UA 1A5KC 1TMMA 2OXOA 2NXNA 5L9NA 2KK0A 1DURA 3ZZUA 1TKZB 4F2SA 1TE2A 2EFVA 3NGSA 2WSEC 1QQ7A 4WJ3B 1S6UA 3CUNA 2BANB 3QT6A 1FWEC 4ZVRB 2CPFA 3GIMA 8ICMA 3HX9A 4EENA 3N7PD 1MW7A 4A8KA 3N97B 4RUBA 2QB0B 3FM9A 1SBRA 3TFRA 3LOUA 3M1VB 4C7ZA 4XDCA 2FJWA 1R0CB 1RA0A 2RQMA 5DM7Q 3FEZA 1TV6A 5E41A 1HBOB 4R63A 4N77A 2F4VJ 5HP1A 3NOGA 5K5MA 2IMRA 3BBBA 1H2UX 5G0RB 3QIPB 3QGHA 3V72A 3SQOP 1JLGB 3PYEA 4CLLA 2G1HA 3TUJC 2MSTA 5KAIU 2P5VA 2WF5A 4KR0B 3CD7A 2V4JA 1RAKA 1RU1A 3ZDAA 3VAIA 4PWWA 2MU2A 3QU5A 1FNXH 3PACA 5KG5A 2C1EB 5AM2A 1XSNA 1M6YA 1WDDA 1YBTA 4OYIA 3HKZC 4M5GA 4HH1A 2KM8C 2PAJA 2Q6CA 2XY6A 3DGPA 4DV4J 4FNHA 4OJ6A 4WTOB 4ED6A 4P2HA 2UUWA 2PE8A 5EE3A 4F0SA 5KG2A 3HHLC 4H4KA 3ZDBA 3D6HB 1CJUB 1HWKA 2XNRA 5IWAF 1HPZB 3N5BA 2FTYA 1KEJA 4WKRA 4OZ3A 4Z6EA 2YX4A 4PKDB 2N7CA 4K0KJ 1IWAA 2X1FA 2UVWA 3M8QA 1U0HA 1N56A 3HT3A 1UBPC 3NNAA 4K4GA 3ILJA 1ZRNA 2CQ3A 3CTRA 4V19X 4GVBA 3CD5A 1AUDA 2GWSA 3N01A 1F5CA 3T6JA 4MK9A 3GYGA 3K1RB 3R9LA 2FVQA 2PUZA 4YP3A 1S79A 3LANA 2BDUA 4UB9A 2IHR1 3V6DA 4QYZJ 2PMZF 1CQMA 2KT3A 2FJBB 4NPOA 3D2SA 1VLBA 1IXKA 3BGRA 1OW5A 3PO4A 1LFWA 3M6UA 3QJPA 2QA2A 2AEMA 4YVZA 2ASLA 2D9OA 2ATCB 5ALOA 3KLHA 4EX7A 1EETB 3SAHA 5G4DA 1VRTB 4F72A 4KLDA 5HAOA 4RZRA 5HJYA 2C3PA 2CXEA 4EUVA 3EXCX 4J9MA 2G2ZA 4ED8A 3R5DA 3KXDA 2E1CA 2VA2A 4AL5A 1X66A 5E3AA 2AQOA 4WU3A 2BPFA 4G9BA 2DGUA 2UVVA 1WUDA 1X8DA 4PUOB 1ZTTA 4K4UA 3MEGB 3SYZA 2E29A 4ALZA 5J2EA 4IFVA 5HO4A 2M88A 2OEKA 1KDNA 3ZC4A 4QZVB 1OPZA 2KG0A 2MQNA 5ALNA 3BBFA 2MZSA 2AQ0A 4ZLNA 2DNPA 1WCLA 5D0HA 1OWXA 2HFVA 1A77A 9ICOA 2E44A 3PFEA 2D1CA 2AMCB 3W60A 4OMFG 1SC3B 3UQ0A 5J0QA 4TQSA 4ZVSB 5HMXA 2OEHA 1CI4A 3M6XA 4PZOA 5K4LA 2VH7A 3WKBA 3H0MB 1X5TA 4RW6B 4DPWA 5C24B 2DYAA 4CGZA 3MFHA 3G86A 4B08A 1A5OC 2BRKA 3RF9A 4USMA 5KNIA 4OYXA 2IRYA 1LFPA 3QUBA 4LZDA 4EEYA 2DEIA 1HKAA 4F7VA 2J9CA 4I2DA 1HNVA 2Q09A 2WB4A 2L9DA 4DF4A 2N4CA 3E2EA 3FK4A 3D0GE 3KJNB 4R88A 3NAHA 4QWAA 1LW0B 9ICHA 1NZBA 3MMBB 1NK0A 1X31C 4DEZA 4LF8F 2DGTA 2YPYA 8ICOA 3POTA 1F0XA 2HVDA 3HM7A 2NQPA 2F1FA 1L7PA 2AYGA 4K4YA 3DOLB 4X4TA 2IJFA 1C1BB 1VLOA 2AWZA 4Q45A 2FY8A 5J0RA 4CLWA 2Y1IA 1MMDA 3R5CA 1NJXA 4ZIVA 2P66A 1KVIA 1FVQA 1F5AA 4CO1A 4X4RA 4UF4A 2FVCA 3HVTA 5E33A 4LF6J 3BF4A 3UVJB 3IV8A 2PSZA 2CVIA 4CNQA 3DMJA 4CH7A 3D68A 1GT8A 1FRXA 1S6PA 4A48A 1RWMB 2GMHA 3KK1B 1Q46A 2UXCJ 1HMVB 4LVNP 3MCSA 2DKXA 5DZ7A 1Z3EB 4QZ9A 4PQUA 4N5SA 3PJWA 4RBUA 2HBLA 5IWAJ 2E5LJ 2KMDA 4F4ZA 1VYAA 3A0HU 1QAXA 3ETOA 4RPYA 4DR6J 4I2GA 4WJBA 2HNDB 4CNUA 1XRTA 4CI0B 4OIXA 2A1AA 2CPJA 1WI8A 1CJKB 1U1NA 3MFIA 3AEVA 2FTRA 2CNOB 1D3WA 4Y2AA 4O0IA 5AKXA 2FJEB 2WFAA 5HP1B 4RT2A 4FYWB 3H4BA 1FXDA 1GTEA 3D54A 3DXBA 1C1CB 4QR1A 3BO3A 4QW9A 3OL7A 4OZJA 1AA1B 2ISOA 1NPRA 3V4MA 2R8GA 3VQTA 2AJ2A 5KOWA 1FFWB 5FLXU 5AK4A 1HHSA 4PQAA 2DNKA 2KD1A 2IYIA 4DQSA 2DR7A 2PFPA 2EBEA 1P1LA 3EVOA 4CNZA 2Z7JA 4CNSA 2G4BA 3V2UC 2XMMA 4CIOA 3M2VB 1C7YA 2JEIA 2W3SA 4JK1A 3DDIA 5DDQC 1KKXA 5GAHU 4RQMA 2HWTA 1S1UA 4P2SA 3EYZA 2Z30B 4J91A 4CO4A 1FESA 4DR3F 2K06A 3MDCA 2WF7A 3O7UA 4KFBA 4K4TA 1W2IA 1RWKB 2ZG6A 4L9XA 1ZD2P 2EH9A 2W9MA 4B9MA 4FFDA 1KLMB 4DSEA 3OPKA 1ECWA 3SR6A 5J2CA 1RYUA 4NLNA 3P5BP 2X1GA 2YWWA 2CZ4A 2H3QA 1D1UA 4CLUA 1XNRF 3HJFA 4XPCA 5HJXA 3UDCA 4YMOA 1NPKA 2W8KA 2DXEA 5J0OA 4FN5A 3OVSA 2YMMA 4IS7A 2OPQA 2MZRA 4C0OC 2DO4A 5LOQA 4P7TA 5ALVA 2W9BA 5CYMA 3FBFA 2QV6A 3BGRB 4ED4A 1Q7LB 3Q2SC 1WEYA 2VQEF 4CDIA 2UU9J 4LJXA 1H73A 3OTQA 4R0EA 1ZPWX 2QT7A 3Q8RB 4PXEA 3JSMA 1PO9A 4Y2KA 3MWBA 3WIUA 2ZKUA 1UJ4A 4C9DA 4DG1A 4CO3A 3T1YF 4WHBA 1TVRA 1CRXA 4NL5A 2V0NA 3K5PA 3DLBA 2XC9A 5AM0A 4UB2A 2OSQA 3H8YA 5CA5A 3DYAB 2XMAA 1JRPA 1RZMA 4DBQA 2IVFB 3RB0A 4ZLLA 1J2NA 3HKZD 1XO1A 2O3DA 3I5BA 3G6YA 5KFNA 3NBPA 1HFEL 2CYYA 3MUTP 5I3UA 1XQIA 1KHWA 2YXLA 4J9PA 4HT7A 5J2MB 1RKJA 2CZ9A 4BCAA 2KDOA 1ZQCA 3C6TA 3CMAS 1JLAB 2HRYA 1TFYA 4RQ6A 4RQ2A 1V5VA 4X4NA 2XI3A 3IXQA 3N9UC 3F2CA 5G0RA 2D3O1 4JI8F 1WD6A 2XS7A 4JI5J 1N54B 4TUQA 1S1XB 4QIWC 1ZM3A 4A8EA 3L95X 1WC4A 5B0BA 1FO4A 4XA5A 4X4PA 3A8EA 3CDUA 2HQGA 2BOPA 3TKAA 4WE1A 1SQEA 4ZPWR 1R9XA 1T9XA 2QA1A 2NR0A 5AKEA 3ENVA 2XICA 3ZO7A 3KLEA 2YVSA 4RQ8A 4US8A 1REVA 4RW6A 1MU2B 4XRHA 1QY7A 2B21A 1NDKA 1RAHB 3OFFA 3HHNB 3C6UA 5B08A 4U6PA 3NGTA 1L3KA 3E58A 3H5SA 2B5JA 2XVTA 3CWJA 3OD2A 4CQ1A 2ZBRA 2OPRA 3SMZA 2UUBJ 5AKYA 1M5SA 2ZE2B 4QQBA 1PSDA 2IMWP 2GAGC 4F91B 1NKCA 2CQDA 2OO4A 4OI3A 3K2YA 2RUGA 3TVZA 3R5BA 3OHAA 3S6JA 2JC0A 1O5JA 1LNQA 1FTRA 4B3MF 3GONA 2BCRA 2C2NA 4NMLA 2CQPA 2Y1JA 1G3OA 2RHQB 2XZTB 4OD0A 2G5IB 2W9AA 3QO9A 3N4MB 5F3XB 4TUSA 2LHTA 1MU2A 1YNYA 4EU0A 4J9RA 3W61A 1BD6A 4Y2SA 2HHUA 2BCSA 4CLYA 4TLQA 5DO2A 1FDBA 3CMQA 1N6QB 4LJMA 2HBQB 4JB8B 4DSIA 4U9RA 5BJRA 2HW3A 1RTJB 2RHSB 1ZOTA 3CCQS 4A8YA 4DPXA 4ETXA 2HRUA 4F36A 2UXBF 5DDYA 2M9NA 3ILLA 1SKUB 5AI9A 3WU2U 3KLFA 1X6JA 2LM1A 4HTJA 2G0JA 3CDWA 4NI2A 2OJ3A 3ENAA 1H2VZ 2BYCA 5H9FK 2A1JB 4X2BA 4KGVB 1CJVA 3FEYB 5F0WA 2PA8D 2HHSA 1Q53A 4ECZA 1MWQA 2L48A 3KK2A 1WC3A 3M6WA 4CTAA 5HK4A 2H9ZA 1RTJA 4F3MA 2FHOB 2Y1RI 4XO0A 4R8UB 3GG0A 3DRXA 5EWEA 2WRMA 2XS5A 3FJ2A 3H0RB 2VHGA 4QBUA 2VC1A 1ZM2A 5AE3A 4RKUC 2XCPA 1NDCA 4I1TA 1OQ6A 2EK6A 3VR1A 3BS5A 3K57A 1JLQB 4HI2A 1KOHA 4C6AA 5GAEI 7ICKA 2RB7A 2Y3YA 2B4VA 3QE9Y 1F5SA 1RWNB 5D4PA 4DV1J 4KV8B 3LAKA 3DV9A 2NO5A 3OTOJ 1U1PA 4UB8U 3UCUP 2G13A 4NCGA 3VVTA 4NM1A 1U6FA 1A5MC 2ZIXA 3NGKA 2UXDF 5J8YC 4TVAB 1U6BA 1EQMA 4KHPJ 1C0TB 5D8HB 1TELA 1V85A 4NLGA 3MDUA 4NYPA 5JTIA 1SQFA 5CD4H 2RS2A 1Q16B 3C23A 1ZQFA 2XI9A 2W54A 4TY9A 2CNKB 4I7FB 5DG7A 1JIHA 1TAMA 1SH3A 1JROA 2AZ1A 3TEGA 3MUMP 5DG8A 2A3VA 4YN3B 5HMYA 2GNKA 1VQMS 2HVIA 3RB6A 3B4DA 2E5HA 1C0TA 3BKFA 2G2OA 3O8WA 2HGNA 2D6FC 1SL1A 2E5GA 4HKQA 4ELTA 2PMZD 1ZM9A 4ZCLA 1P1MA 1H2TZ 3P45B 5J0SA 2PDAA 5KFEA 1VQ9S 3GYNA 4QYZK 5CR0A 3EZUA 1N61A 1K44A 1NI3A 2PIIA 3VZIA 3GV7B 3MCMA 2YY6A 1UPHA 3AL0B 5LMNF 4BC9A 1PYSB 1BY9A 4A8SA 3BJYA 4IRCA 1FE4A 4YR0A 4DF8A 9ICAA 5FLXY 5J1NA 4P4MA 1ELOA 8ICHA 1RWXB 1RE1B 4YMMA 4GMKA 2AT1B 3NG8A 1PBAA 1Z4UA 4LF9J 5ETQA 9ATCB 2DKZA 1SXDA 4P52A 2IJRA 3WK9A 3M4XA 5FDLB 2DNHA 3LUYA 1Y9OA 2AW0A 2GIQA 2E1RA 1XR6A 4XUSA 5AKGA 3IBCB 2OSRA 4OJHA 2KRBA 1S1VA 1I3OB 1WKLA 2Q79A 3D6JA 4F67A 2R7WA 5C2CA 3AD7C 1WKJA 3GZ7A 1V3RA 9ICUA 4Q7AA 4NLBA 4FF4A 1Z1VA 4Y2QA 2R7SA 1P6TA 4DR4J 2XYPB 2HBMA 2XMUA 2OD6A 1JLAA 3SXLA 2YH1A 3BGUA 2MQOA 3QAUA 1PAEX 1UZHA 4O23A 4DFDA 4JI2F 4WIIA 2BZ2A 3ICLA 2HBYB 1EJTC 2DTJA 3A8IA 1EARA 1RT7A 2BE9B 4QWCA 2ZBIA 2CPEA 4B9SA 1JLBA 3SSSA 3MECA 3C6UB 2HCFA 3TAMB 4NY8A 1PKUA 5B7WA 1KHVA 4URQU 5KT4A 3D1OA 4YB5A 2QMWA 3TW0A 2CJQA 1S57A 1PK1B 1S5LU 5E3QA 3C28A 3NRWA 2LCWA 5KFPA 3UDEA 4DL6A 1DLOB 3SSRA 1B7FA 1WF2A 2GQ2A 1N33J 2RDIA 5L39A 4I69A 3KLHB 1E9ZB 2XSFA 4IFYB 2P53A 2YNHB 3EPGA 2PA3A 5F8MA 1X4AA 3JYTA 4QW8A 1BPYA 2NSBA 2ZHBA 2CN1A 1H7XA 2R2SA 2J9DE 4ZVUB 3J81U 5DB9A 1U1LA 1MG7A 1LQ9A 3D0HE 5ALWA 3TAMA 1RJQA 3ALRA 4CT9A 4RBTA 1N34F 2QIFA 1T0TV 1RQLA 3W9IA 2KKHA 1Q95G 2CJKA 5J2PB 2EC0A 4PHDA 4JOUA 4MYUA 3KLFB 3LPYA 2P6RA 4A8FA 4PYDA 2QG9B 2F8EX 3QX7A 4BJQA 4NJ8A 2GO8A 4LFCJ 3SFUA 1WHYA 1U2RA 2GC8A 1BNOA 3D6FB 2YMLA 4J9OA 1FKPB 1HNZF 1ZXIA 5KFVA 2WHEA 2ZIVA 1XNSA 2DNYA 3VAMA 3BN7A 2UV8A 4RUAA 1NAQA 5E3RA 3Q86A 5IIIA 4CF4A 3BO4A 3KMSA 5J0PA 4TN2A 2DPJA 1HJPA 3IGHX 2D41A 4IH6A 4NASA 2H1YA 2CNLB 4CLKA 2YX8A 1HARA 3IBFB 2VFSA 3MDAA 2D8CA 1K6WA 4JI0J 1FRMA 2CRXA 2B9XA 3I0RA 2FZCB 1ZQ1C 4C8MA 4J9SA 5HR6A 5A8WB 4PCQA 3F53A 2HHPA 3LP0A 5KFCA 4KLSA 4LT6A 4I2HA 3BZKA 2R8IA 3IG8A 1ZJMA 2E7XA 3Q8KA 2LXUA 1SV5A 7ICIA 1YBQA 3JPPA 2RHFA 3IR6B 2YN4A 1XR5A 3UN3A 1LW2A 5KG6A 2YNGB 3J80U 1PG5B 5J1PA 1SI9A 4QZEA 1Z4NA 2LECA 1CJUA 2EAPA 2KNJA 2YX7A 1GMUA 2D3UA 4JV5F 5CZXA 2DQNB 4LF7J 2AU0A 4KJIA 3UD4P 1RM6C 2I9GA 4UY85 3VHQA 2F8LA 1ZQLA 3JPSA 2ESEA 3DUGA 4NLUA 2LLZA 1YKWA 3HHLA 2GVZB 4Y2XA 4UB3A 1R0AA 3EXYA 2OLWA 3MPYA 3QATA 2F4VF 2CUYA 2CQ4A 1HW9A 4OHZA 2BABA 3BH7B 2MQ8A 5ALTA 4NYZA 5HROA 1EIYB 4QZDA 4DV0F 3NGDA 1XMOJ 2V94A 3CJSA 1S9GB 3HSZA 1VISA 4EPBC 3UXPA 3IHQB 2F3JA 5ALMA 3DU6A 1SKRA 4UBCA 4X4VA 3J7Z5 3ZFVA 2N1RA 4L3KA 2AJ0A 1NH7A 2FY1A 1KW4A 3BM7A 4Q0BA 4KE5A 5AI5A 1O6XA 3TEHB 4CLFA 1CSJA 3U1NA 4KAIA 2JVRA 2N3OA 1A5NC 4PHAA 1T9TA 5DDOC 3ZD8A 4G6VB 4DV4F 5ITHA 1RTDA 1ZQIA 4EO6A 4RJVA 1LWXA 1HNIA 4UQGA 4F02A 1C20A 1N33F 1JKHB 3RH4A 3L4BC 1K0VA 5CJ7A 2YKPA 4FXWA 5FSDC 3FRZA 4IO9Q 3M9NB 3BS9A 2D69A 3ISCA 4EELA 3LP2A 2BM0A 4G3IA 3LWLA 1OMSA 1RB0A 2HNZB 4UAWA 5GADU 4RQ3A 2JLEA 1K73T 3QZ8A 1URJA 4C11B 1FF2A 4M1KA 4NX9A 4OJOA 1TKTB 1L3TA 2CQ1A 1VBXA 3K89A 2VIXA 5D4OA 3R8YA 3AA8A 1JJ2R 2HS0A 5EOZA 1DTQA 4M51A 1DQ8A 5DDPC 3LP2B 2HMIA 4LRCA 3GIIA 1C2PA 4O5CA 3NWGA 3PCOB 1SC4B 3QU9A 2DHXA 3AAWB 3W5YA 1TVAA 2VBZA 2JRSA 2NRZA 1A0OB 1B7YB 1RWWB 2OCEA 1H72C 2LMIA 2FMQA 4NLYA 2E1PA 2B3TB 1KC8T 1TV9A 2YWGA 3E3XA 3AA9A 5ALHA 4RW7A 2ADBA 3CXCR 5CYQA 4YB7A 4RPZA 4S0MA 1RADB 4P4PA 5E79U 2O1PA 1HD1A 2K1RA 5HHHA 1I51B 1CJTB 3QSIA 3K59A 4LRDA 3AQOA 1RA5A 1ZQBA 4EP8C 3BZQA 1EP4B 2IAJB 1MN8A 4YB1P 2BJDA 3J7YI 1APSA 2XSJB 9ICRA 5EX0A 4OI2A 3G6ES 4DZHA 1R31A 2FUG9 2DHHA 3LTOA 2V63A 4F4WA 4FE3A 5ALZA 3H98A 1ED1A 5LMUF 2LVWA 1PAUB 3TQ1A 3H40A 3E0FA 1CEZA 3KKFA 2Z2LA 2WAQD 2LA6A 3BQ0A 2GV1A 3KK1A 4ED7A 3MPDA 5B5EU 3S1TA 3C14B 2H5EA 5D3GB 2XMJA 4YHHF 2K1RB 2DB1A 9ICCA 1T7PA 2YQ0A 2GJ2A 1EJWC 2J76E 1VIOA 3Q83A 2HNDA 4UUWA 1MMNA 2EFGA 2MSNA 5KL1B 4O5EA 2BPGA 4OI1A 1Q8BA 4OCZA 1IKXA 2OMLA 2Z8QA 1F6TA 1O0PA 4NMXA 3HJEA 3QGKC 4LRBA 4M95A 4FNIA 2CJBA 1ZQHA 1IR0A 1VR6A 1UW4A 4UAYA 4F5NA 4ZLPA 1X0PA 3CP8A 3M2UA 1L8OA 2FLPA 4AD6A 4HLBA 4X4OA 2VJUA 3I31A 1F60B 3LDAA 2MKKA 4DLEA 3WK8A 1H3DA 3LSCA 2BBEA 2PEHA 5AICA 1LK7A 2BW7A 5A2QU 4K4HA 4Z42C 4KGKA