4DEZA

Structure of msdpo4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
TKWVLHVDLDQFLASVELRRRPDLRGQPVIVGGSRKVVTCASYEAREFGVHAGMPLRAAARRCPDATFLPSDPAAYDEASEQVMGLLRDLGHPLEVWGWDEAYLGADLPDESDPVEVAERIRTVVAAETGLSCSVGISDNKQRAKVATGFAKPAGIYVLTEANWMTVMGDRPPDALWGVGPKTTKKLAAMGITTVADLAVTDPSVLTTAFGPSTGLWLLLLAKGGGDTEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PAD region in the mycobacterial DinB homologue MsPolIV exhibits positional heterogeneity.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords DNA polymerase IV 1
total genus 75
structure length 232
sequence length 238
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dezA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4dezA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dezA01
1RYSA 2NRXA 1JLQA 4PGQA 2PFQA 2UUTA 4IQWA 3DM2B 5KT7A 2XO7A 4Q0BA 4MIBA 4BWMA 8ICIA 3UR0A 1JLGA 4ELUA 1RZTA 2JEGA 4I2CA 4DFMA 3H2LA 2BDPA 4NM2A 4RQ5A 2BANA 4TUPA 2R2RA 4DQQA 5KFHA 3Q8MA 4B3OB 7ICEA 4DS4A 5KFLA 5J0RA 2HHQA 3MR5A 3RBEA 3PW4A 1NK9A 5DGBA 4K4VA 2EC0A 3NAHA 1LWCA 5F8NA 3H5SA 3JYTA 3E01A 2W8LA 1VRUA 4NLWA 4IH5A 1XR7A 1S1WA 4ZVEA 4PQUB 1S0OA 4F4XA 5K14A 5DB7A 3M8SA 5KFPA 3TFRA 3MEDB 3N97B 4I2JA 2B43A 4WFXA 2W9MA 3SYZA 1K1SA 3PR5B 3MEEA 1C0TB 5KFZA 1FKOB 1SV5A 5J2EA 2PFPA 2GIRA 5CYQA 1N6QB 2KFZA 1JKHB 2E9TA 5CA7A 3DYAB 4KLIA 4DSEA 2XWYA 4K4ZA 5IIKA 4MK9A 4FBTA 3MEDA 4ECZA 2RF2A 2BPFA 2PI5A 2HHVA 4DQRA 4XUSA 4F3OA 5KG1A 4F91B 2WTFA 5HP4A 1DTQB 4ICLA 3RH4A 1JX4A 2FVQA 4NYZA 2UUWA 2FVPA 5HHIA 7ICQA 5KFAA 1UA1A 3LK9A 3DLEB 4JWMA 3H8WA 5C24A 3N6MA 4F5PA 1TKDA 1ZQRA 5J2GA 3KHLA 5EUHA 4KV8A 4I2BA 1QE1A 4ZVFA 2IHNA 4RQ0A 1DLOB 4RW8B 5J2FA 3KLEA 1NKEA 4C8KA 5J2HA 2D3UA 4GC6A 4KLJA 2BCVA 3OHAA 3EZ5A 1J5OB 2FMPA 1RTHA 1HMVB 4IKAA 3PX6A 3IHQB 4ED0A 4O3OA 3RB6A 3QIPA 5KTQA 4RQ7A 4Q45A 3TARA 5TZVA 5KFFA 2AGPA 1VRTB 4LSNA 3RJJA 2VA2A 1X2IA 2VG7B 5J1EA 1HQEA 4KLOA 2P6UA 4EZ9A 4DL2A 5C42B 3C1YA 3KHHA 1S0VA 1SH0A 4O4GA 3MFIA 2HNYA 7ICNA 2BCUA 4DOBA 4ECSA 5DB8A 3QO9B 3V7JA 4YR0A 3MBYA 4Y34A 1JLAA 7ICIA 1C2PA 2GIQA 1HYSA 3E01B 1U48A 1YVFA 4ZPCA 3RJEA 4KLHA 5J2PA 5F9LA 1S1WB 4PQUA 3C6UB 5J1EB 2HNYB 3V4IA 3RB4A 4ZPAA 3Q8SB 4ZP9A 3M9MB 4BXOA 1HYSB 2R2UA 3GIJA 1ZQKA 2BHNA 4O0IA 3I0RB 2AGQA 5I3UB 2HVIA 2ZJAA 5IINA 4ECVA 4J9NA 4B9SA 3EW9A 4MIAA 4O3SA 1X9MA 1ZQYA 4U6PA 9ICKA 1XO1A 2WONB 3QEBZ 1LW0B 1S1UA 3ITHA 4F4WA 5BOLA 1SUQB 3OL9A 1KSPA 4KLLA 4U7CA 1TL3B 8ICOA 5F8HA 1IXRA 4C8MA 3IGNA 4NLNA 1TVRB 3V81B 4KV8B 4MKAA 9ICBA 4M9NA 4F5NA 5EWEA 1KEJA 4IFYB 4QZEA 3Q8RB 2MAXA 3PZPA 5DG7A 4PGYA 1S9GB 2FLLA 3N4MB 3K75D 1QLNA 3MFHA 5KG5A 5J2IA 3NBPB 3BREA 2PI4A 3LP0A 1RT6A 4NLSA 3PR4A 4DS5A 3FFIB 9ICAA 4F5RA 1QSSA 3T19A 3JPPA 4ECYA 4Q43A 2YNFB 3CDWA 1RTIB 1JLBA 2YKMB 4ECWA 1HPZB 5J0YA 4DFPA 1C0UA 1TK5A 5CYMB 4QW9A 1IKXA 8ICGA 1FK9B 1S6QB 4WZMA 1S4FA 4IQUA 3BQTA 1Y88A 1S1TA 2V4RA 5IIMA 5KT5A 3I5AA 2AJQA 2C28A 3FFIA 3DOLB 3VQSA 3SV3A 3V6DB 5J29A 2O5DA 2BRKA 4UAWA 1HNVB 4LSNB 4ZHRA 4Z6DA 1ZQDA 3RJKA 2R2SA 5KFDA 5KFQA 4RNMA 1TAUA 4IDKB 2OPPB 5K14B 1U45A 8ICAA 3UXOA 2ATLA 3DM2A 4MF8A 3NKYA 5J2KA 5T14A 4O4GB 4PHPA 2FLNA 1TP7A 1KFSA 1JLCA 3PW7A 1S0MA 3CJ4A 7ICMA 5J2JA 1REVB 1Z4UA 1JLAB 3DRSA 4M2YA 1JLGB 3V6DA 3MR3A 3D5MA 1UWBB 1JLFB 1ZQEA 1C1BA 4KFBA 1S9EA 5CWRA 4EBCA 5DB9A 3UQSA 2R8GA 4NCGA 1REVA 1KHVA 2IM2A 5C25B 1COOA 4DOCA 4MF2A 9ICHA 4QZDA 3T5LA 4M9GA 4NLZA 2NRVA 3MABA 1KHWA 4IRDA 4KLSA 7ICPA 1S9EB 2OH2A 3MGIA 5HBMB 2J6SA 3RJHA 3HW8A 2I9GA 4RU9A 1EETB 3H40A 5KG2A 4IRCA 4IG0B 3BQ0A 1ZQAA 3HWTA 3IS9A 3OGUA 1NJZA 3LP1A 2V4QA 4PPXA 1B22A 3LALA 5C25A 4MFBA 1TVAA 4MEXA 9ICUA 3MDAA 3CDUA 2ZE2B 1RDRA 5DKWA 2RF2B 2IMWP 2KZZA 1S6PA 1XU4A 1NK0A 5DB6A 4ZMMA 4UB5A 1MQ2A 3CDEA 4RW4B 2ILZA 2VG5B 3KLHB 2W9CA 9ICWA 8ICKA 1SL0A 3QIDA 4Y3CA 3C6TA 9ICOA 4LSLB 4Z6FA 3FDSA 4RQ8A 4DG1B 4I2DA 3C2LA 1NJYA 3MEGB 4NRTA 3V6JA 4KN7A 1TL1A 3RR7A 4GC7A 2IA6A 1D8YA 2KZ3A 2W7PA 3JSMB 2IM1A 4I2QA 5J2CA 4LQ3A 1S1TB 4GLXA 1XSNA 4K4IA 4LSLA 3C2KA 4J9QA 7ICUA 4I2GA 1T94A 2QV6A 4Y2CA 3C6TB 2IHMA 1MQ3A 3LP2A 2OPSB 3GIMA 2FPKA 3OL6A 4F4YA 1S49A 4QZAA 4P4MA 4FS2A 2IJNA 4R65A 4B9UA 1T05B 4DQPA 4JV0A 2VG6A 4ECQA 3ISND 3PJXA 2OPPA 2E9ZA 3QIPB 2HNZB 4C8OA 3M8PA 4YR2A 1ZETA 4H4OB 2BQRA 4O5EA 3GV5B 8ICQA 4K4YA 2C2DA 2LYHA 2I5JA 3TVKA 2JZBB 4PH5A 1JXEA 2W8KA 1X9WA 4KFBB 3BGRA 1QAIA 1L3SA 2HHXA 1ZJNA 3G6YA 4RQ2A 5HLFB 3NGDA 2ZD1A 2M9NA 4HKQA 2PFOA 3I0SA 1RTDB 4K50A 4J9OA 4UB3A 3JPRA 3PO4A 2BPCA 5FDLB 3M9OB 5KFCA 4K4GA 2JC1A 3MEEB 3E2EA 1NKBA 1JXLA 2YKNA 4DL3A 1Z3EB 1MU2B 4UBBA 4TUSA 7ICLA 3FSIA 8ICXA 1TAQA 4R5PA 2HMIB 3V6HA 1H38A 3HVAA 5KFJA 4NLVA 5HROA 1N48A 4ICLB 5J0OA 4KMUA 3N6LA 3NBPA 2ALZA 5FDLA 4WZQA 4MFBB 5DQGA 4QWEA 2ZE2A 3HVWA 4MK7A 1T03B 4LQ9A 3FYHA 5C5JA 3LDAA 1HUZA 5DLFA 5I42B 4IG3A 3DRRA 3Q8LA 1HQUB 4DF4A 3EPIA 4R8UA 1WCLA 3H4DA 4YMMA 2VA8A 1QUVA 3KLEB 2IAJB 4Q44A 1CEZA 4WYWA 4DG1A 3QZ8A 2C2EA 1S1UB 4F2RA 4TXSA 3JPQA 1ZYQA 3KHGA 1T8EA 2HW3A 4IG3B 3H8SA 4WYLA 3DOKA 4TY9A 3ZDDA 4IDKA 1T03A 2YNGA 2BR0A 1R0AA 1HUOA 5J2MA 4HYKA 9ICFA 1N5YA 1HMVA 1DTTB 1AROP 5KFWA 4IFVA 4O44B 4DSJA 2HWIA 1HNIB 1BVSA 2AX1A 3TANA 3LWLA 4ELVA 4DO9A 3LP2B 1ZQTA 1JN3A 2Y1IA 1RXWA 1DTQA 2HHTA 3CJ5A 3DRSB 4ECXA 1GX5A 2VG6B 2E9RX 4F2SA 1S1VB 4EBDA 1T05A 1KFDA 3CWJA 1ZQPA 5C42A 3PHEA 2FJVA 7ICGA 4QW8A 1LB2B 1RTIA 3OJSA 4RQ1A 4IOBA 1DTTA 4H4OA 3Q8PB 2KZMA 1RTJA 1KLMA 8ICWA 2BRLA 7ICHA 4JUZA 2IC3B 4TURA 2YNHB 2UVVA 4I29A 3BQ1A 1UT8A 3RB3A 5EWFA 4ZPBA 4KN4A 3PY8A 5D3GA 2ZJ5A 1TKTB 2R8IA 1HJPA 1K1QA 4F50A 4KKOA 4EZ6A 2FPLA 3MTKA 4GXKA 4I28A 1RYRA 2WOMA 3SFUA 4UQGA 2AWZA 4DEZA 5EDWA 4QZBA 3UQ0A 2FMQA 4DFJA 5L1KA 3IG1B 3UXPA 1S6PB 3MR2A 5KG6A 4ECUA 4KLFA 1OS5A 4G1QB 4J9LA 2AX0A 4QPXA 4RW9A 4YXMA 2BQUA 3M9NB 1TKZA 3B0YA 3T5HA 4IQTA 3K4GA 4DOAA 3CJ2A 2RDJA 1SUQA 1FKOA 3MF5A 1LW0A 3I5CA 2R8HA 2B5JB 3RBDA 3H5YA 4LZDA 3GIIA 4M6WA 4XQ8A 1DOQA 5DLGA 5KFRA 5L1IA 4IQXA 5KFTA 3IGVA 2DFLA 4K4UA 3H4BA 1RT2B 4KO0A 3LP1B 4KSEB 4ZP8A 4IG0A 8ICFA 2I1QA 4XO0A 1SKWA 4H54A 3OL8A 1NJXA 1Z00A 3NTUA 4F92B 4IH7A 2KTQA 4YCXA 4RQ6A 2UVRA 3KTQA 5J0WA 1NK6A 3DOKB 5DQIA 1S1XA 3FQKA 1RT2A 3MR6A 4RW7B 3UDLA 2HAIA 4NLDA 1JLQB 1QE1B 1TK0A 1XSPA 4UAZA 4FO6A 4TUQA 3SFGA 4O3PA 4KO0B 3ZDAA 8ICUA 2RKIB 1U47A 2OWOA 2GWSA 2AQ0A 8ICLA 4H4MB 2A1JB 2JEJA 4R0EA 3LAMA 1BPDA 9ICXA 4J9PA 2F1JA 5F8JA 5KFYA 3JSMA 1HNVA 4ZHRB 1RTHB 5KFVA 2CKWA 4I2PA 4KLMA 3UPQA 1T4GA 3OSPA 1RT7A 3PMNA 4B9VA 4RUCA 3ISBA 1RTJB 3DI6A 1NJWA 3M8QB 5KFNA 4YMNA 5CP2A 4DL5A 5J2NB 2HHUA 3C2MA 2V0NA 1MU2A 3H5XA 1MMLA 4QWBA 9ICNA 8ICNA 3C1ZA 5EWGA 1TKTA 1HPZA 3RAQA 1C0UB 3KLIA 1BQNA 3AU6A 4JV2A 1KLNA 4K4XA 4KKOB 3DMJB 4Z6CA 2XI3A 4EO6A 5KT2A 4B9TA 3OL7A 2XY7A 4ED7A 2BQ3A 4TY8A 3H8JA 3IN5A 5J0XA 3CJ3A 5CB1A 3RAXA 3IRXA 1ZQWA 1BQMA 3ZD9A 4P4OA 1IKVB 2JZBA 8ICCA 9ICLA 3KLVA 3BSCA 1U09A 4I2HA 4P4PA 1XS9D 2B21A 2VANA 3E51A 1JLEB 4M0AA 1BQNB 1NOMA 4RQ4A 3HX0A 1BPYA 1QTMA 2H5XA 3RH5A 3KJVB 5DDMA 3BJYA 4F4KA 4DL7A 3KMSA 2MUTB 3TAMB 1JLFA 3N6NA 2UVUA 3ZDEA 3PO5A 1R0AB 7ICFA 4DSKA 3PJWA 4KLQA 8ICBA 1N5YB 1V9PA 1HNIA 9ICSA 1LV5A 4QZIA 2XY6A 1TV9A 5HROB 5DDYA 2WONA 5KFOA 3D28A 1JKHA 4MFCA 1X9SA 1BPXA 1DLOA 2DPIA 3IM1A 1TL1B 4DSFA 5CJ7A 3DYAA 2P6RA 1TFRA 4I2AA 3MECA 4QZHA 4DLGA 5I42A 1NK4A 2IAJA 4WE1B 4YN4A 3KLFB 1HQUA 1XSLA 4DQSA 1ZQXA 1RT6B 1L3TA 4JK1A 4H4MA 4M94A 1RT4B 4B9MA 3JPNA 2Q0ZX 8ICVA 2HWHA 1HQEB 3MECB 4NLOA 9ICPA 2ILYA 1ZJMA 2YNIB 3RJIA 5DQHA 3TQ1A 4KBIA 2RDIA 3PW5A 2YKMA 4O5KA 4M9HA 3PX4A 1XWLA 3G86A 4RPYA 3UXNA 2XGPA 1ZQHA 4KLGA 1QSYA 4MH8A 4DFKA 3ZDBA 4NLUA 1ZQQA 1B43A 1S1VA 5EOZA 4RNNA 4UB1A 4O3NA 3T1AA 3Q8KA 1N4LA 1NK7A 4ED2A 4KLEA 4M95A 5KFGA 5CR0A 5J2PB 4BDPA 4MFFA 3HP6A 2BGWA 3GV7B 5J0UA 3BGRB 2BCQA 3DMJA 5KT3A 3DRPA 3PW0A 3SI8A 3I0SB 1LWFA 1MC8A 4URGA 3ISCA 4RPXA 4PHAA 4UB2A 1ZQBA 3DLKB 2ASDA 3EPGA 1XR6A 4RNOA 5HHHA 1UWBA 4I27A 1BQMB 1WCNA 3UPFA 3KK2B 9ICVA 5J2DA 1IKVA 3I5BA 4TQSA 2B6AB 3NMAA 4ED8A 5D46A 1RT1B 3DLKA 5KG7A 9ICGA 2XCPA 1NNDA 3HVTB 8ICYA 2FVRA 4EYIB 5KFKA 3QO9A 3KK1A 8ICTA 4M9JA 1IKWB 3C23A 1HARA 3TAMA 2WHOA 3RJFA 2F1IA 5J0SA 2VA3A 3V81A 1KDHA 1EXNA 1C7YA 4J9SA 3CJ0A 2HHWA 4QZ9A 4DL6A 2FMSA 2PFNA 2C22A 3PW2A 2NRWA 4NLPA 2ZTEA 4Y2AA 4JWNA 1RT1A 1T3NA 3QGGA 1EETA 4DSLA 1RTDA 3IS9B 2PXIA 1BGXT 2XCAA 2ZTCA 1L3UA 9ICIA 5HMLA 3BDPA 1JLBB 4IRKA 4YVZA 3QYYA 1A77A 3BQ2A 3KK3B 3GFKB 4QWDA 1T7PA 4WXOA 3QLHB 1C1CB 1ZQFA 4Z6EA 4YD1A 4R63A 4MEYA 5HMMA 1RXVA 2ISOA 9ICRA 3ITHB 7ICRA 2C2RA 1IKXB 3KLFA 1NKCA 4RW8A 3DOLA 4NM1A 2V9WA 4F5QA 5KFEA 4UBCA 1JIHA 1TV6A 1TVRA 3MEGA 1S10A 4WFZA 2BANB 1NK8A 3NL0A 1C1CA 1D9DA 4RPZA 4NLTA 2OPRA 8ICPA 4KTQA 1L5UA 9ICCA 4DF8A 1S9GA 1QAJA 1LW2A 2P66A 3QLHA 3C5FA 4O5CA 4MKBA 4UAYA 3LP0B 5F8IA 4RT3A 5KG4A 4G3IA 2ZKUA 3QGHA 1FKPB 5D4BA 2BE2B 1D1UA 3HHKA 3PX0A 4O4RA 4QZCA 3EYZA 3EWAA 2KN7A 2OPRB 5IIJA 2JEIA 5CHGA 1SKSA 3RRHA 4PHDA 2WRMA 3JPOA 2FPMA 5L1JA 3Q8QB 3DRPB 1JLEA 2WOMB 1LWFB 4WXWA 3PV8A 1RA6A 1QSLA 5HP1A 4LVSA 4RZRA 1SV5B 4KLUA 4ED6A 4KLDA 4QWAA 1ZQGA 4UB4A 3JPTA 1IKYA 2BE2A 5J2BA 8ICEA 2I5JB 3H98A 5J2NA 4K4SA 4ZH4A 5L1LA 1ZQIA 3IG1A 4BWJA 4RW9B 5F8LA 2IM0A 1TKZB 3BSAA 3H59A 2NRTA 4F8RA 7ICSA 3CVKA 4DSIA 4CCHA 1TKXA 5IILA 3V4IB 3BR9A 1PZNA 4JV1A 3ZD8A 4ZP7A 4NLKA 3G6VA 4ELTA 1IKYB 4R5PB 5C24B 2HMIA 1LWCB 2CJQA 3LANA 2W9BB 1C1BB 4NLXA 5DBAA 8ICHA 4F4ZA 4RW4A 2XY5A 1W25A 4NLYA 3HT3A 1CSJA 1S76D 1KTQA 4KLTA 4YMEA 3ISNC 4J9KA 5KG3A 4KE5A 5IIOA 4PHEA 4J9RA 2MUTA 4IH6A 4ZP6A 2BCSA 3KLGB 3GQCA 3LAKA 3FRZA 1ZQVA 2ZUBA 2ZJ8A 4Q8EA 3THVA 4DLEA 2DPJA 2WB4A 1LWEA 1D8LA 4NLGA 1S1XB 3ZDCA 4RQ3A 2RKIA 4EBEA 1UA0A 4P2HA 9ICEA 2W9AA 4R8UB 3OHBA 3KLGA 4C8LA 5IIIA 4K4WA 1TV6B 1ZTTA 4PUOB 2J6TA 4TYBA 3CO9A 3H7IA 3RJGA 2YNFA 1LWEB 2FVCA 4EO8A 2IM3A 4O3QA 5J0PA 3KMQA 3DLEA 4QZFA 1LW2B 2QE5A 2AGOA 4PWDB 3V7LA 4Q0BB 2YNGB 4NRUA 2D7SA 3RH6A 3GDXA 1BPZA 3M8QA 4I2FA 7ICOA 2IJFA 4KAIA 4MK8A 4KHMA 1ZQOA 4WFYA 1Z00B 4RNFA 3PMLA 1RT5B 4PWDA 2HNDB 1ZQZA 3BSNA 1JMSA 4I2IA 3DDKA 4KHRA 5J0TA 2FJWA 1SL2A 1EP4A 4OL8A 1SL1A 4M04A 3NAIA 5L9XA 3KHRA 4TLRA 3AUOA 2IC3A 1SKRA 1DGSA 1ZQSA 3OSNA 1IKWA 1KLMB 1VRUB 4X5VA 2YNHA 3JYTB 2FLPA 1NK5A 5D3GB 4TQRA 1XR5A 5F9NA 4E0DA 4I2PB 2VG7A 1U49A 9ICJA 2F8EX 4YR3A 1C0TA 5KFMA 4TN2A 2JEFA 3RB0A 1WNEA 1RPLA 2D41A 5KFXA 3KK2A 4NLQA 1XC9A 4RT2A 1ZQMA 3C21A 1KFTA 5BPCA 5DBBA 5KFIA 2NRZA 4M9LA 5KT4A 3ETLA 4IR1A 2W7OA 4XPCA 2HHSA 4B9LA 2BKEA 1U4BA 2B6AA 5HBMA 3HVTA 4ID5A 2AQ4A 3KLIB 4B3OA 3C5GA 5KFUA 5DG8A 2ASJA 4B9NA 3KK1B 3LWMA 4YG2A 4DQIA 1NHUA 3GILA 4M6WB 3T5KA 1L3VA 4RW6A 5DGAA 4XRHA 1SZPA 2XI2A 4IQVA 1KRPA 3H5UA 1ZTWA 4R64A 5J2MB 5J0QA 3JPSA 2Y1JA 3M8RA 4PGXA 2KFNA 7ICKA 4ID5B 5DG9A 3GIKA 4PUOA 3B0XA 8ICJA 3DLGA 4ECRA 3G6XA 3QE9Y 5CYQB 3T5JA 1ZQNA 3ISDA 4QZGA 1RT4A 5J2AA 4DL4A 2JLEA 5KFBA 3HPOA 4I2QB 2J6UA 3KK3A 1UT5A 3RR8A 3T3FA 5KT6A 4DWIA 4XA5A 3QGIA 5BOMA 2OPSA 2XC9A 3RRGA 2HNDA 1GX6A 3EZUA 1S77D 8ICZA 4KITB 1N56A 1VRTA 4ZPDA 7ICTA 2ZTDA 1IM4A 3M8PB 1S6QA 1U9LA 1TK8A 4Q8FA 1RT7B 2JC0A 2WK4A 2WCXA 2I1RA 4ED1A 2HNZA 1NHVA 3ICLA 1FK9A 4YQWA 1EP4B 1FKPA 5KG0A 1SH2A 4NZ0A 5KFSA 2IBKA 2AU0A 3QZ7A 3AU2A 2BPGA 1J5OA 4FBUA 1ZQLA 4G1QA 4NXZA 1ZQUA 3GYNA 4ZVGA 4F5OA 4NLRA 1ZQJA 1JLCB 4I2EA 5HLFA 2R8JA 2OPQA 2ZD1B 5J2QB 3HKWA 3TAPA 4EEYA 1BPBA 2YKNB 1CUKA 3GV8B 4TY8B 3OLAA 5HP1B 5I3UA 4BXOB 4RNHA 4K4TA 1A76A 1S9FA 4GXJA 1I6JA 3IRXB 3ORYA 1S48A 4NCGB 3BSOA 1MSWD 2OPQB 4K4HA 5J2QA 4C8NA 1D0EA 1TQLA 3KOAA 1S97A 2ISPA 5DBCA 3CIZA 3KJVA 3PVXA 1TKXB 4I7FA 3FQLA 2GC8A 4R66A 1N6QA 3TFSA 4TYAA 4YP3A 2W9BA 1D9FA 4RW6B 4YFKA 3MDCA 7ICVA 1RA7A 3KNAA 2D3ZA 3DRRB 2R8KA 7ICJA 3C6UA 1RAJA 8ICSA 3TAQA 1S0NA 4IFYA 2ZUCA 4NY8A 4I7FB 9ICTA 1RT3A 3DLGB 4EYHB 4J9MA 4O9MA 2B5JA 4QZ8A 4YXJA 2HVHA 3UQ2A 3RTVA 2F1HA 4RUAA 4MFAA 2A1JA 4FS1A 3I0RA 1RT5A 4X2BA 1ZQCA 3MGHA 4IR9A 4ED3A 5JXSA 3TI0A 5HNKA 4YD2A 4M47A 5JUMA 5D49A 1SH3A 3V72A 4URQU 4O3RA 2VG5A 4ECTA 1RT3B 2W9CB 4IFVB 3PNCA 4O44A 4YMOA 5CYMA 2FVSA 3V7KA 2ZUDA 4XPEA 8ICRA 5F8MA 3SZ2A 3KLHA 2ASLA 3QEAZ 4WE1A 2BCRA 2XGQA 9ICQA 9ICMA 4KB7A 4GXIA 5F8GA 3DI6B 4BGDA 1TL3A 2FJXA 2R2TA 1BPEA 4RW7A 4F93B 4URSA 2YNIA 3SV4A 3V6KA 3OJUA 2UVWA 4QWCA 8ICMA 4ZVHA 4LZGA 3OLBA
chains in the Genus database with same CATH superfamily
1RCOB 1DQ8A 1JLQA 4IUFA 2PFQA 5CABA 3DM2B 2WW4A 2XO7A 4BWMA 8ICIA 3UMCA 4X62F 2GJ2A 3UR0A 2AJ1A 3BS7A 5DJBA 2HVEA 1RZTA 4I2CA 4DHVA 4RO0A 2KM8B 2K06A 1PG5B 2DXFA 4TUPA 4DV7J 4K7QA 2R2RA 4DQQA 4RQMA 2CADA 4WP8A 3GFYA 1OPZA 3PKYA 4DS4A 3UWTA 1FVSA 4L3NA 5KFLA 4C3MA 1ZPWX 3RZAA 3MR5A 1JJ2R 2MPUA 4K4VA 4LF8J 8ATCB 1L7MA 2F44A 2VD3A 1RQLA 2HFOA 2ZH6A 3BS5B 3POTB 4IH5A 2YX7A 4PQUB 3TVYA 4RUBA 3A13A 1FWCC 4BC7A 1FWBC 2W43A 3FSXA 4KT0C 2KVIA 5HO4A 1T95A 2EFGA 4US9A 3D0GE 4UAUA 4BX9C 2HVDA 2V8HA 3CNQP 1FKOB 5J2EA 3IC1A 1WC6A 4XTTA 5HQ8A 2Z57B 2VODA 1JKHB 5K8NA 3DYAB 5K20B 4DSEA 3CCTA 5IIKA 2WB1F 4ECZA 3ZO7A 2P50A 4F91B 2HBRB 3I9V9 1HNZF 4PL1A 3HM7A 4P73A 4ICLA 1CJKB 2UUWA 5HHIA 3R97A 3LK9A 3F2BA 1KRBC 2CPZA 3HT0A 1ZS6A 4HACB 1NDLA 2BOAA 1H74A 5EUHA 4FVMA 3VAHA 3ZTSA 4ZVFA 2J0XA 2IHNA 1XMQF 2UBPC 2MZTA 3O3LA 3KLEA 2P9BA 3GCXP 4C8KA 3CCMS 1QH9A 5HVHA 3CE8A 2QFJA 5K5MA 1O03A 1HD1A 3QUCA 2BCVA 4JB3A 1VQ5S 2CIMA 3D6JA 1FX2A 1RTHA 1HMVB 2KHQA 5AM2A 3IHQB 2XO6A 2C2NA 5HI7A 2Y9TA 3QIPA 4L72B 2ZHAA 3W66A 1DQAA 3DN9A 4EPBC 4JOUA 2OTLS 2NLWA 1P1TA 4USAA 2AGPA 2FC8A 3CUNA 1APSA 4F0KA 2VA2A 2AQOA 3NS1A 3ILJA 2K4PA 3IR5B 4KLOA 2P6UA 1VK8A 3QT8A 1TL7B 4LFCF 3D6FB 3Q24A 1XO0A 1SH0A 4O4GA 1L7OA 1ZM2A 4CTAA 2AYMA 2VQEF 4DOBA 5D0HA 4FF1A 3QO9B 3QRQA 5J1PA 2AYBA 7ICIA 1C2PA 5HJYA 2KEYA 1N5VA 1HYSA 1FESA 3E01B 1PO9A 4AYBC 2ZJQQ 1U48A 4YFUA 4E8UA 2GMLA 2EH9A 5F9LA 4PQUA 4Y2YA 1B7YB 1BXNA 3NOCA 1Q7LB 3CCES 3WDOA 3BS9A 4C5YA 4ZVUB 3M9MB 1Z1BA 1HYSB 3GIJA 2DHXA 2XLJA 2WFAA 1V51A 1HBUA 2YKAA 4EU0A 3KYLA 4M5KA 5IINA 4NPOA 1HI1A 3NGTA 2CG8A 2GGPB 2FYXA 5BR8J 9ICKA 4WWSA 1XO1A 1PC5A 3QEBZ 4DV1J 1LW0B 3DV9A 3ITHA 3LW5C 3HHLA 1HA1A 3C14A 2VV5A 2WF7A 4KLLA 1TL3B 4ZVSB 5F8HA 3D2NA 4C8MA 4PJ0U 1TVRB 2LQBA 5HN0A 4KV8B 4F5NA 5EWEA 1KEJA 1R6YA 3G4SS 3Q8RB 2HVZA 3WIUA 2DY1A 4PGYA 2FLLA 1LFPA 1QLNA 1OW5A 3NNAA 3NBPB 1ZAVA 2DHAA 5A8RB 1X60A 1X0FA 1QSSA 3T19A 1FWJC 1N60A 4Q43A 2YNFB 4DFPA 4G1PA 3TZZA 3WK8A 3K8WA 2HMXA 4QW9A 8ICGA 4QJVA 1FK9B 1Z1ZA 4WZMA 1S4FA 2E8MA 5IIMA 1QAXA 1RKIA 2AJQA 3VQSA 2E29A 1FJ7A 5J29A 2DNPA 4PXEA 1HNVB 2M0NA 3M8WA 2W11A 2ERRA 2J9EA 5KFDA 2QA1A 4USMA 4G9BA 1RBLA 4PPZA 3SENA 8ICAA 2P9EA 2QMUB 4MF8A 3NKYA 3MAAB 5AKHA 1N54B 4PHPA 3TQEA 3LSCA 3AJDA 3BQ7A 3MPDA 1FFUA 3IV6A 4JI5J 4J7CA 1JLAB 4ZIWA 4CNZA 3MR3A 3VZHA 1LVHA 1UWBB 4KC5A 1Y7PA 3KZXA 1ZQEA 1OPIA 4TU8A 3CO0P 1OIAA 2J7WA 3I31A 1YGYA 5GAEI 4Y28C 2ZOFA 4P10A 1S99A 4LVOP 5HMZA 1SKUB 4LRFA 2R8GA 3PIOQ 5ALOA 3MUTP 2UUCJ 3JAMU 3ZTPA 4DOCA 5GAHU 4NLZA 4AT1B 3MABA 3TJAA 4KLSA 1L8OA 1IJFB 5HBMB 3CC2S 3W2WB 3Q23A 2KOBA 3CMQA 5KG2A 1FNOA 4IG0B 3IS9A 1SJ1A 2XMVA 3QU5A 4UARA 2V4QA 2VUGA 5CXTA 2ZNZA 4RR5A 5C25A 1TVAA 3BO2A 1D09B 9ICUA 4OX9F 1RDRA 3ICJA 5DKWA 2RRNA 1ICEB 2EK1A 1ZD4A 1XBWA 4X4UA 2E1MC 2DWQA 1DK2A 4Q2MA 1MQ2A 4RW4B 2PA8D 2VG5B 3UDCA 1FRLA 3KLHB 2W9CA 5CYJA 5DM7Q 1SL0A 2VIXA 4CYUA 4TVAB 5KOWA 4K2JA 4DG1B 1EJTC 2AW0A 2F40A 4DV2F 3T79A 3EZOA 3MEGB 1AYEA 3IFEA 1KCXA 2IA6A 2MSSA 2KZ3A 3JSMB 5E3QA 5MLCV 1FKAF 4QIWC 4GLXA 1XSNA 2MKHA 4RUHA 3QGKC 2BW2A 1KRAC 5H9FJ 5ALQA 4J9QA 1R9YA 4UTGA 1T94A 4C8ZA 1MQ3A 1S5LU 2FPKA 3EE3A 5FIIA 1FFGB 4WK1A 4P4MA 2XG8A 4PWWA 4R65A 1LEOA 4NJ8A 2F5GA 1H3DA 4RKUC 2VHLA 2Q79A 2H5JB 2OPPA 3WK5A 2JR5A 3QUTA 1IWGA 1NSKL 2HNZB 4CLLA 2MY7A 1LNQA 4AQYF 4J9UE 4FDFA 4C8OA 4YR2A 1FNMA 2HHHJ 2BQRA 4O5EA 3W5ZA 1L8LA 3FBCA 4KX5A 4Y2JA 4ILRA 2E1AA 2AH5A 2LYHA 3MD3A 3LPYA 5IV4A 4KPYA 1JXEA 2EBGA 1WHYA 3SDEA 2D3OR 2W8KA 1H2VZ 4M5IA 3PRBA 1L3SA 1ZD5A 2JXJA 5KAIU 3PRVA 1XNRJ 3DRXA 5FDLB 3PO4A 2BUNA 3M9OB 3HFVA 2N1RA 3CP8A 3E2EA 2D6FC 1DXSA 4BJQA 1MU2B 2V8DA 2UXCJ 4TUSA 1TAQA 5LSRA 1PIEA 1H38A 3PACA 2Q4TA 5EHHA 2QMWA 4XAKA 1CULA 3T1HF 1E9ZB 5CD4A 5J0OA 3N6LA 3MM5B 2BJDA 4OYMA 2ZE2A 2BJ1A 1ZRNA 3D2QA 2E1RA 2K4HA 5C5JA 5I42B 5RUBA 1PAUB 4DF4A 4UY8T 4M5NA 1HNWJ 2YWWA 3ULHA 4UW2A 3S01A 3JXOA 3CNHA 1YZ6A 1XQIA 2F8HA 4QR2A 1YG0A 4NL9C 1FWKA 3ETMA 4TXSA 2FIUA 3WC2A 2YQ0A 4CIOA 2D69A 1IVZA 1VLBA 1T8EA 5GMDA 3H8SA 3DOKA 3EXYA 2AHOB 2Y9UA 1UW9A 3GZ7A 4UB6U 2YNGA 5J2MA 2QJ3A 3NCPA 2QC3A 1AROP 4IFVA 1Y3JA 4DSJA 4USVA 4FYDA 4G6VB 4K5SA 4OZJA 1JN3A 1RXWA 4I0WA 3VGVA 2HSZA 1GX5A 2H1YA 1EARA 4Y2MA 4ZOSA 3Q0AA 4WU2A 4LRAA 3CWJA 3AXMA 2GAHC 4FVCA 1ZQPA 2DY9A 4BKNA 2FJVA 2JV3A 3PYGA 2MQPA 4X64J 4RQ1A 5ETOA 4IOBA 4H4OA 1OWXA 2BRLA 3CC4S 7ICHA 1WC3A 3EM1A 2UVVA 4I29A 1UT8A 2HQ3A 4DUZJ 4ZPBA 3BO3A 1Q82T 2R8IA 2ADCA 1X4CA 4DR3J 1U2CA 4GXKA 4I28A 1X5OA 4UQGA 2LEBA 3HKZF 5DDOC 4EFAC 2LA4A 1X4BA 4DFJA 2E3TA 3UXPA 5AK5A 5KG6A 4ECUA 4KLFA 1Q8BA 3AM9A 3JQJA 4G1QB 4J9LA 3TZWA 2ATCB 3ET6B 2ROPA 4QPXA 4OO1J 3L7UA 3B0YA 4PR6A 2QO3A 3CJ2A 4OI4A 4OJLA 3NS6A 1LW0A 2ZOMA 2CNLB 1T11A 3P5TL 3CMES 1IR1A 1YJUA 2LEPA 3GIIA 3VV2B 4XQ8A 3A8EA 3LH2S 4ALZA 3SEOA 3PYFA 4IQXA 1SBRA 2DD8S 3PIPQ 2WW8A 4K4UA 1UVMA 2ZITA 2KVCA 3LP1B 4ZP8A 5B0DA 3R7SB 2R18A 2KTQA 3TUPA 2V4JA 1NK6A 4A8SA 5BJRA 5DQIA 5M2UA 2YWFA 3FQKA 1ZA1B 2HAIA 4C6AA 1LQ9A 3D6MB 2B51A 3DFEA 4GKKF 4FO6A 4O3PA 4KO0B 4HI1A 2RKIB 1U47A 2OWOA 4FN5A 2GWSA 3E58A 9ICXA 3VAIA 4QYZJ 1U8WA 1FIQA 4KGMA 1HNVA 3TX0A 5KFVA 1U0SA 5DZ7A 2B56A 2CKWA 4I2PA 1NPKA 3VCDA 1N34F 4ZVPB 2WAQF 3PMNA 4RUCA 1T02A 3OTQA 4OV1A 1RTJB 5LXYA 2DIUA 3I56S 1TL5A 3M8QB 2R7RA 1N33J 3TZYA 4DL5A 2HHUA 4LF5F 2LYAA 1MU2A 1R43A 3H5XA 1FE0A 2DXEA 5EWGA 3QU9A 2HRUA 1TKTA 4ZVOB 2Z00A 2DHSA 2ZVIA 3RAQA 5B5EU 3WU2U 3AU6A 3BH6B 4JV2A 2V5HG 3RAMA 1J5EJ 3N5BA 1W26A 3F0NA 4CTAB 4Z6CA 1NH8A 2XI3A 2GOKA 1PCAA 3ZZYA 1NFGA 4NV0A 2MU2A 3CJ3A 1FO4A 1IQZA 4GO5X 5F0WA 3ZD9A 5D0RA 4P4OA 2VIHA 8ICCA 3F5EA 3BSCA 1N0UA 5B0FA 4OQJA 2H9ZA 2VANA 4H4KC 1BQNB 3U27A 4DR1F 2M0GB 3HX0A 5LXXA 1BPYA 2J0WA 2EPIA 2E5LF 4F72A 3J7YI 3TAMB 2AZ3A 2OP5A 5B09A 3IRUA 4DSKA 1YWXA 1N5YB 5AI9A 1FWHC 9ICSA 1RHUB 4QZIA 3CJKB 2RDDA 5HROB 5DDYA 2WONA 3OW2R 2VOPA 1DLOA 5ETPA 2R9LA 8AT1B 2BZ2A 2FZCB 1S5ZA 4DSFA 3QAUA 2DEJA 3NVVA 3LO3A 3MECA 3LTOA 4QZHA 3IMQJ 4WE1B 2ZIWA 1XSLA 1ZQXA 2LXUA 3CGIA 4M94A 3MM8B 4B9MA 3GJSB 2E5HA 3GGMA 5G0RB 2WVCA 1FXDA 1HQEB 1Q95G 1C4CA 9ICPA 2YNIB 1ZJMA 4M9HA 1O5JA 3PX4A 1XWLA 4RPYA 3FEQA 1ZQQA 2A10A 1N5XA 3TACB 2HGNA 2JH3A 4OHZA 4RNNA 4UB1A 2V6AA 1WHXA 1NK7A 1CJVA 3MGJA 4M95A 5KFGA 5CR0A 3Q22A 2ZZMA 3RW7A 3HP6A 3PNIA 2UU9F 2BCQA 1NMEB 3I0SB 2I6XA 1MC8A 1ZQBA 4RPXA 4CLZA 1RAOA 2HIQA 4RNOA 5HHHA 1GT8A 4JI7F 1DFDA 1R0BG 4I6YA 5KL1B 2VB6A 4Y2IA 3CW2C 1FVQA 1OSDA 2G07A 3KK2B 2NPFA 3DEEA 1HWJA 5ALIA 1RWPB 1Q8KA 1F3VA 3QATA 2XULA 4OYXA 1H7WA 2O66A 5KG7A 2AQVA 3KJNB 8ICYA 2LDYA 2F4VF 2FVRA 5ALVA 1PYOB 1N2XA 3KK1A 4M9JA 1I51B 4OJGA 3N0VA 1D8ZA 2VA3A 4PEOA 1T9XA 4DL6A 2E7VA 5A2QY 1N36J 5AXLA 5B08A 1JI7A 3LNPA 3AQEA 2Q43A 2WVBA 1VQMS 4NL5A 2EKYA 4LF4F 1EETA 2RQ4A 4DSLA 1RYUA 1QDUB 3TYTA 2FVMA 1WEXA 3QRRA 3OR1B 2XCAA 9ICIA 4TLQA 4DUZF 5HMLA 5K8PA 4IRKA 1KP6A 4ANCA 3I28A 3KK3B 3GFKB 4QWDA 3M6KA 3H8YA 3QLHB 3W8GA 2CUYA 3HX9A 4Z6EA 4R63A 4MEYA 2ISOA 1RXVA 2G0CA 2AKWB 2QL5B 4AYBF 4DMZA 7ICRA 1IKXB 3FMWA 1NKCA 1NDPA 3MMCB 3MAQA 2V9WA 2DGVA 4WTYA 1MWZA 4CH1A 4FFDA 3OVAA 1TVRA 2G1DA 3MEGA 4NXMF 2CQ4A 1NAQA 2B9YA 2BANB 3ENVA 4NLTA 3TRGA 1A6LA 4ZJLA 3MOJB 4PZNA 1QAJA 2AIRB 1LOUA 1NBEB 4JI4J 3C3LA 3GG1A 2X1AA 4DYKA 4RT3A 4G3IA 2BE2B 1FD2A 1D1UA 3HHKA 3PX0A 3DU6A 1GXUA 2UZAA 2YWGA 3EWAA 2KN7A 3QMQA 5IIJA 2HFUA 4Y2XA 1FRKA 1HWLA 3SAHA 5L1JA 3Q8QB 1OSCA 2L9NA 2IOFK 1FX4A 2QLXA 1RA6A 5HP1A 4LVSA 4RZRA 3K5MA 1FT8A 3CJQA 3SQGA 3JPTA 1U2FA 2BE2A 2COLA 5J2NA 8RUCA 4NCBA 4ZH4A 1XIQA 1RAIB 4NX9A 2EXUA 4CQCA 3BSAA 5A8WB 2CAJA 1NB7A 2MQQA 4UOGA 4ACOA 1Y4ZB 3FKBA 4ZP7A 3KJFB 4ELTA 4DPWA 1WC0A 3N7SC 2AP6A 2W9BB 5L39A 2JH1A 3B4DA 5DBAA 5A8WA 2M2BA 4LR8A 2BYCA 4RW4A 4V19X 1L7NA 1RAGB 2BA9A 4DI6A 4RBUA 2QSWA 2IA0A 4J9RA 4ZP6A 3IWLA 1JMTA 3KLGB 3BBFA 1YJ9S 3Q8YA 3N28A 2ZUBA 2ZJ8A 4B3RF 2GQQA 1UAWA 1A5KC 1VBKA 4DLEA 4NLGA 1Y9OA 4RQ3A 1VQ8S 4C60A 2HFNA 3ZZ0A 2WF9A 1X5SA 4RDVA 2APOA 4R8UB 5BYRA 3KLGA 3S8SA 4YDXA 2VC0A 2B9EA 2HI0A 1WSVA 2J6TA 4TYBA 3W3SA 3CO9A 4EO8A 2P2CB 4PWDB 3V7LA 2Y0SC 1IBLF 2VF3A 4EUVA 3QQCD 3M8QA 1NRKA 2CQ0A 4C4TA 2W04A 2LBOA 4KHMA 4Q7AA 1Z00B 4RNFA 3PMLA 3US5A 3JTOA 2IMRA 4PWDA 1SIWB 2QB0A 4WCEQ 1KEKA 4Y2TA 3DDKA 2KXNB 4FXDA 2YH0A 4KHRA 3H0RB 1SL2A 1EP4A 2BE7D 2RUGA 5E3RA 1NPRA 5L9XA 3NAIA 3GCWP 5KNIA 3QU4A 5JVGQ 1KLMB 1N32J 1U1LA 4EPDC 1OY9A 4L6V3 4EK2A 3JYTB 2FLPA 2J7UA 2CVEA 4E0DA 4RX6A 1RZMA 4HI2A 3H25A 3MEKA 1FFSB 3PXGa 3V5RA 2PD1A 2F8EX 4YR3A 1F9HA 4TN2A 1R8AA 3RB0A 5HMEA 4ES1A 5KFXA 3DUGA 2V68A 3KK2A 4N5SA 1KFTA 3UBPC 3MTWA 3F2DA 2CYYA 3M8YA 5KT4A 3ETLA 2DR5A 2AJ2A 4DXLA 4XPCA 2NV3A 4DPOA 1U4BA 3HVTA 4ID5A 3ET6A 4U9RA 1X7VA 5A6PA 2W03A 3F56A 3K2YA 1NZBA 5KFUA 1UQVA 5DG8A 3KK1B 4G7EB 3OV7A 3FVYA 2CDRB 3SCLE 4DQIA 1NHUA 1FWEC 4I6WA 2RH3A 4PXCA 3DLHA 1FE4A 4C7YA 2VC1A 3O1LA 1M6YA 1KRPA 5J2MB 3CCLS 5J0QA 1KQGB 4P75A 3PEJA 4PGXA 7ICKA 4ID5B 2GVZB 2F3JA 2DNZA 1K44A 5ALFA 3W62A 4B6JA 4ECRA 3DLJA 4CP5A 3IG8A 1UKUA 4O23A 4OZ2A 4CLKA 5L8RC 2LU1A 1CQMA 2JLEA 3CDBA 3BKUA 2QS8A 4LFCJ 3HPOA 1ZM4A 3NLCA 1S7HA 5AI4A 3H0MB 4YY3J 1UT5A 1RU1A 1TU0B 2SXLA 3RR8A 3VAGA 4DWIA 1ROFA 1VIOA 1TMJA 4Y2VA 4RWWA 1GX6A 8ICZA 1N56A 2R3VA 1IM4A 2BV3A 1U9LA 1TK8A 1RT7B 2WK4A 4MJKA 2I1RA 4AXIA 2HNZA 1KD1T 3ICLA 4M5DA 1OJ4A 1SH2A 5HATA 1YSJA 1N0VC 3QYPA 2IBKA 4I1TA 1VQPS 4R25A 3K17A 1XMQJ 4M1KA 1SC4B 4FPIA 1J5OA 4FBUA 3EDRB 2UZ9A 4G1QA 2PC6A 2BM1A 1W7WA 1ZQUA 2KG1A 4NLRA 4I2EA 5EE1A 1TTHB 5J2QB 2ZD1B 2K4EA 3HKWA 2HS4A 1WOSA 1CUKA 3GV8B 4JV5F 4LBPA 1U1KA 3U02A 1M1HA 2EDUA 2AJFE 2MY8A 4BXOB 4RNHA 5I3UA 3SQOP 1A76A 2F8KA 3JSBA 5D78A 2QA2A 3IRXB 3ORYA 2QT7A 3BE7A 1VCTA 5ETNA 5J2QA 4C8NA 2ISPA 2VDHA 2RT3A 3CIZA 1TKXB 5ALJA 3P96A 2GC8A 4FF3A 3BBCA 1DAXA 1N6QA 3CTRA 1VQ7S 2KE7A 1D9FA 1RHKB 1JK9B 1KBUA 1EQMA 3R1HA 5F3ZA 7ICVA 4ZCLA 3MPVA 2D3ZA 3DRRB 2R8KA 3C6UA 1RAFB 2XHWA 3R3TA 2FLOA 8ICSA 3TAQA 1Q1KA 2ZUCA 1RT3A 3DLGB 2B5JA 4DR6J 4YXJA 2HVHA 3B4MA 3VR1A 3MGVA 1CS4B 2VJ5A 4RUAA 1UVNA 3J7YU 3PFOA 4MFAA 2A1JA 1RT5A 2XYGB 2CPJA 4ED3A 2KJ9A 5HNKA 4YD2A 3DDNA 1Q86T 1YDLA 1I1GA 1SH3A 1IR2A 2CVIA 1BD6A 2A3VA 4URQU 4RQNA 4DN0A 2JWNA 2BXJA 3A3OB 3NXZA 5SZTA 3CCSS 3KNGA 4NXMJ 3QEAZ 3I9ZA 2HGMA 4NCAA 1WKLA 4X62J 1U8SA 2R2TA 1BPEA 9ATCB 2G09A 4F93B 4I4BA 4QWCA 3WK4A 3AFGA 1RYSA 2HQGA 3H2VE 2HS0A 4Q0BA 3F73A 2HYIB 2E1FA 4D3GA 2MQNA 2JRSA 3TP2A 2BJ3A 1VQSA 2OUGA 3H2LA 1TFYA 4JB8B 3MZIA 2F77X 4NM2A 1CG2A 2JRZA 2BANA 3CCZA 1VQNS 1UTAA 1F2HA 1P27B 1FWLA 3T6BA 7ICEA 3K1ZA 3A12A 5J0RA 3AB2B 4M5GA 1YNYA 1MN7A 2EC0A 1FXRA 2YMPA 4QZVB 2FTRA 1LWCA 3JYTA 3E01A 1SXDA 1VRUA 2GQ2A 4LH8A 1XR7A 1SIJA 3D2WA 4F4XA 3LVWA 4DV3F 5AI0A 1ZH5A 3C8YA 2E8NA 3M8ZA 2VFTA 1K1SA 5H9FK 2MRLA 3MEEA 1VQKS 4PYAA 5KFZA 1PGZA 2ZBIA 2HQDA 1SIZA 5CA7A 5LMUF 2E1CA 4UZCA 4K4ZA 2Q6BA 3MEDA 3EXCX 4NMLA 3NGUA 2KKVA 2HHVA 2CNOB 3DNCA 4UATA 2KJVA 3IRWP 2CRXA 2WTFA 3BN7A 1JX4A 5BYQA 2FVQA 2FVPA 5KFAA 4KRWA 4CM0A 2KRBA 4B3ZA 4KYZA 3T8LA 4OHYA 5T7LB 5THWA 3KHLA 2OI2A 2OEMA 4KV8A 4I2BA 1QE1A 3VALA 4M8LA 1PO6A 1PYTA 2DNRA 5KL8B 1D3WA 3ENQA 1DLOB 2CN1A 4RW8B 5J2FA 5IC6B 3KG0A 2WF5A 5J2HA 4ZJOA 2OIHA 1AZSA 1OXJA 3OR2B 3CCRS 5HMXA 1F0MA 2Y0SF 1O8BA 1KRCC 3J7Z5 3QJPA 3EZ5A 1CJTA 2H4WB 1J5OB 4YB7A 2P9CA 4P0PB 2Z2LA 1KTVA 3R6GB 1E6VB 4IKAA 1IG6A 2XQCA 2K1RB 1EJRC 5KTQA 3OUYB 1R9ZA 4RQ7A 3G6ES 4GVBB 3QGPA 5TZVA 1R31A 2V2KA 5KFFA 3ZZOA 2B0GA 2XEXA 3FEXB 1VRTB 1VK3A 2NYIA 1S7IA 4EZ9A 2KV2A 3GJTB 4ZVTB 3VF0B 4DL2A 2CJKA 5C42B 3MAAA 2XMAA 2VU5A 3U7JA 4ES3A 1J2NA 1F9FA 3BN4A 2ZBQA 4C3KA 4YR0A 1BMQB 2MKYA 2ZUAA 3BS5A 3FMBA 1YRUA 5DM6Q 2B7CB 1BWVA 1GTEA 1YVFA 2J8SA 4KLHA 4HH0A 5KAKA 2PLMA 2HNYB 4NI2A 2W25A 2D3DA 2OCEA 4AP9A 3AEVA 3V4IA 4ZPAA 2YPZA 5LMNF 2DHHA 4G7EA 2IYIA 2D8CA 2G5HB 3D0IE 2JNJA 4HEA9 2R2UA 1WF0A 4OX6A 1V97A 1V6HA 4P7TA 4O0IA 1WEZA 3EVMA 5B0GA 2ZFHA 1RTZA 3K5PA 4N47A 1NZAA 4ECVA 2E8PA 2EFPA 3I87A 2CWXA 4JI5F 3VC8A 2GVZA 1XTZA 2HFVA 4C0HA 4YDDB 2WONB 2MLZA 1TFWA 4C11B 1OYEA 3AODA 2QLJB 3F5AA 3OL9A 4U7CA 3QJJA 3IM9A 2GJFA 4EEKA 4NLNA 3J7AN 5E3PA 3K0JA 3OOQA 2F2AB 2RRBA 1KN5A 5A2QU 2ZKTA 2F1FA 3NP5A 2F8LA 2FZGB 4IFYB 2RU3A 1B4SA 2MAXA 3PZPA 2L5YA 1WSRA 5CA5A 5A6TC 1Z2LA 3VGUA 5EE3A 1LKYB 3N4MB 2H65B 5KG5A 4KH1B 1J97A 3P3DA 4NLSA 2DNOA 3PR4A 4OX8A 3FFIB 3HULA 1RHRB 3O44A 4ECYA 3MXHP 2CZ4A 4LF1A 1HPZB 3G82B 1FJGF 5CYMB 3LSBA 1CC7A 1IKXA 2RQCA 4DR5F 4IQUA 3BQTA 1Y88A 3VHQA 1I94J 2DT9A 5KT5A 1SCJB 2C28A 1K70A 1RISA 5F41A 4P72A 3R0DA 4CNSA 3FAHA 4LSNB 4KGKA 2F3NA 2QARA 1S57A 1O0PA 4RNMA 4LFBF 1TAUA 2F63A 4ZVQB 2DH7A 3UXOA 1K8AT 2IPOB 3LUYA 4X4SA 1TP7A 3T1YJ 1S0MA 2KNJA 3CJ4A 1KOOA 3DKDA 4W4MA 2H3ZA 3R2CJ 4LVNP 2EWHA 3V6DA 3ALRA 2OAUA 2G2OA 4KFBA 2DKOB 1J6PA 2HKEA 4UB9A 3NRWA 2IRXA 2UXBF 3QNWB 3KFWX 5JVHQ 3UQSA 3MM7A 2QL7B 3DLLQ 4J91A 1W2BR 4MF2A 3EICA 2YVSA 9ICHA 2VHGA 2B9WA 4M9GA 2IVYA 1NDCA 1HBUB 3G8QA 1XRFA 1KHWA 3IAS9 4MKYA 3HW8A 2I9GA 1EETB 2PO4A 4IRCA 1NJZA 2DKZA 2MLXA 1HKAA 2W2NP 3LOUA 2FY8A 4D3HA 1PSDA 3CDUA 2ZE2B 2XLIA 1FWPA 2DEIA 2OSRA 5AT1B 2PFDA 3IGHX 2IMWP 2E5SA 1XU4A 1X42A 3BR8A 3CDEA 3OPKA 1CC8A 5A0LA 9ICWA 3QIDA 5ALUA 4Y3CA 9ICOA 4LSLB 1UPMB 4OYPA 3M7DA 1KQQA 2ZIVA 3V6JA 1PJ6A 3QT7A 4QIGA 4I2QA 5HVGA 4LQ3A 1S1TB 1ZOTA 2UUBJ 3I82A 2VPWB 3LA0A 4K4IA 4LSLA 2L48A 1R89A 3M32B 7ICUA 2W01A 4I68A 3UI3A 4UB8U 3LP2A 1LK5A 4LR9A 3GIMA 1ZA2B 2FJAB 2O01C 4F4YA 1P8GA 4QZAA 2IJNA 4B9UA 3ADAC 2YB4A 3EGJA 2EFNA 1U25A 2VG6A 3N5FA 1FF2A 4Y00A 2XS5A 3NNHA 4ECQA 4LF9F 3M7VA 2MQLA 2Q1LA 3M8PA 1GO3F 4OJHA 8ICQA 2YBVA 4HHHA 1YTYA 2JGAA 4K4YA 2ZIXA 4NOHA 2JH7A 3AB4B 2WF6A 4KFBB 3TO8A 2HHXA 2MSNA 3G6YA 3WHIA 5ALWA 4QYZK 5HLFB 2K89A 4LFBJ 2A6MA 2KG5A 1LFWA 2PFOA 5LJ3Y 4J9OA 4UB3A 3JPRA 4GVLA 1HBOB 2AMCB 4K4GA 2JC1A 4OZNA 1NKBA 3CCVS 2YKNA 4DL3A 4FXWA 3GSIA 1Z3EB 2KJ5A 4UBBA 7ICLA 1X4DA 1YK9A 1S79A 3CT9A 2NYHA 2UUAF 4LF8F 2VQFJ 3D6TB 4NLCA 3A8IA 4L74A 3CSKA 1N48A 3CJ8A 1YITS 1WTFA 4WHBA 3EGVA 1EIYB 4WZQA 5DQGA 2F9DA 3UCZP 3C16A 2DHGA 5DDRC 4LQ9A 3J7A1 4C0OC 1H0HB 4AQYJ 3UNYA 5DLFA 1HBNA 1GKQA 1CJUB 4ED5A 5ALSA 1KKHA 1HQUB 3EPIA 4R8UA 3H4DA 4YMMA 2VA8A 3CXCR 3HLUA 1VYAA 4DG1A 1QQ7A 4JI1F 3B82A 3B54A 3DC2A 4CF5A 4ZJQA 3VTIA 4C8YA 3DOMA 2KRRA 3KHGA 2HW3A 1XNQF 4WYLA 1WG1A 4IDKA 1F60B 2V4JB 1NH7A 1T03A 1H2TZ 2BR0A 1IV8A 4NXNJ 2VBZA 5JRTA 4F0MA 4ATNA 1LKYA 2DF4B 3TANA 4GVBA 1P6TA 1ZQTA 2Y1IA 2NPIA 2RIJA 1DTQA 2HHTA 3CJ5A 3DRSB 4DL0C 4GKJF 3W9IA 4Y2QA 5FLXU 3TVZA 1LXNA 2EVZA 1T05A 1B7FA 1O12A 5C42A 4DZ6A 3PHEA 1LB2B 1RTIA 4DUYJ 2GOLA 2HZAA 1FTRA 2HG4A 3Q8PB 4QNLA 2KZMA 1KLMA 8ICWA 2GIFA 2R4FA 3AH6A 3EJMA 2J0QD 3UDEA 2L41A 2YNHB 2QARB 1WC1A 3OFGA 3RB3A 2N7CA 1ULRA 2U2FA 5EWFA 3M2RA 1V5VA 1TKTB 1BWEA 4XDCA 5T41A 1K1QA 2ZH4A 3OPXA 2FPLA 2LHTA 2F65A 2WOMA 3SFUA 2CJAA 1MROB 2KAUC 2QZ8A 2AWZA 4N8OA 4OZ0A 4QZBA 3R5JB 4JYAJ 3M2RB 1SWVA 1NCLA 1LK7A 1NDKA 5L1KA 4F67A 4LJXA 2A19A 3MR2A 1OS5A 1AFIA 4WTOB 2NXNA 3M9NB 2PMZD 1R6VA 3T5HA 3K4GA 2CQHA 1YJRA 1FKOA 1M5KC 2XYHB 2R8HA 1WOOA 2YX4A 3RBDA 4DR6F 1RK5A 3EX7B 1F5SA 1DOQA 5DLGA 5L1IA 1N34J 2EG1A 2CJ9A 1GH8A 2DFLA 3H4BA 5D0GA 4NEZA 2B0CA 3A4TA 4KSEB 2CG4A 3P49B 8ICFA 1X6JA 3FC9A 2HCFA 2CWKA 4TU9A 3GE9A 4F92B 4IH7A 3D2SA 2YQ1A 2CJYB 3F44A 2UVRA 3GJQB 3DOKB 2O3DA 4RW7B 1XSPA 2V8GA 4UAZA 2XSJB 1GKRA 2OMOA 2PT0A 2R7TA 3ZDAA 8ICLA 1DJ0A 3CCUS 2A1JB 3I32A 4HVZA 1RB0A 4R0EA 4WJBA 1TELA 3Q8VA 3RGIA 4J9PA 3NG8A 5F8JA 3ZTQA 1YJNS 4F3MA 2LXIA 3JTNA 3KJQB 3IAM9 4DV3J 2R7VA 7FDRA 5AK6A 3SMVA 3UPQA 1T4GA 2ZDOA 5AM4A 1RT7A 4B9VA 5DZ6A 4KIRA 4NASA 3DI6A 1NJWA 2KO1A 1BC6A 5KFNA 5CP2A 1L7PA 4DV1F 4EX6A 4QWBA 9ICNA 2VOOA 5GAEU 1M7JA 2AEFA 1MN9A 2DXDA 2RUSA 1HPZA 4N41A 3O5TB 1RWUA 3BGLA 4CO4A 3KLIA 5D4NA 2RHSB 4ZS6A 4KKOB 2VFUA 2R7QA 3AXKA 1RSCA 3OL7A 2XY7A 4NA2A 3IN5A 3P45B 5CB1A 3RAXA 3IRXA 2JVRA 1IM6A 1IKVB 2GQCA 1U09A 2HBJA 1XS9D 2B21A 2LQ5A 2VQEJ 1JLEB 4M0AA 4QIEA 3GYGA 4GFJA 2YQEA 3OFHA 2LMIA 3PHTA 2NSBA 2H5XA 1X5TA 3NS7B 4F4KA 2LM4A 4DL7A 2MUTB 3K58A 3V4MA 3ZDEA 2DYAA 2EZXA 7ICFA 3POTA 4OHWA 4KLQA 1U1RA 3T81A 5GADI 3FBEA 3C19A 1WOPA 4B17A 3ZZTA 1X0PA 1S6OA 4LFAJ 5KFOA 3AAWB 3D28A 2AV5A 1X9SA 3VQTA 4FNIA 3NRZA 2ZIVB 2V63A 3P6YC 4ENOA 3OFFA 2LQJA 4Z2XA 4DLGA 5I42A 2FJDB 1NK4A 3ZZZA 3KLFB 2QRRA 5EGYA 1VI7A 3HI9A 2KH9A 4DQSA 2IHR1 1PYSB 4DV5F 1Y00A 1L3TA 1PVQA 4B3SJ 3LYSA 2W2PP 4CGZA 1URRA 3JPNA 4Y2UA 1EQ0A 1JQGA 3DGVA 4HTJA 1SVDA 3RJIA 2FD2A 2AYGA 2ZXHA 3TQ1A 3PW5A 2HOQA 1ZZNA 3G86A 3IXQA 4KLGA 4MH8A 4DFKA 2P53A 4CT9A 2WB1C 4C4SA 2GAGC 1FJGJ 1S1VA 3MMAA 2MGZA 1N88A 4ED2A 1OUQA 4CNUA 4P2XA 2HBKA 2ROGA 3CPWR 4MFFA 3M1VB 3V2UC 2QL9B 2N3OA 3WKBA 3PYDA 2M9KA 1U6ZA 1QAYA 5J8YC 3DLKB 3CMAS 1XR6A 1UFWA 2JVOA 1XERA 1Y3KA 5C2GA 3UPFA 2ZG6A 1M5SA 1WWHA 2Z7JA 3C28A 2GZOA 5J2DA 3M30B 3W2VA 1GXTA 3I5BA 4TQSA 2B6AB 4ED8A 5H9EJ 5D46A 9ICGA 2HIYA 2PIIA 4PG5A 2XCPA 1NNDA 3A8KA 3WBZA 2MHEA 4WFAQ 2B9XA 2XSFA 3PSPA 4R0JA 5ALRA 3QO9A 4ZN3A 1IKWB 2GH1A 3C23A 2WHOA 2DBYA 1C7YA 4LF7F 4PXBA 2UXDF 3EVOA 3A8JA 2C22A 3DDHA 2BB0A 4NLPA 4C80A 3O7UA 4Y2AA 1UJ4A 2B6GA 5LMUJ 5LMNJ 1J2MA 1CLFA 1TMMA 2PXIA 5LSLA 4JI6F 2VZ9A 5CCMA 5L9NA 4USWA 2OFGX 3MCNA 1T9VA 4X4VA 3BQ2A 1U2RA 2FJ6A 4WXOA 1ZQFA 4OZ1A 4USUA 3OVBA 2LDIA 9ICRA 5HMMA 2VFRA 1DGJA 2YY6A 4Y6IA 4C11A 4DDFA 2HLTA 3KLFA 3DOLA 3PSIA 5IZHA 2MSTA 4BLGA 1CJTB 4CLPA 1S10A 3FZBA 3GMGA 2RQ5A 4A8EA 1C1CA 3UVJB 2GMJA 1L5UA 1K5OA 3MPGA 4DF8A 1S9GA 4M5HA 2H4YB 3C5FA 2KMDA 4UAYA 3LP0B 4U8VA 3DRYA 2P8IA 2E5LJ 1RQ0A 3I4HX 4F71A 3M05A 3EYZA 1BE4A 1IUJA 1CJVB 1XMOJ 2KB2A 2JEIA 2GW8A 4GRSA 4PHDA 1KVIA 1EJXC 4JI6J 4FXVA 1TZ0A 2HBZB 1XEZA 3GLJA 4KLUA 2CZVC 4ED6A 1ZQGA 4NWBA 1HLWA 2NUHA 1KQSR 3H98A 3GR1A 2HGLA 1AT1B 4UOFA 2IM0A 1OY6A 1VLYA 2BX6A 3H59A 3SCJE 4F8RA 7ICSA 4CCHA 5EN1A 1NZ8A 3BR9A 2KIVA 1PZNA 3QWUA 3K5NA 4JV1A 1TAMA 3ZD8A 3P4UB 4UASA 4NLKA 3M4XA 4OIXA 4QIWD 3G6VA 2XB2D 1RJJA 1IKYB 2D1CA 5A76A 2CQPA 3ISZA 2JFKA 1Z4NA 2K8GA 3MOZA 1IBLJ 3Q89A 2W55A 3K5LA 2XY5A 3HT3A 3QUQA 1KTQA 3SFWA 1V85A 4WPAA 1FDBA 5G5HA 5KG3A 3HHNB 2LCWA 2ZVSA 2KU7A 3C66A 2GHWA 2BCSA 2LVWA 3QWPA 3JQMA 3HO1A 4QU6A 3MCOA 3FRZA 1AFJA 2D74B 3THVA 5E3AA 1VJ5A 3AJ2A 2YKQA 5ETVA 1S1XB 4YB6A 2GCFA 2B4PA 1MW7A 2XMKA 4RL1A 3B8HA 3TADC 4QQBA 4EBEA 4ZPVR 9ICEA 4P2HA 1TL4A 2W9AA 1FXLA 4C97A 2V34A 2MGZB 1PUZA 1ZD2P 1TUVA 3TEGA 3OVSA 3DXSX 3T1YF 5FP0A 2YNFA 2JLFA 5J0PA 3KMQA 4QZFA 1LWXA 4B3SF 2AGOA 4CDGA 2YKOA 2ZH5A 4Q0BB 2QEXS 3TOQA 2LLZA 2YNGB 2M4MA 4NRUA 2RQKA 2DO0A 1WWVA 1DBDA 7ICOA 2V2QA 1ACMB 2WB1D 1C20A 4Z42C 2IY5B 1ZQOA 1REGX 1A5NC 3M6ZA 2Z8QA 2GSEA 4RWXA 4DR5J 4OZLA 2H3IA 2DBBA 2HNDB 1ZQZA 3BSNA 4AFFA 3CCJS 1JMSA 1JJHA 5AKKA 4CLTA 5FLXY 3OTEA 3HHEA 4QJFB 5A6WA 5J0TA 4OL8A 3Q2SC 4CI0B 1I5OB 1KOHA 4TLRA 3AUOA 4I64A 1SKRA 3OBIA 1ZQSA 3OSNA 1BLUA 4J90A 5HQMA 2H3QA 2PUZA 2M7SA 1PJ5A 4DV0J 3CDAA 3AD7C 1RJRA 1F6TA 3I96A 1NK5A 1XMBA 2MZJA 1E6YA 4NEYA 2KIWA 1WG4A 4I56A 2Y8WA 5KFMA 5IOLA 3E0LA 4NLQA 1XC9A 3I76A 1ZQMA 3TX8A 2ACMA 2BW7A 4C4WA 5DBBA 2DR8A 2CDQA 2AQ4A 3KLIB 2A6OA 1D9AA 2G4BA 2FVKA 2ACYA 2DNKA 1FTCA 4UY85 4B9NA 4Z7CA 4JYAF 1P1MA 2FGCA 2C2OB 4OYAA 2G9OA 1UETA 2K8BB 3OQ2A 3CCQS 1RAKA 3MPWA 4QOTA 1T9UA 4GIBA 4IQVA 2UP1A 3GWCA 5AE3A 1RI7A 2Y1JA 4YHHJ 3O6QA 4DR4J 1SXEA 2D9PA 4JI3J 2NXUA 4DV6J 5DG9A 1U26A 1YJVA 2DCUB 4AYBD 8ICJA 2LA6A 3JAMY 3G6XA 3QE9Y 3ISDA 3NCQA 4QZGA 1RT4A 4LF4J 5IT9U 4Y2KA 4LBIA 1AUSL 1RBAA 2NS1B 4Q5VA 2YB1A 1OY8A 4W90B 5GMKa 4KY3A 1HBMB 2XC9A 3N79A 1UPPA 4IQMA 1NUEA 5JJBA 2G2YA 1UVIA 3Q86A 1NNLA 5CD4H 2OHDA 1QTNB 2OGUA 4OD0A 3UVJA 1H2UX 4KITB 1YJ7A 1HHTP 2ICSA 3UO0A 4Q8FA 2WCXA 1X4GA 2JC0A 4X65F 3L3FX 3NGKA 5D4LA 2UXCF 2HK3A 3J80U 1GAOA 1NM2A 1COKA 3BGFA 5KFSA 1PBAA 2WAQC 4P6QA 2X1FA 1DK3A 3QZ7A 1U1MA 1LKZA 3IO1A 1U1PA 3MM6A 2Y1RI 1ZQLA 3GYNA 1RHQB 1V3RA 4PABA 2IFXA 3N01A 1WACA 3D3BJ 3KUEA 1HI0P 2Y3YA 2R8JA 2OPQA 4OJ3A 2ZIUA 1S59A 2YKNB 3OD2A 3OLAA 5HP1B 3HFKA 4DX6A 2C3MA 2MKIA 1UL3A 1FFWB 4NCGB 2I8EA 1H6KX 4X4PA 2EANA 4K4HA 3KOAA 2ZH2A 5IT9Y 1B4FA 3W63A 3TR5A 2IVFB 4CNTA 2HEKA 4R66A 2J8AA 4C0BA 5E3CA 4RW6B 1QVFR 1NPPA 5AE1A 2B8QA 2BJ7A 1RA7A 3KNAA 4AL6A 3FSYA 4CZCA 3HFZB 2XS7A 4KIAA 3PFEA 4NY8A 2KSOB 9ICTA 4EYHB 4O9MA 3AQFA 2J9DE 2Q66A 4DUYF 3NQBA 2GNKA 1RACB 3KDOA 1ZQCA 3HHDA 2RB7A 5JXSA 5E0OA 4MYTA 3B6BA 3HKZC 3V72A 3CD0A 3ZNJ1 1KWMA 3CD5A 4IFVB 4C9DA 4YMOA 3HVRA 2LMRA 1HNZJ 3F53A 4LRDA 2FVSA 2ZUDA 2XMMA 1WUUA 3KLHA 2R7SA 2ASLA 1RGVA 4WE1A 1POJA 3D67A 9ICQA 9ICMA 5B0AA 4KB7A 1SJFA 4NXNF 2RS2A 1EKRA 4BGDA 1X6IA 1TL3A 2AJ4A 4RW7A 1SJ3P 1AZSB 4WF9Q 3V6KA 2YNIA 3OJUA 2UVWA 3D1HA 4M5DB 3GRIA 4P0PA 2UUTA 4IQWA 1VMBA 4MIBA 4QBUA 3CD7A 1DARA 4ELUA 2WBMA 1N5TA 4A8WA 3R5CA 4JI4F 4CQDA 2YY3A 2C42A 4RQ5A 1SPBP 1V38A 5E41A 3ZC4A 4B3OB 1GMWD 2ZH8A 2HHQA 3HJVA 3RBEA 1NEEA 1Q8LA 2P35A 4ZCMA 3KD3A 4ITSA 1EJWC 2LU2A 3NASA 4DV7F 5F8NA 2Z2YB 3H5SA 3AQOA 3AQPA 1S1WA 1S0OA 2BJ9A 2WBRA 4PKDB 3M8SA 5KFPA 3TFRA 4DOZA 1M5PC 3OFEA 1KW4A 3NWRA 2W9MA 4R7WA 4KQZA 3NY0A 3PR5B 1C0TB 2C3PA 2WZ1A 1SV5A 1FHTA 1FRMA 1JROA 2PFPA 1K9MT 5ETLA 5CYQA 2EQYA 1AUDA 1RLDA 2FDRA 1MMNA 3WIVA 4WU3A 2XWYA 4OLPA 4MK9A 4FBTA 1XJWB 1VHFA 2UV8G 2RF2A 2BPFA 2PI5A 3B78A 5AM0A 4DQRA 4WBFA 3W64A 3FCHA 3N9UC 1N62A 4XUSA 3OXFA 3EGWB 4F3OA 5KG1A 1M5OC 1RWNB 1HWUA 4NYZA 1FDAA 7ICQA 2ZJRQ 3T1HJ 1SC6A 4JWMA 2VDIA 5C24A 2DK2A 3ILIA 4I69A 4EGLA 3FK4A 1A0PA 4HL9A 2VH7A 4UOHA 3ZI4A 1K0TA 2KHCA 1N5SA 4DFDA 1NKEA 3JQKA 1A5MC 3JTPA 4KLJA 4CEXC 1KR4A 3OHAA 1VIXA 3WK9A 1B0VA 3IP0A 1N32F 2DNLA 2YMLA 1PVPA 2P9GA 3PX6A 1DHMA 3RF9A 2HHPA 3HZEA 3SSRA 1WTBA 1IQTA 3TARA 5CZXA 1R8PA 1Y0HA 2CNKB 5J8YA 4LSNA 2ZC4A 1Q79A 2VG7B 1HQEA 2MMYA 1VLOA 3HD1A 3UD4P 2OXOA 5F0UA 1S0VA 4FNHA 7ICNA 2I5HA 1X40A 1YJTA 1HBOA 2ZM6J 5DB8A 2QIFA 1MG7A 1U1OA 4Y34A 4CLYA 3NVWA 4OX7A 1F44A 2YX1A 4K8RA 4E98A 2C2MB 1WF2A 1VQOS 3FZ2A 3SEIA 5J2PA 1WG8A 2IJRA 2Z4PA 1S1WB 3UN3A 2DQNB 1FO1A 5ALYA 1B70B 4WIQA 3Q8SB 3PCOB 3UD5A 2A2CA 4OI0A 2VPYB 2ODGA 3QX7A 2RHFA 2M70A 2BHNA 2DB1A 4XIUA 3P5BP 3I0RB 2AGQA 5I3UB 3N4WA 2CXYA 2Z30B 5G4HC 3FBBA 4MTPA 4OJ1A 4O3SA 4HHUA 1WD6A 1TUWA 1X9MA 3JB9k 2RS8A 1QD1A 1W2IA 2PDAA 2G1HA 4A46A 4M5LA 1S1UA 4F4WA 4FKYA 3K57A 3MCMA 1GQEA 2LECA 2HRYA 3MCSA 1SUQB 1A0OB 1KSPA 2HSEB 8ICOA 2YTCA 3SD7A 4HT7A 2YKPA 2MZ1A 1ZPVA 2B7BB 1MLAA 3HM9A 2QX0A 3V81B 1JRPA 9ICBA 5GAGU 4M9NA 3VVUA 5AXMA 5ALHA 3LGHA 5DG7A 1M5VC 4M63A 2YWHA 3K75D 4JI3F 2EW9A 1RT6A 1B0TA 1KBRA 4DS5A 3RRKA 1CVJA 3JPPA 4KX3A 1RTIB 2JSXA 2YKMB 2DRAA 5J0YA 2H5EA 2V69A 1CRXA 1C0UA 2VONA 1F5AA 4RU2A 1S1TA 2V4RA 4MT1A 3ONQA 4IOCQ 3AY0A 3ILLA 3EGZA 3SV3A 2O5DA 4NYOA 4CF3A 2BRKA 1P1LA 4UAWA 3ICXA 4ZHRA 4Z6DA 5A0YB 2RU9A 2QB0B 2R2SA 4MHVA 4P0QB 3HCXA 2PAJA 4K0KF 3M2VA 2EC2A 2OPPB 2ZBRA 3L7PA 3CJSA 2F7VA 3DM2A 1IIPA 4PRFA 5J2KA 5T14A 2FLNA 1MROA 2QB1A 1KFSA 4J37A 5D15A 2XMWA 4C7ZA 5ALTA 1BNPA 1ZBTA 7ICMA 4DR7J 4A8QA 1HIYA 5AKLA 1Z4UA 3J80Y 1JLGB 4FYXB 1G2EA 3D5MA 1T3OA 1NU4A 1NHKL 3UCGA 1JJCB 3J81Y 1C1BA 3DHXA 4YB1P 1UVLA 1S72S 5CWRA 2A1BA 2DIVA 1ZZFA 4QR1A 5DB9A 2VPXB 4NCGA 2XVTA 3BKTA 1KHVA 2IM2A 5C25B 1COOA 3QFWA 4KGVB 2KL8A 2CQIA 6AT1B 2KKPA 1PC4A 3OTCA 2JMGA 3X1LB 1U0HA 1N5WA 4IRDA 3MM6B 2DR9A 7ICPA 1RABB 4PYDA 3MGIA 3UE2A 1OYDA 3RJHA 2A3JA 3IR7B 4RU9A 1RJQA 3H40A 1K6WA 3BQ0A 1ZQAA 1UCVA 4R85A 3HSJA 3LP1A 4MFBA 1Q0NA 4R88A 4MEXA 1VC0A 1DZ5A 3MDAA 4JI0J 3GB0A 1PK1A 2F4FA 2QA4S 2Y8YA 4ZPWR 2H48B 1YRTA 2CPIA 2RF2B 2JLGA 2A18A 3PDNA 5D8HB 5LL6d 1HNXJ 2CQ2A 3WX8A 2ILZA 3EGNA 1R8HA 3HF5A 8ICKA 4FP9A 1WI8A 3C6TA 1O51A 2XIDA 2C3UA 3FDSA 4P9SA 2NYVA 3RR7A 5C0YA 1D8YA 2MKCA 3TNVA 2W7PA 4KGXB 2F8MA 5J2CA 4ZLNA 3NGSA 5IWAJ 3A0HU 3ZFVA 2CJBA 2MHNA 3C2KA 4OMFG 4I2GA 1OO0B 3NVZA 3C6TB 3GFHA 2I0XA 3WKAA 1EX8A 1RA0A 3OL6A 1S49A 4ZLPA 3PSFA 4DQPA 1NXIA 4LJMA 4ZITA 1ECWA 2MQ8A 1WEYA 1Q5VA 2OOFA 1BNOA 3C15B 3ISND 1UJ6A 2E9ZA 3QIPB 1EAYC 2FDNA 2W24A 2C2KB 3AJ1A 1ZETA 1WYGA 3MDUA 1R27B 1Q3VA 1GMWA 5GVQA 1IJEB 2JZBB 4PH5A 2RSQA 3SSSA 3A3NB 2HK2A 1QAIA 2KICA 1RDFA 1ZJNA 5AK4A 3R2DJ 1VFJA 2EAMA 4N7TA 4ILMA 2X1GA 3RG6A 2KM8C 2ZD1A 4OJ5A 5ETQA 2M9NA 2OSQA 4HKQA 3I0SA 1VQ9S 4K50A 2HBMA 4KHPJ 3E3XA 3TUZC 4RBTA 2HLUA 5IQ6A 1JXLA 3D68A 3BPSP 3VZIA 2GO8A 1EHWA 5ETTA 3FSIA 8ICXA 2KG0A 4R5PA 1KVJA 3R7BB 4F36A 2DJWA 3O0FA 3FGVA 4C98A 5G5GA 4LR7A 4ICLB 4KMUA 3NBPA 5K9FA 3EDQB 2ALZA 4JI2F 5FDLA 4MFBB 2GHVC 2VJ4A 4QWEA 3HMJG 3HVWA 3TA1A 4A8KA 3FYHA 5ALPA 1SI9A 1HUZA 4IG3A 2DGWA 3Q8LA 4ZIVA 2KDOA 3KLEB 1WKJA 2ZHBA 1CULB 1CEZA 4OJPA 2Z56B 1QQ6A 2IYGA 1CS4A 3ETOA 2VM8A 5F3XB 1ZYQA 3F2CA 1CI4A 4ZA1A 4IG3B 1V5IB 5IT0A 1HUOA 4HYKA 9ICFA 1N5YA 1ZXIA 3NRBA 1HMVA 2DNNA 4O44B 3RJMB 1JALA 3L7OA 2HWIA 1HNIB 1BVSA 2AX1A 3NOGA 4Y0FA 4ELVA 3LP2B 2V2ZA 1RAHB 2ZH1A 3P8BB 1CJKA 1X66A 2VG6B 4F2SA 4WJ3B 2HHHF 3R9LA 3MR7A 2AZ1A 7ICGA 1R8BA 5KOXA 4EPEC 3FBFA 1V4YA 2PMWA 4JUZA 5HMDA 5IV3A 3HDSA 4C4RA 1VC6A 2ESEA 4KN4A 4LIRA 5D3GA 2ZJ5A 1QJHA 1DY3A 1HJPA 2YQ3A 4F50A 2XMUA 4NLBA 4EZ6A 3RU0A 3MTKA 4CQ1A 1RYRA 5CH7B 1YLXA 1P7DA 4F3QA 7FD1A 1NI3A 3W5XA 4DEZA 3VAJA 3KFUF 3H42A 2K60A 4DZDA 3UQ0A 2OELA 4DX8H 2EBEA 3GTYX 4DU7A 2X3DA 2OEKA 4C7QA 2K8CB 4L3KA 2E5GA 1HD0A 4RW9A 4JI8J 2BQUA 1GMUA 1TKZA 2YX8A 3RBZA 4IQTA 3QU7A 1SUQA 2QA4G 4CDIA 3MF5A 2B5JB 1HQ2A 1SQGA 1U6BA 4FF4A 3CB4A 4DR1J 4M6WA 2X1BA 4U96A 2ZJPQ 2DNHA 2Q6CA 1KS2A 3C2PA 5KFTA 3IGVA 5FSDC 3W65A 2G2ZA 4KHPF 1L3KA 3CJKA 4KO0A 1U1NA 1Q46A 3HK2A 4ZCIA 4GY7A 4XO0A 4OV6A 2IBOA 4H54A 1NJXA 1Z00A 3NTUA 2DGOA 4YCXA 4RQ6A 1P9QC 1Y5LB 1NO8A 3C15A 2XWXA 3MR6A 4GMKA 4NLDA 1JLQB 1RM6C 1HEKA 1QE1B 2FHMA 1B3TA 4DCPB 2QT3A 4CE6A 3SFGA 4TUQA 1DRZA 5JMNA 8ICUA 2LYBA 2AQ0A 4H4MB 4C0ZA 2JEJA 3N7RC 4TKTA 2D9OA 3LAMA 1BPDA 5DS7A 4IS7A 2F1JA 4NMXA 1FWFC 5KFYA 2DR7A 4AQLA 4ZHRB 3JSMA 2DNYA 3KG1A 2DR6A 4PPDA 4US8A 2CXEA 2VKZG 3U1NA 1OQ3A 2YWEA 3L9ZA 2RMLA 4G1IA 4PCQA 3J81j 3SR6A 3VVTA 4YMNA 3OUYA 3C2MA 1FJCA 2H3VA 1MMLA 5AJ3F 4NYPA 2H51B 3C1ZA 1MA7A 1U24A 1TL7A 1C0UB 4CLUA 1BQNA 1KLNA 1SJ4P 4KQNA 1M1GA 3G9CA 4B3TF 3N7PD 4CO2A 4NWIA 5KT2A 4B9TA 5A8KA 1YRRA 3QU2A 2BQ3A 1MWYA 1JJ4A 2LEAA 3D3CJ 4TY8A 4BCAA 3H8JA 1UEKA 5J0XA 4EX7A 3CCWA 4XDDA 2BKNA 4FYYB 9ICLA 3KLVA 3IM8A 3EVWA 4I2HA 1Y5IB 4JMUA 2EG2A 1NOMA 4IO1A 4NA3A 2IOFA 1QTMA 4M5MA 3KJVB 2YH1A 2DNGA 1EKSA 3N6NA 1H98A 1PAEX 3EUNA 1SC1B 5B0BA 1MNEA 3TEHB 3DDIA 4C3LA 1XK8A 5GADU 4DBQA 3S1TA 4IO9Q 1HNIA 2OJ3A 1LV5A 2UUCF 4ERDA 2XY6A 1TV9A 3I1YA 2ZXIA 1JKHA 1BPXA 2XMTA 3IM1A 1QM9A 3DLBA 2NXEA 3DCAA 2HRTA 3GONA 3GP9A 1TFRA 1IBCB 4OCZA 4I2AA 2CPRA 3UD3P 1HIWA 2HFSA 1XNQJ 2WVDA 1HQUA 2O67A 2E1EA 1CBKA 2GHPA 2GMHA 1S8OA 5BYSA 1X4AA 1F0XA 4H4MA 1YMYA 2Q0ZX 8ICVA 3SCKE 2HWHA 3MECB 2W2OP 4N56A 4KBIA 3UMBA 1UEVA 4O5KA 2JDJA 2AJ0A 3LVVA 3UXNA 4X4TA 4GO7X 1QSYA 2OLWA 3ZDBA 1EF2A 2RD5C 4NLUA 3C46A 2XHCA 1B99A 1B43A 2OKQA 2NO5A 1IBKJ 5SUHA 4O3NA 3Q8KA 1H72C 2K4IA 1G7CB 2H3EB 1N4LA 1UCNA 2LQ8A 2GA7A 4P0QA 5J2PB 4BDPA 2MB0B 2BGWA 2KD1A 4BJHA 4V1XA 2MKKA 3DMJA 2V2VA 3DRPA 3SI8A 1URNA 1LWFA 2ZNYA 3ISCA 1HWKA 5K4LA 2L9DA 4L75A 4RLEA 2OODA 1QCKA 3EPGA 5HANA 2DGXA 5M2RA 1BQMB 3NNCA 3B9JA 4OFZA 4PAAA 2VASA 2ASYA 1Q7YT 1A6SA 1IKVA 1GXLA 4DPXA 3NMAA 5F3TA 2IVMA 1RT1B 2LP4A 2H5IB 4YB5A 3HVTB 2W54A 1MN8A 4EYIB 5KFKA 2ZZNA 8ICTA 1HARA 2ALYB 3RJFA 5CEHA 5J0SA 3V81A 2B3TB 2BOPA 4FYWB 3SDEB 4J9SA 3ZXWA 2HHWA 3W5YA 2FMSA 1RKJA 3W61A 2R7WA 1S12A 4OI1A 1VQLS 2H3FA 3PW2A 4LF9J 2FUG9 3H0LB 1RT1A 1GMVA 4P2SA 3QGGA 2DRBA 4LRCA 2L3MA 2CJXB 3R9KA 3BZCA 4JI7J 2ZTCA 2WHEA 1L3UA 3PM9A 2ZH3A 1XNRF 2PEHA 3MWBA 2K3IA 4BBYA 2KI2A 2B4VA 2EZYA 4HT5A 4B02A 1ZRMA 4YUDA 4YD1A 3ITHB 2ZUGA 1FCAA 1WG5A 4RW8A 1HBMA 1BY9A 5H1SV 4F5QA 5KFEA 4NA1A 1JIHA 2UXDJ 1RLCL 2CZ9A 5LM7E 3NL0A 4RPZA 2OPRA 5ALLA 1N5QA 1NZPA 2YXLA 3UN2A 1VBZA 2P66A 3QLHA 5L46A 1MMDA 4O5CA 4MKBA 4F7VA 5F8IA 5KG4A 1FERA 3UDVA 2FGOA 5A8KB 4PG4A 1FKPB 5D4BA 5D0EA 3D0HE 4I67A 1DQ9A 4H9MA 1EB0A 3MHYA 2OPRB 2E7WA 2VICA 3M6UA 5JU5A 3RRHA 3JPOA 5MAOA 5U47A 1R9XA 2ZIUB 3PV8A 3MM7B 1QSLA 2W7AA 4FKXA 4Z37A 1QUPA 8ICEA 3AL0B 1RADB 5L1LA 1ZQIA 4RW9B 5F8LA 5IC4B 4HH1A 1TKZB 1XNSA 4A47A 2NRTA 2POKA 2R7OA 3CVKA 4DSIA 2HBYB 1B64A 5EE9A 2KT3A 3HSGA 3ZZPA 2E66A 2LKYA 2XS2A 1QQ5A 5E79U 1RUSA 2HMIA 1LWCB 4F4AA 2CJQA 3LANA 3ZTOA 1PILA 4OYIA 4NLXA 3IR6B 1V3ZA 3QXGA 1G3OA 3F41A 4F4ZA 3O2IA 1AQ6A 4NLYA 2KSOA 1S76D 4YMEA 3ISNC 1WDDA 3NS5A 1YBUA 3MM9A 4PHEA 4CNQA 4F0RA 3MM8A 4IH6A 4KH0B 1U0HB 4DCCA 1YKWA 3LAKA 2XNRA 1ZQVA 1I94F 4OLOA 4Q8EA 1O08A 2EI5A 2DPJA 3BV8A 2AXTU 2ZBCA 1LWEA 3L3CA 2MKSA 1D8LA 1HI8A 3FC4A 1YRXA 4WP9A 1U7LA 2RKIA 3D4JA 2XICA 4DUTA 1EJVC 3TWZA 1H73A 4K4WA 1RAAB 1SB3C 3R5GA 1TE2A 1TV6B 4PUOB 1IWAA 2JX2A 4DR7F 2E5JA 4PZOA 2BM0A 3RJGA 5L38A 4C2MA 1LWEB 2IM3A 2ZZTA 5ADZA 3DLEA 1LW2B 3T9NA 3N2CA 2DISA 4DV4J 2MZQA 2WF8A 3M2UB 3ZNUA 3AD8C 2D7SA 5AM1A 4I2FA 1GEHA 2BVZA 4X66J 4MK8A 2BEFA 4WFYA 1Y11A 3TUIC 4TNOA 1RT5B 4LF6F 4PG8A 2IOHA 4I2IA 3KUGA 1YBQA 1T9YA 2KN4A 2FJWA