4DEZA

Structure of msdpo4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
TKWVLHVDLDQFLASVELRRRPDLRGQPVIVGGSRKVVTCASYEAREFGVHAGMPLRAAARRCPDATFLPSDPAAYDEASEQVMGLLRDLGHPLEVWGWDEAYLGADLPDESDPVEVAERIRTVVAAETGLSCSVGISDNKQRAKVATGFAKPAGIYVLTEANWMTVMGDRPPDALWGVGPKTTKKLAAMGITTVADLAVTDPSVLTTAFGPSTGLWLLLLAKGGGDTEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PAD region in the mycobacterial DinB homologue MsPolIV exhibits positional heterogeneity.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords DNA polymerase IV 1
total genus 75
structure length 232
sequence length 238
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dezA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4dezA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dezA01
4DQSA 5J1EA 4F92B 1FKOB 4GXKA 4BXOA 4BWJA 5F8HA 5DKWA 4XA5A 3V4IA 4Q43A 4I2HA 3ZD9A 3MFHA 4RPXA 4QZHA 2E9ZA 4YMNA 4KLSA 4K4VA 1HMVB 5IILA 3UDLA 3V4IB 3MDAA 4NLSA 2MUTB 4YVZA 7ICNA 3OL6A 1KFDA 4ID5B 3MEGB 4WZMA 5F8JA 4KKOB 3KLEA 2P6UA 4M6WB 2HHTA 1TAUA 4MK9A 5HHHA 2W9CB 4ELVA 4MFCA 1HPZB 5KG3A 1EP4A 3H98A 4MEYA 4RT2A 2FPLA 3KK2B 1QTMA 1TKTB 2WK4A 3RH6A 2JZBB 3GV7B 2IA6A 1ZQFA 4EYIB 7ICKA 3OLAA 5FDLB 2HW3A 1MSWD 5CWRA 4ZVEA 2IM3A 3EZ5A 1HARA 1XO1A 4YXMA 3EWAA 4RNNA 3N6NA 4HKQA 3AUOA 4XQ8A 3PW0A 2FVPA 3B0YA 4O4RA 5HLFB 3EW9A 4F93B 1JKHB 2ZJ8A 4KTQA 3KK3A 2J6TA 1RXVA 4QWEA 3M8PB 4RQ0A 7ICTA 5HMMA 1Z4UA 4RQ1A 1IKXB 1KEJA 3TAPA 9ICWA 4QPXA 3DOLB 1FK9B 4WE1A 4ZVFA 1ZQLA 4NLKA 2B21A 3ZD8A 2XC9A 2ISOA 3IRXA 2QE5A 1TK8A 2BKEA 4IOBA 3ZDEA 5J2NA 3RB6A 3NTUA 9ICSA 3LWLA 4WFZA 5KG2A 3BGRA 2P6RA 5EUHA 2BDPA 2ZTEA 3FSIA 7ICRA 3E01B 2F1IA 1RTJA 1HQEA 1XSNA 7ICIA 7ICEA 3DI6A 4KAIA 4TYBA 4ECWA 4O9MA 4IRCA 3THVA 4RW6B 3PMNA 3AU6A 5KFFA 4H4MB 3GIJA 2DPIA 5DDYA 4NLVA 5J2HA 3V7JA 4MF2A 4Z6EA 1ZQSA 1DTTA 4O5EA 4DS4A 9ICPA 1IKWB 4K4TA 3MF5A 4RT3A 2YNIA 3H5XA 2IHMA 4WZQA 8ICIA 3QIPB 3DRRB 4M9HA 2RF2B 1JLGA 4RQ7A 3K75D 1T7PA 2XI3A 1MQ2A 4DSJA 8ICGA 4O5KA 3TFSA 4ZVGA 3DOKB 4KV8B 1RYRA 3KHHA 1ZQDA 1ZQNA 4URQU 4HYKA 1HNVB 5EWGA 1ZQHA 4IR9A 1RXWA 3N6LA 3MABA 4RW4A 2PI5A 5CYMB 3NKYA 1RT4A 4O3NA 1XSPA 2CJQA 5KFDA 2HNYA 1T03B 3BREA 5J0YA 2HWHA 5DQHA 4PGYA 4WYWA 8ICZA 1LW0A 1S0NA 4ED7A 4WFXA 4QWDA 2XGQA 4TN2A 5D46A 1PZNA 3MR3A 1VRUA 1Z3EB 4DL7A 1S1TA 2IM2A 4RW6A 1N4LA 1QUVA 5C24A 5J2JA 4R5PB 4BDPA 4DSIA 1BQNB 1RTJB 2HWIA 2WTFA 1D8YA 2XGPA 4KHRA 3AU2A 5D3GA 1T03A 3Q8RB 1R0AA 4OL8A 1REVA 1S6PA 3IGNA 4RQ4A 1J5OA 4KITB 4UB3A 5J2PA 4UBCA 5DBCA 2OPQA 1XSLA 4CCHA 3DLGB 2XY7A 3DOKA 4KV8A 4NLGA 4QZFA 4Y34A 1D9DA 3G86A 1S0OA 2FMSA 4KO0A 5F8LA 3PX6A 3DRRA 4YMMA 4YMEA 9ICJA 2OPPB 3JYTA 4R8UB 4QWAA 3RRHA 2XY6A 1ZJMA 4J9PA 3UPQA 1KLMA 3LAKA 3KJVB 3C1ZA 1RTHB 3N4MB 2OPSA 3IGVA 5J29A 3IM1A 5KFYA 3M9NB 1LWFB 3FFIA 3HVWA 3T5LA 3KK1A 3T3FA 5EWEA 1S97A 3DI6B 1QE1B 2PFOA 3ISNC 4IQTA 2BE2A 1N5YA 4Q0BA 4DQIA 4IDKB 7ICQA 4KFBB 1JMSA 3UR0A 1TL1A 3H5YA 4MKBA 2XCPA 4LQ3A 3DM2A 1ZQYA 8ICAA 5D4BA 4ECSA 5F8NA 3OSNA 2NRZA 2W8KA 2F1JA 1KSPA 3DLKA 2XWYA 2KZZA 4EO6A 1JLCA 5IIOA 4ECZA 2YNIB 3HPOA 4LSLA 7ICUA 3ZDAA 3Q8KA 4R66A 1TL3A 4PPXA 4B9TA 3MR2A 4EZ6A 2FVQA 3PY8A 5L1JA 2C2EA 4R63A 3KLIA 1RT3A 4YD1A 1RTDA 4EBEA 1B43A 2ASDA 3OL8A 4I29A 4DS5A 5J0WA 4UAZA 4NLDA 1NK9A 1RTIB 4NLQA 4IQXA 1VRUB 4FBUA 5EWFA 1UT5A 3T19A 4B9LA 3Q8QB 3TAMA 1TVAA 4PGQA 5HP1A 5KFJA 1BPXA 1KRPA 3M8QA 3KHRA 3CJ2A 3MDCA 4JV0A 1JLBA 3PX4A 4RNHA 3JPOA 2LYHA 1S1UA 1ZETA 4IG3A 3PW4A 1HPZA 2IC3A 2ZUBA 1EP4B 1JLBB 3ITHA 5DB6A 3BGRB 3QLHB 4F4KA 3NGDA 2RDIA 1EETA 3ZDDA 1S77D 1ZQUA 4YR0A 4YN4A 4ECXA 2EC0A 2W7OA 2O5DA 3GV5B 4G1QB 4UB4A 4ECYA 1DLOB 1SKRA 4DL4A 2JEGA 3GV8B 2FMQA 5KT2A 1W25A 4M04A 1BPBA 3TFRA 2MAXA 2BANA 2BCSA 4IQWA 9ICRA 2XY5A 3M9OB 4IRKA 3UQ0A 1JLAB 3LDAA 2IM0A 1D9FA 2OPQB 1TV6B 4C8OA 4ED8A 4KKOA 4I2IA 2B43A 4B9SA 1C0UB 4Y2AA 4ZP9A 2VA8A 4MFAA 4J9KA 1RA6A 4KLDA 1ZYQA 4YR2A 9ICCA 3KK2A 1T3NA 2ZJAA 3V6DA 1LWCA 1Z00A 7ICHA 5J2GA 5KFSA 1QAJA 5KFCA 3C6TB 1LWEA 2FVSA 3ISCA 3RJKA 3E2EA 4B9NA 2HNZB 4TUPA 5KFRA 3T1AA 5J2QB 4E0DA 2JEJA 3H2LA 3BQ2A 2RDJA 1WNEA 1MMLA 4RNFA 3NL0A 2DFLA 4O3PA 2V0NA 3TAQA 4M0AA 5J2EA 1RTIA 3H8JA 9ICHA 3OL7A 3QZ7A 2R2TA 2WOMB 3MEGA 5KFAA 8ICHA 5I3UA 4I2DA 5DGAA 2UUWA 4Z6CA 5KT6A 1XS9D 1SUQB 8ICFA 1TL3B 1DTQB 4F5PA 4PUOB 4XUSA 1JLAA 5J0TA 2FLPA 3C21A 5KG4A 3TQ1A 2BPCA 3UXPA 3C5FA 4BGDA 2BGWA 1NHVA 2NRXA 4TQRA 1ZQRA 3CDWA 4K4UA 1ZJNA 1S1TB 3M8QB 2H5XA 5J0OA 4DOCA 5DLGA 4K4HA 3DLGA 2R2SA 4J9MA 4DFMA 5KG7A 5EOZA 3PVXA 2PFPA 1TV9A 5T14A 4ZH4A 4H4OB 5KFTA 5DBAA 3QGHA 2IC3B 4XRHA 4M9GA 2JZBA 1UA0A 4WYLA 1TAQA 4K4SA 2KN7A 2OPRB 1UWBA 3ITHB 8ICTA 2M9NA 3PX0A 4TUQA 5CP2A 4GXIA 2JC0A 2ISPA 1RAJA 4YFKA 4M9LA 1UWBB 1LWFA 4K4IA 2C2RA 5HP1B 4I2PB 4ID5A 5KFIA 1BPEA 2UUTA 3TAMB 3NAHA 1S9EA 1ZQZA 1ZTWA 2HHUA 2HMIB 3JPRA 3V6DB 4O4GB 2XI2A 4NM2A 4F2SA 2I1QA 2E9RX 1S1WA 3LP0B 4EEYA 3KLFB 1C7YA 1SL1A 4I28A 2KFZA 5DG8A 3SV4A 1SKSA 3HX0A 4IG0B 4XO0A 2IHNA 4IFVB 5CJ7A 2XCAA 1H38A 4I2EA 1XR6A 2WONB 3RR8A 5DQGA 1RT6A 4NYZA 2B6AB 4ECVA 2FLLA 3LP1B 2VA2A 5DBBA 3CDUA 3HHKA 4JV1A 1X9WA 4O4GA 4K4WA 2UVRA 3H5UA 2BR0A 8ICPA 1SZPA 1IKVA 3KLGA 5IINA 5CYQB 5L1IA 9ICXA 3KLHA 4IH6A 5J2DA 3H7IA 4RQ2A 1RTHA 2AX1A 5J2PB 7ICOA 1L3VA 4YMOA 2ZE2A 2I1RA 4F3OA 1XR7A 2B6AA 4IRDA 2BQUA 4RW9A 1TP7A 1X9SA 1C0TA 4QZ9A 3PO5A 4FS2A 2ZD1A 1TVRA 1IM4A 3MEDA 1LW2A 3SV3A 3ZDCA 5DB8A 3TVKA 4QWCA 8ICSA 4TQSA 1C1BA 1TV6A 2CKWA 1RA7A 1ZQXA 5KT5A 2R2RA 4M9JA 5J2NB 2HMIA 3DLEB 3EPGA 3OJSA 2D41A 1VRTA 4UB2A 1T05B 1ZTTA 4J9RA 1ZQWA 4KLOA 2Y1IA 4DG1A 5D49A 2HHXA 1CSJA 5KG1A 5KG0A 4I2BA 4DF4A 3DRSA 4O3OA 4RUCA 4KB7A 3VQSA 4ZVHA 3B0XA 7ICJA 1BPYA 4M47A 1N48A 5JXSA 3OGUA 3PW5A 3GDXA 1RYSA 4YXJA 9ICBA 5EDWA 3Q8SB 3UQ2A 5C24B 3M8SA 4ZPBA 4JK1A 3BSCA 1JXLA 3V81A 1KHVA 3LP0A 4F5OA 1TKZA 3H4BA 5KT4A 2J6UA 3I0RB 4DSKA 4IDKA 4RQ3A 1NJWA 2ATLA 4KLUA 3I5AA 4PQUB 1S6QA 3H40A 2NRWA 3CJ0A 2AX0A 4GXJA 2BRLA 2P66A 9ICNA 2VG5A 3GIKA 2YKNB 4Q44A 4KLIA 3MEEB 2FMPA 5KT3A 4P4MA 5KFWA 3RRGA 1BQMA 3E51A 5DQIA 4IQUA 4YG2A 4F4YA 1HQUB 3CJ4A 3DLKB 5F8MA 4LQ9A 3GQCA 4J9NA 4F5QA 1ZQOA 4NM1A 2HVHA 4YD2A 2B5JA 1S76D 4DO9A 2IJFA 5J2MA 1N56A 1RT5A 4RW8B 3PV8A 1QAIA 1BPZA 3C2KA 4M94A 2NRVA 4KLLA 3RH5A 4ED6A 3MECB 3QEAZ 2WHOA 2AQ4A 3V6KA 4ICLA 1ZQCA 5HLFA 1SH3A 4LSNB 5J2KA 3M8RA 4URGA 2ZJ5A 5DG9A 3T5KA 2YKMA 4B3OA 2Q0ZX 4KN7A 4DL2A 4RW4B 2VANA 4H4OA 2KZMA 1CEZA 5KFUA 2RKIA 2PFNA 1HYSA 3ICLA 3HWTA 3KLFA 2AWZA 2JC1A 5KFLA 3PW2A 1MC8A 1RT2B 1HMVA 1MQ3A 4ZPAA 4ED1A 8ICBA 2HVIA 5CB1A 1B22A 5DLFA 3BSNA 8ICQA 4IFYB 4TY9A 3IS9B 2YNHB 2HHQA 2RF2A 1D0EA 1FKOA 4PHEA 4F4WA 1GX5A 4PGXA 9ICAA 4DQQA 8ICNA 1BVSA 4JV2A 5DG7A 3KOAA 2V4QA 3QLHA 3HW8A 3FRZA 4YR3A 3BSAA 1ZQIA 5KFEA 4RQ6A 2VG6B 1LW2B 1RDRA 3UXNA 1RT1A 2FVRA 1S1WB 4DOAA 4BWMA 1RT7A 3JPTA 3GIIA 2WRMA 1L3TA 1JN3A 4M6WA 1OS5A 5L1LA 3SZ2A 4TY8A 1D1UA 1WCNA 5IIJA 1NKCA 4KLQA 2R2UA 3LWMA 3LAMA 1XR5A 3ISND 4DFJA 3KHLA 5HMLA 4KHMA 3G6XA 4MIBA 2IJNA 5KFQA 3V72A 3UPFA 2BE2B 1S48A 1RT1B 2ZUDA 3RJEA 4ICLB 4RU9A 5KFNA 4J9OA 4M9NA 4I7FA 3I5CA 4JWNA 9ICQA 2ILYA 1QE1A 3CIZA 4WFYA 2BHNA 4TUSA 5J2IA 4C8NA 4DG1B 2E9TA 3DYAA 4PQUA 4O5CA 4NLPA 3C2MA 5HP4A 3Q8LA 4K4ZA 4P4PA 1S1XB 1HJPA 1S0MA 5KFVA 3Q8PB 3DMJA 4I2CA 3GILA 3EYZA 3JPPA 5J1EB 1IKYB 2W7PA 3LK9A 4ECRA 3T5JA 5J0XA 3PW7A 3ISDA 1U45A 4NCGB 1CUKA 1X9MA 2AGOA 4I2GA 3C5GA 3QGGA 5CR0A 3QGIA 1N6QB 3BDPA 3PZPA 4ZP7A 1RPLA 1Z00B 4MK8A 3TANA 2JLEA 4JUZA 4NRTA 1NKBA 2WCXA 3PHEA 4ZPDA 3M9MB 3EZUA 2FLNA 4KSEB 1GX6A 1AROP 3V7KA 2ZE2B 2UVWA 8ICYA 2DPJA 4QZ8A 8ICCA 4RPZA 4DLEA 4F2RA 2GIRA 4DSFA 5CYQA 2B5JB 2OPSB 5FDLA 4MFBB 3IRXB 3OJUA 1BPDA 5IIIA 3QIDA 4YQWA 8ICUA 1DTTB 4PUOA 3KLVA 3V7LA 4PHDA 3MGHA 4J9LA 4Q45A 1SL2A 7ICVA 4F5NA 5J2BA 4ED2A 1ZQPA 4MEXA 5C42B 8ICVA 1HNVA 3DYAB 3HVTB 5CHGA 1TVRB 2NRTA 4RQ8A 5HHIA 5BOLA 2D3ZA 4ELUA 4U6PA 5C25B 4Z6FA 1REVB 5J2FA 4B9UA 1S1VB 1HQEB 5J2CA 2R8KA 3FYHA 1D8LA 4QZGA 4Q8EA 3I0SA 1BQNA 1NJYA 3DRSB 4U7CA 2Y1JA 4RZRA 3KLHB 3JPNA 4ECUA 4B9VA 4C8KA 4TY8B 1RZTA 4KLMA 1S9GA 4R8UA 3DRPA 2BCQA 2W9MA 8ICKA 3GIMA 3EPIA 3IG1B 2C2DA 3FDSA 4J9SA 4QZBA 1RT6B 5D3GB 1C1CB 7ICPA 9ICIA 4KLGA 3MFIA 2W9CA 1S10A 1S1UB 2W9BB 5KFGA 4NLWA 2YNGA 3KK1B 1C0UA 2F1HA 3DRPB 1BGXT 4I2FA 4NRUA 3RB0A 4B9MA 3DDKA 4IH5A 1SH0A 2I5JB 5F9NA 1KTQA 2BRKA 1JIHA 9ICEA 4MIAA 2D7SA 3QIPA 5F8GA 3PNCA 1JLGB 4K4GA 5CA7A 4M2YA 3PR5B 1C2PA 3IG1A 3JYTB 4EZ9A 3QEBZ 4G3IA 4PWDA 4C8MA 1KFSA 1L3SA 2VG7A 5F9LA 2R8GA 1HYSB 4RUAA 5TZVA 5I3UB 4RNMA 1IXRA 1RT3B 4F4XA 1S6PB 2IM1A 1U49A 2C22A 5KT7A 1N5YB 1TKDA 5L1KA 1TFRA 3BR9A 2FJXA 3RJFA 4ZMMA 2BCVA 1TKZB 4MH8A 3E01A 4UQGA 4DL3A 4RW8A 1FKPA 4RPYA 2ALZA 1Y88A 4NZ0A 3MR6A 4DQRA 1ZQMA 5J0QA 4NLTA 2FPKA 4QZAA 1SV5A 3UQSA 1FKPB 3KNAA 2ILZA 8ICJA 4P4OA 4R0EA 1NHUA 2KFNA 5F8IA 1S1XA 3GFKB 3JPSA 5HBMB 3BQTA 8ICLA 4Q8FA 3C6UB 3HVAA 2I9GA 1T94A 1RTDB 3C2LA 7ICLA 2I5JA 3PJXA 3RJHA 4NCGA 3G6YA 5HBMA 3RH4A 3BJYA 2ZTCA 2V4RA 4IR1A 1NK0A 5J2AA 4XPCA 3RJIA 1S4FA 3OHBA 1QLNA 4O44B 4YP3A 2AGQA 1LV5A 3H8WA 4C8LA 1K1QA 3T5HA 3TI0A 9ICLA 4I2PA 2IMWP 4LZDA 1RT5B 1HNIA 1DLOA 5KTQA 3SFGA 2GWSA 5I42A 4URSA 5BOMA 2FJWA 2PFQA 1R0AB 4R64A 1QSYA 5KG5A 5KFBA 4IG3B 4F91B 2YNFB 4DF8A 3RJJA 1ZQBA 8ICRA 4MFFA 3JSMA 1HUOA 5CYMA 4PH5A 4RQ5A 3RBDA 4NLOA 2JEIA 1HNIB 5HROA 4FO6A 1SH2A 1NNDA 3KLEB 3TARA 3LANA 3CJ5A 1SKWA 4UAYA 1T4GA 4NLZA 2VG7B 4IFYA 2OPPA 1LWEB 2AGPA 4KLJA 2YNHA 2BANB 1ZQJA 4ECTA 2IAJB 3DOLA 3RAXA 4F8RA 4O3RA 5L9XA 4NLNA 1KHWA 2W9AA 4LZGA 2ZKUA 1S9FA 2YKMB 2KTQA 4B3OB 2AJQA 4I7FB 4KE5A 2YNGB 4ED0A 5KFXA 2FJVA 2HHSA 4QZDA 5KFHA 3C1YA 1XU4A 1ZQEA 2R8JA 4QZIA 1WCLA 1ZQKA 4KLTA 1JKHA 4ZHRA 3FQKA 2ZTDA 1JX4A 3NBPA 1ZQGA 4QWBA 3KMSA 1V9PA 5KFKA 2BCUA 3SYZA 2AQ0A 1QSLA 1JLEB 4O0IA 3DM2B 2V9WA 4K50A 3HP6A 4BXOB 2AU0A 3IN5A 1UA1A 3BQ0A 1RT2A 4DQPA 3JPQA 4EBDA 9ICFA 1IKVB 3KLGB 1LW0B 5C5JA 3PJWA 5J2QA 1TK0A 3KJVA 2XO7A 3ISBA 1K1SA 1XWLA 4DFKA 4IH7A 2HNYB 4TLRA 4O44A 3C23A 2A1JB 4DL6A 5J0PA 2BPFA 4ZHRB 3ORYA 1RT7B 4K4YA 3QO9B 4WXOA 2R8IA 4K4XA 2C28A 3MEEA 4X2BA 1NKEA 3CDEA 5HROB 4KLHA 1TKXA 2BPGA 2PXIA 4ELTA 4Y3CA 2HAIA 2MUTA 4UBBA 8ICEA 2WOMA 4NLXA 9ICTA 2W8LA 2BCRA 4J9QA 4JWMA 9ICMA 4DWIA 1MU2B 5BPCA 4O3SA 4KMUA 4PHAA 1NK4A 4MFBA 4ZPCA 1HUZA 3V81B 3CWJA 3D28A 1A77A 3BQ1A 3MGIA 1JLQB 3N6MA 1I6JA 2RKIB 1C0TB 2ZUCA 4EBCA 1X2IA 3C6UA 4TXSA 4IKAA 2BQRA 2KZ3A 2UVVA 4LVSA 3LP1A 1HQUA 1LWCB 1NOMA 1QSSA 2GIQA 5J0UA 3LP2B 4FBTA 4DEZA 1NJXA 3FFIB 5DDMA 3V6JA 4EYHB 4NLUA 5KFMA 2PI4A 4P2HA 3I0SB 3HT3A 1KDHA 3PMLA 5KFPA 4GC7A 3CVKA 1U9LA 3CJ3A 4PHPA 1KLNA 3NBPB 4G1QA 3H5SA 2ASLA 4YCXA 3Q8MA 4KO0B 4KBIA 4DSLA 4RW7B 5K14B 5DGBA 1DTQA 1J5OB 4IG0A 4KN4A 4RNOA 3QE9Y 1KFTA 4RW9B 1EETB 5DB9A 3D5MA 3LALA 3OLBA 2A1JA 4I2AA 4QZEA 4QW8A 4M95A 4LSLB 4F50A 4H54A 3IS9A 2VA3A 1U4BA 8ICOA 1N6QA 3CO9A 2HHVA 4GLXA 3OHAA 1JXEA 1DOQA 3OL9A 3V6HA 4XPEA 1LB2B 2UVUA 1JLEA 3H59A 4DL5A 4EO8A 3MEDB 5KFOA 1TKTA 5DB7A 3ETLA 4R65A 4Z6DA 1DGSA 3H8SA 1FK9A 4WE1B 1T8EA 2WONA 1U48A 2HHWA 8ICMA 1COOA 4Q0BB 3G6VA 1ZQTA 5C42A 2OPRA 9ICUA 1SUQA 3MBYA 5IIKA 3OSPA 4DSEA 3I5BA 4I2QA 2YKNA 5J0RA 1EXNA 3RTVA 4RW7A 8ICWA 3DMJB 3RBEA 3DLEA 3BSOA 1VRTB 5IIMA 1T05A 4PWDB 1ZQQA 1SV5B 3I0RA 5JUMA 1A76A 1C1BB 4F5RA 4DFPA 1SL0A 9ICVA 4ZP6A 3M8PA 1NK6A 3PO4A 3UXOA 3RJGA 2BQ3A 1IKXA 3RB4A 4FS1A 1ZQAA 7ICFA 8ICXA 9ICKA 2HNDA 2ZD1B 3QO9A 3JSMB 4H4MA 3N97B 9ICGA 3NMAA 3PR4A 2D3UA 1TK5A 7ICGA 2OH2A 4F4ZA 2W9BA 4QZCA 4O3QA 5HNKA 1U47A 1U09A 1L3UA 4MF8A 1NJZA 4ECQA 4Y2CA 1S9GB 7ICSA 5J0SA 1JLQA 2GC8A 5J2MB 4UAWA 3NAIA 4TYAA 2F8EX 2OWOA 4GC6A 2IAJA 4NLYA 1NK7A 2HNZA 4MKAA 2R8HA 4NXZA 1S0VA 2ASJA 1IKYA 1YVFA 1KLMB 4KFBA 4I2JA 3RAQA 5C25A 2FVCA 1RT4B 1ZQVA 1BQMB 1JLFA 3HVTA 3IHQB 5KFZA 1TKXB 4IQVA 1UT8A 4IFVA 3QZ8A 2FPMA 3KLIB 3SI8A 4NY8A 3LP2A 3MTKA 3KK3B 1NK8A 5K14A 4LSNA 9ICOA 4DOBA 1JLCB 1S6QB 4QW9A 4MK7A 4I27A 1MU2A 4R5PA 1NK5A 3KHGA 1C1CA 2JEFA 1S9EB 1IKWA 3HKWA 4UB5A 5I42B 4NLRA 4KLEA 2IBKA 4I2QB 3MR5A 3FQLA 3KMQA 5KG6A 4UB1A 2J6SA 2WB4A 1TL1B 3C6TA 3SFUA 1L5UA 1XC9A 3QYYA 4KLFA 1S49A 1S1VA 3MECA 3K4GA 4DLGA 7ICMA 4ZP8A 2YNFA 3GYNA 4WXWA 1TQLA 2VG6A 4TURA 4X5VA 2VG5B 3H4DA 3KTQA 3RR7A 2HNDB 3ZDBA 3RB3A 2QV6A 4ED3A 1JLFB
chains in the Genus database with same CATH superfamily
2RU9A 4BXOA 3CIMA 2KKVA 1EQ0A 5CD4H 2LXIA 2Q6BA 2VC1A 4JI5F 2YQ3A 4UATA 4DYKA 3CJKA 3PYFA 2PMZD 1HMVB 2YWWA 3V4IB 4KPCA 4DJBA 2MUTB 7ICNA 5F3XB 3OL6A 1JNRB 3KYLA 5F8JA 4KKOB 1UWAA 4M6WB 2H3IA 5HHHA 3GJTB 4DCPB 1NDCA 4NWIA 3EGJA 4RT2A 2DT9A 1XMBA 3KK2B 1WC6A 2DNGA 2WK4A 2GHPA 2JZBB 3GV7B 1ZQFA 3KXDA 5FDLB 4FFDA 1MSWD 2KXNB 4ETZA 1W2IA 4OI1A 3HULA 2FHMA 1UMJA 4GO5X 4ZPWR 1N5SA 2EAMA 3B0YA 3P96A 2DNYA 1H6KX 3E0FA 2K4IA 5AI6A 1AZSB 4OX9J 3EW9A 4F93B 3NCQA 4DCCA 4LF7J 3GCXP 2AJ4A 3UD5A 2X1FA 3T79A 2GNKA 3QJLA 4UBPC 2DIUA 2HBJA 1SJQA 2OTLS 3M8PB 3HFVA 1IKXB 1KEJA 3TAPA 3TADA 5CHCB 1TELA 3OVAA 4ZVFA 3U27A 4NLKA 4X4OA 4I56A 3IRXA 3ETRA 2CPIA 1DJ0A 4WJBA 3PRVA 1RWNB 4LF5F 4ZK7M 5KG2A 4DR5F 4E98A 2MSTA 4JI8F 1T3OA 2GO7A 3E01B 4N76A 4NYOA 3DRXA 3W65A 1M90T 1RKJA 3T6BA 1ZRMA 7ICEA 3CCMS 4KAIA 3BZKA 3OFEA 2RS8A 2DJWA 1U2CA 3THVA 3KZXA 2RHSB 3PMNA 2AJ1A 5KAKA 1VC5A 1RACB 3GIJA 2DPIA 4ZITA 2MGZA 2LMIA 5HMEA 1DTTA 3VAHA 2CJ9A 3MF5A 4EK2A 2KSOB 2KMDA 2RF2B 1JLGA 4B3MF 1J5EJ 1N5WA 2KJWA 1MN7A 3I4PA 4OYMA 2GAHC 4KV8B 3ONNA 5K8NA 2YWHA 1KQKA 3DHXA 2RD5C 2QYCA 3BKTA 2QLFB 4Q7AA 4U67Q 2DH7A 5EWGA 2RHFA 2I6XA 4IR9A 1WELA 2J8AA 5BYQA 3DLBA 2ZHBA 2FJBB 1ROFA 3R5CA 3ZZ0A 2CJQA 1X4FA 1N2XA 2HWHA 4USMA 4HDHA 4WYWA 5K8OA 4ED7A 4QWDA 5EE1A 4U8YA 4DR3J 4TN2A 4CDGA 3N4WA 2CPXA 3PYEA 2ROEA 3TOQA 4RW6A 4C7QA 3CGIA 5JJBA 5C24A 1BQNB 4U96A 2WF9A 4UQTA 1YRXA 1D8YA 2ZNYA 4KHRA 3AU2A 2ZOFA 5D3GA 3Q8RB 1R0AA 2UUBF 4OL8A 2R3VA 2B0CA 5EE0A 4RQ4A 1RK8A 9RUBA 2CFXA 3HHLA 2KAUC 3DOKA 1AT1B 4NLGA 1U8WA 3MD1A 4CM2A 3BH7B 7FDRA 1D9DA 2XQCA 2JLFA 1TUWA 2QARA 2H3FA 4NV0A 4J9PA 5LMNF 1R7IA 1RTHB 1B0TA 3MM9B 2OPSA 1FFVA 2CQGA 5KFYA 1EZZB 3C19A 2RMLA 2WAQD 3A4TA 1VYAA 3KK1A 2VDIA 2CQ1A 2Z2MA 1QE1B 1X4BA 4JI3F 1AB8A 2BE2A 5KNIA 3HO1A 4IDKB 3R1HA 4PG5A 2HZCA 2W11A 1PVQA 2MZQA 3K5LA 2D6FC 3OTOJ 4KFBB 1JMSA 2D69A 8AT1B 3IR6B 1OQ3A 4MKBA 1VQMS 4LQ3A 1Q95G 4XTTA 3T1HJ 3DM2A 2GZOA 2PFFB 4PG8A 2DR7A 1YKWA 5ALVA 1NDPA 2JOQA 2NRZA 1RAEB 4YFUA 5IM0B 1IM6A 2KZZA 2BMBA 4B3TJ 4LRFA 5IIOA 1FE4A 1DZ5A 1Q1KA 1TL3A 2NXEA 3TRGA 4K8RA 3ALRA 3HJEA 5D77A 3NVZA 3C29A 4EZ6A 1QUPA 3PY8A 1WI8A 3KLIA 4AE5A 2O6KA 1RT3A 4EBEA 2ZIUA 4I29A 1NAQA 5FP0A 4CEUC 2HBRB 3OPXA 2FD2A 1RTIB 1S5ZA 1CULB 2M88A 5IC4B 1UT5A 3AXMA 1TVAA 4G7EB 2FJEB 2IBOA 2MJUA 2QMWA 4LFBF 1BPXA 3KHRA 1E9ZB 5D4PA 4CO5A 1EF2A 1JLBA 1ZXIA 3JPOA 1S1UA 1SJ4P 2JJ4D 3UFCX 4IG3A 3PW4A 2BZ2A 2ZUBA 2A6MA 4C80A 2KOBA 1S3TC 1VLBA 3BGRB 2BB0A 3Q89A 5T7LA 3GIQA 2ZZMA 2DHSA 3EICA 2A18A 4ECXA 4G7EA 4LRAA 4WPAA 5KAFU 3GV5B 4ECYA 2IVYA 1UL3A 5KT2A 1CS4A 4PWWA 3RW6A 1CJUB 2XY5A 3QU4A 3R9KA 1FWFC 1JLAB 1MROA 2G1DA 2RQMA 1NDKA 1UP1A 2Y0SD 1D9FA 1TV6B 4C8OA 4ED8A 4FZMA 5K9FA 1UETA 5FLXU 3MOJB 4WTOB 4B9SA 1TFWA 2VA8A 2K89A 1ZM4A 4F0RA 1WUUA 1WC1A 2OAUA 1IBKJ 1MN8A 2ZJAA 3SFWA 4AQYF 5KFSA 3D66A 1QAJA 4BJQA 5EX0A 3ISCA 4B9NA 5FLXY 4TUPA 2AIRB 5KFRA 4BKNA 2JEJA 1UEKA 1MMLA 2OKQA 2CNOB 4CLFA 1RXOB 3IBWA 3H8JA 1GXUA 1HNZF 5C7PA 4C7ZA 3ELHA 3VHQA 2GQ2A 4DUZF 2JVRA 3MEGA 5KFAA 1ZA2B 3ZZPA 2UUWA 5KT6A 1XS9D 1TL3B 2KNJA 1UVNA 3TUPA 1RU2A 1X4AA 3ILLA 3L9ZA 4P0QB 2FLPA 4LF6F 4RBVA 2Z30B 5KG4A 2WZ1A 2HRYA 3C5FA 3MTWA 4DR6J 3W7BA 2ZJRQ 4K4UA 4QIWF 5L9NA 5E7OB 3M8QB 5J0OA 3M1YA 5DM6Q 4K4HA 2QYGA 4W4MA 4J9MA 4DR5J 3IC1A 1RP5A 3PVXA 2NO4A 1KC8T 2R4FA 5T14A 2H4YB 2WF8A 2CQCA 3QGHA 1Q8LA 3M8ZA 4M9GA 2IC3B 2JZBA 4WYLA 3IG8A 3GR0A 3L4PA 2KN7A 1UWBA 8ICTA 1N5XA 1WOOA 1WWVA 2V5HG 1VLOA 1RAJA 3MM7B 4K4IA 2QLTA 4U8VA 2C2RA 3IBCB 2MEWA 2UU9J 2VJVA 3M2VB 4ID5A 1RAOA 2VZ9A 3TVYA 2G4BA 4CEXC 2IA0A 1VQ9S 5A0YB 3TAMB 1S9EA 2LYAA 3JPRA 2XICA 2XI2A 1DQAA 1KQQA 4EEYA 3M6WA 1S7IA 4NZ7A 1AQ6A 4YOEA 4I28A 2CQDA 2VBXA 1FXLA 2G0AA 1TUGB 1SKSA 5H9EK 3ENWA 1ZM9A 2IHNA 3TUIC 1KBUA 1N62A 1FO1A 5CJ7A 1T9TA 3WX8A 4ZOSA 5DQGA 3ENQA 2MKIA 1ED1A 1C4CA 3LP1B 4DFDA 1YBQB 3HHKA 4LFCF 1F0MA 3CCRS 1VQNS 2FVMA 2OD6A 4A47A 8ICPA 2JV3A 3ZC4A 3K89A 1NMEB 1SZPA 4M5NA 1LEOA 3MMAA 2L08A 2Y8WA 1UFWA 4GMKA 3FMBA 2LA4A 4IH6A 3K7RA 3GTYX 1RTHA 1BLUA 2VPZB 2KG5A 1L3VA 1Y3KA 2B8PA 2YBVA 2B4OA 2BQUA 1TP7A 2JXJA 1RBAA 3CCES 1C0TA 2E1AA 2IRYA 2ZD1A 4OHWA 3MEDA 1LW2A 1WHXA 3SV3A 3FGVA 3AA8A 3TVKA 1X5TA 4ZPVR 3C46A 1M1KT 3H25A 1TV6A 2MXYA 2OEMA 2R2RA 2PO4A 4O3MA 4M9JA 1R31A 1YGYA 1UPMB 1PG5B 4WK3A 1VRTA 3CD7A 4J9RA 3E74A 4WP3A 4CLYA 2LU2A 4DG1A 3HHNB 2VASA 1FRLA 5AK5A 5KG1A 3ZZUA 1AFIA 5KG0A 4I2BA 2GIFA 2Y0BB 1QAYA 2YN4A 2W03A 4OHZA 2EZYA 5AKXA 3B0XA 1BPYA 1RWXB 4CLSA 2DGXA 1S59A 1N48A 4GRSA 3OGUA 3BO3A 3SSQA 1KVJA 4CQBA 4YXJA 3UQ2A 1Q5VA 2MKSA 4ZCKA 3IP0A 2H4WB 4ITSA 3UDCA 3QNWB 3NMRA 1KHVA 3SCIE 5AM3A 4L74A 3O8WA 3R8YA 4MYTA 3NP5A 1G4CA 2IOFK 2R7OA 1NDLA 3QFWA 2FI1A 3H4BA 3RZAA 3I0RB 1FNXH 4RQ3A 2LECA 2ATLA 3H40A 4M5MA 1RA0A 2YY3A 4JYAJ 2DL0A 2N1RA 4KLIA 5KT3A 1NO8A 3H2UB 5KFWA 2QLWA 5ALOA 5DQIA 3HD1A 1PVPA 3CCSS 1RCXB 2HSEB 1FWGC 2DHAA 5F8MA 4LQ9A 2B0GA 1H0HB 2F4VF 3GQCA 4J9NA 2HVHA 2ZIVB 4YD2A 2COLA 5HI7A 5A6PA 2ZH2A 4H4KC 3VAIA 5CXTA 3KFUF 4KQZA 2NRVA 5T7LB 4KLLA 3RH5A 3PTWA 1Y0HA 4KGVB 2WHOA 3H7HB 4CLWA 3SEIA 1RISA 3ZTQA 5AK4A 5BYSA 3M8RA 1VQLS 5ETQA 2ZJ5A 1HWLA 1LXNA 2HIYA 4ZIVA 4BCAA 2Q0ZX 5BJRA 2F63A 4LF6J 2VANA 4JB3A 5D4NA 2C3MA 2AWZA 5K8PA 1JJHA 3H0MB 4OI4A 4ZPAA 4ED1A 1E6VA 4N8OA 4OYPA 4KIRA 1WSRA 5D0RA 4FZLA 4RU2A 3FM9A 1D0EA 1FKOA 1P1MA 5B0DA 1X0FA 4DQQA 4DOZA 4H4KA 1BVSA 5I3PA 1TL7B 5C2CA 3ZXWA 1EKRA 5ALDA 3BGOP 1L3KA 2F40A 1RWVB 2Z4PA 2YX7A 3A8KA 2VG6B 3PFOA 1G3OA 3SCLE 4CZCA 5JTIA 4DOAA 4BWMA 1M1HA 1Q8BA 3BS5B 3GIIA 4P7VA 4EI2A 4M6WA 2WW8A 1AA1B 2H1YA 3S6EA 1BWEA 4KLQA 1NXIA 1XR5A 4OCZA 3KHLA 2CJYB 1IIPA 3CP8A 1WJ9A 1H98A 2W2OP 2VODA 4W98A 2Y0SF 3JB9k 2IRUA 3RJEA 3QRRA 3IGHX 5HMDA 1U0HA 4BLGA 3NQBA 2B4VA 2V8VA 4M9NA 2XS5A 9ICQA 1WD6A 1QE1A 3RN6A 3M2RA 2M9KA 5HL7Q 3LGNA 3LUYA 4DG1B 5ALWA 4O5CA 4F3MA 3CULA 3Q8LA 3JTNA 2JHEA 2QTWA 2R42A 4OJ1A 2V2KA 3HX9A 1DQ8A 2G0CA 4I2CA 2XWXA 2HZAA 3GILA 3VVTA 3CNHA 4CDIA 2DXEA 3L3FX 2FYXA 5J1EB 1KDNA 3T5JA 2WVDA 2Z2ZA 3LOUA 1CJKA 2DBYA 4JB8B 4IQMA 4I2GA 3C5GA 5CR0A 3C3LA 1N6QB 3BDPA 1RPLA 2JLEA 5D8HB 4JUZA 4OYIA 3MPDA 4NRTA 2KD1A 1XNSA 3PHEA 4F71A 4PPDA 1S79A 4US9A 2R7WA 1M5PC 2IYIA 1YRRA 4P2XA 1AROP 3V7KA 2L9NA 2P9BA 2QO3A 3VVUA 3G96A 1K70A 3FRYA 4WKYA 4DLEA 2B5JB 2OPSB 3KG0A 3CJ8A 3DGPB 4X66F 4DV2F 1BPDA 5IIIA 4X65F 3K17A 4P75A 3J80Y 8ICUA 1VGYA 3R5DA 4DU7A 1SGGA 1DTTB 2IJRA 1ZM3A 3V7LA 3MGHA 4WU2A 4Q45A 2CQBA 1SL2A 1DFDA 1ZQPA 5KOXA 4MEXA 5ALUA 1ZA1B 3W63A 1M0SA 1FTCA 2NRTA 5D78A 1TL7A 3C66A 1WTFA 4ELUA 4GKJJ 4RKUC 4LFAF 5J2FA 4B9UA 1S1VB 5G0RB 1LKZA 3H90A 4ZCIA 4OX7A 2R8KA 3MMBA 3FYHA 3I0SA 3Q8VA 4NMXA 3MR7A 4Y2SA 4ECUA 4LF2A 1FA0A 2CVEA 3GSDA 2JMGA 2FDRA 3BPSP 4KLMA 2EH9A 2AEMA 1S9GA 1JB0C 1X42A 2W9MA 8ICKA 3GIMA 3EPIA 3IG1B 2C2DA 3H8MA 2F77X 1RT6B 5DRKA 1NSQA 4KLGA 4UF4A 2DNZA 2QX0A 1HIWA 3KK1B 4NLCA 2F1HA 3CB4A 5H9EJ 4DV3F 3FC9A 2GMJA 4Q5VA 2Z2YB 3HXMA 3DDKA 1U1QA 1KTQA 1WDDA 2ESEA 2N7CA 2BV3A 1L7PA 3SIPB 4CTAA 1VOMA 5F8GA 1JLGB 1RBOB 5CA7A 3IG1A 3JYTB 4EZ9A 3UN2A 2P2CB 4PWDA 2AT1B 2AJ0A 1KFSA 1L3SA 4J5OA 5F9LA 1ZM2A 3SCKE 2R8GA 2PKEA 1XO0A 4RUAA 3EZOA 5TZVA 4DR1F 2XZDB 1N60A 2ZM6F 3HPAA 1U49A 4ZVQB 3H0LB 3J81U 4FXDA 3LNPA 1FHTA 2MSSA 3DUGA 1L8OA 4JI6F 2W1BA 1RHQB 3A12A 2FY1A 4MH8A 4UQGA 4Z2XA 1NH7A 2GQCA 4WP8A 3WC0A 5AE1A 4YDXA 5HMWA 4RPYA 1WEZA 1Y88A 5AI0A 3MR6A 4DQRA 1UEVA 4DV1J 2W2MP 3UQSA 1N33F 3KNAA 2PFDA 3Q8UA 3F0NA 1NHUA 5ETVA 3CYMA 2PA3A 1S1XA 3HFKA 5ALGA 3BQTA 4Q8FA 1TMMA 3M7VA 1RADB 5HMXA 3OR2B 1DRZA 2N3OA 1T94A 1SPBP 2DEIA 1X6IA 1X4EA 4CO2A 3PJXA 3RJHA 2KDOA 2XS2A 1GK8A 1NK0A 2D9OA 3RJIA 1SWVA 3OHBA 3R6LB 4OX8A 2EWHA 2BJ8A 2NLWA 3DN9A 2HOFA 3SSSA 4I2PA 2OHFA 2IMWP 2K8AA 1FIQA 4IS7A 1RT5B 3LTOA 2HGLA 1DLOA 4I1TA 3SFGA 1WUDA 2DR6A 5EN1A 5I42A 4OJGA 3I31A 4K5RA 1WKLA 5BOMA 2ZHAA 3V4MA 1ZZFA 2PEHA 1R0AB 3ILOA 5GVQA 5J1NA 2RHQB 5KG5A 3Q2SC 2XM3A 5IXUA 1NNDA 3LANA 4PKDB 3CJ5A 4A8QA 1F5AA 1SKWA 1FWKA 4WJ3B 1POKA 1WYGA 1UW9A 4KLJA 2RRAA 3KD3A 1N54B 2UV8A 4NEZA 5GAEU 4MKVA 4P0PA 1Q8KA 4ZIWA 2DISA 4C98A 3DOLA 2GCFA 4QR1A 5K4LA 4NLNA 4RPFA 4LZGA 3ET6B 2G5IB 3CCLS 4US8A 2AJQA 4I7FB 1A6LA 1WC0A 1WG1A 2YNGB 4ED0A 3GPAA 1ZAWA 2HHSA 4QZDA 5KFHA 2V8HA 4QZIA 1WCLA 1O08A 4LF1A 1OYDA 3G8QA 3SYZA 3SMZA 1QSLA 5D6GA 2OXOA 5F3TA 3DM2B 3K1RB 3HP6A 2XSJB 2EKNA 3IN5A 2FJ6A 4OHVA 2EXUA 9ICFA 3KLGB 4JI6J 3CEDA 1LW0B 5C5JA 2XO7A 4FZVA 1YRTA 2O66A 3AEVA 2ACMA 3T9NA 1B7YB 4IH7A 3BBBA 3O44A 3RW7A 2BPFA 1N5QA 3VC8A 4F02A 2MHNA 2XG8A 4K4YA 1T95A 4WXOA 2R8IA 1O51A 4K4XA 1ZAVA 2NUHA 2EK1A 3PJ9A 1HI8A 1NKEA 4USHA 3CDEA 1NUEA 1TKXA 5DDOC 2BPGA 4DU8A 2DK2A 4G1PA 2HAIA 1VIOA 2QA1A 3TEGA 8ICEA 2E66A 4R85A 2IMRA 2DEJA 1PK1A 9ICMA 1RWMB 2G13A 2YTUA 5M2UA 4O3SA 1EKSA 3IM9A 3Q0AA 4ZPCA 3SDEB 2KKHA 3GFZA 3D28A 1AW0A 1X60A 4KH0B 1PJ6A 3MGIA 2XZTB 2YXLA 2XO6A 4I0WA 2MB0B 1FT8A 2RKIB 1C0TB 4OYXA 2ZUCA 1BD6A 3BZCA 1X2IA 4TXSA 5CH7B 2Z2LA 5DJBA 4C0OC 2GOKA 1FXRA 2EZXA 1NOMA 3VWSA 4UOGA 2XMUA 4DEZA 5IT0A 4P10A 2LKZA 4EYHB 2MKKA 5KFMA 2PI4A 5GAEI 4P2HA 2E1FA 4C4TA 3SQIA 4CE6A 2P8IA 5DETA 1WTBA 2J9DE 2F2AB 5BYRA 2V8GA 4UW9A 3CVKA 4WFAQ 4ZN3A 3CJ3A 1KLNA 2E1CA 2ZVIA 4UB8U 4YCXA 3Q8MA 4KO0B 2I8EA 4RNOA 3QMQA 1KFTA 1EETB 3F2DA 5DB9A 3LALA 2A1JA 3C14B 4QIVA 4QZEA 4M95A 3M32B 1FVQA 1JROA 4L3NA 3D3BJ 1U4BA 1V6HA 2HBKA 4AP9A 1N6QA 1U1RA 2F65A 4P7TA 3FBBA 3OHAA 1PUZA 3KJFB 4XPEA 1T3QA 1IBLJ 3KUGA 2QB0B 1JLEA 3W5YA 3H59A 3QATA 4HI1A 2KYZA 1TKTA 1KBRA 4XDDA 3K8VA 4WE1B 1T8EA 1N5VA 3BBFA 2OPRA 1SUQA 3TQEA 5IIKA 3OSPA 1DARA 4I2QA 2K7KA 2NSCA 3OUYA 2G3FA 4RW7A 2VBWA 8ICWA 3EVWA 4M8LA 3K0JA 2O01C 3BSOA 1T05A 1SV0C 1ZQQA 3OTEA 3P3DA 1ICEB 1C1BB 2CYYA 4DFPA 2CNNB 1SL0A 9ICVA 3KDNA 2HQCA 2Y8YA 1E6YA 3RJGA 3U1NA 2ZZTA 4OYWA 1V38A 3AL0B 4X4NA 9ICKA 2HNDA 4JI4F 3N97B 9ICGA 2W25A 2EDUA 4Y2RA 2D3UA 4ES1A 3H8YA 2W9BA 3B9JA 3TJ9A 4O3QA 3OQ2A 1ZAXA 5HNKA 2ZJQQ 1EX8A 3PIOQ 4Y28C 1U09A 1G7CB 1LFPA 5D4OA 4C2MA 1WG8A 2H51B 1S9GB 2KU7A 2DKZA 2XMKA 1K9MT 3M2VA 2GC8A 5J2MB 1E6YB 2VQFJ 4UAWA 1UTAA 1MG7A 4QR2A 4GC6A 1PJ5A 4ZLLA 5H2FU 3MAQA 4RUBA 1M6YA 1S0VA 1G6BA 2C2NA 2P5VA 4X4QA 2VBYA 2WBRA 1RT4B 2YTCA 1KL9A 2VICA 4Y2KA 5AKQA 2CDQA 5KFZA 2DNPA 4IQVA 1KVIA 2FPMA 3KLIB 4NY8A 1XRFA 3LP2A 2GX8A 4MK7A 3KKAA 2QS8A 1P1TA 1X4GA 3M1VB 1C1CA 1RAAB 3I4HX 3HKZF 3GJRB 2FJDB 1IKWA 2QMUB 4UB5A 1H2UX 4NLRA 1NPKA 4I2QB 4UB1A 1T02A 3C6TA 1L5UA 3LPEA 1XC9A 3QU2A 2WAQC 5GTIU 3GP9A 1YJRA 1S49A 2EAPA 1RHRB 4NA3A 4ZP8A 1REGX 2YNFA 3GYNA 3UDVA 3R7SB 2E7XA 3J81j 1A9NB 2O1PA 1BMQB 4ENOA 1B0PA 4I6AA 1FKAF 1PYTA 2KVSA 1VHFA 1FNOA 4A8WA 2QRRA 2HNDB 4DX7A 2DNHA 2AEJA 3SCJE 5J1EA 4BWJA 5F8HA 4AXJA 5A8WB 3V4IA 4Q43A 4BS2A 3GE9A 2PDAA 2ZEJA 3EGZA 1WACA 4QZHA 1J2VA 3WKAA 4F3QA 1WEXA 1YJ9S 3CCWA 1QH9A 1V5IB 3B8HA 5IILA 3UDLA 4I4BA 4B3ZA 2ZIWA 3TJ8A 4YVZA 4C7YA 4ID5B 4WZMA 2LVWA 2P6UA 1YBUA 3S1TA 3GLJA 3OXLA 4CRJA 3MGJA 5KG3A 3M6VA 2FPLA 1QTMA 2HKEA 1TKTB 4DR4F 3ZTPA 2W54A 2OEHA 4WKRA 2YX8A 3OLAA 1POJA 3CJRA 1RZMA 1IWAA 2FIUA 3EZ5A 2KO1A 3U7JA 3SAFA 4I69A 3VAMA 1XMQF 2YQ0A 3N6NA 4HKQA 3PW0A 2CZ9A 3N5FA 4C9DA 4LF7F 4A8EA 4RWXA 4B3MJ 3LYSA 1Y11A 1FDAA 1MMDA 2HOQA 4LIRA 1Q46A 4K2XA 2ZJ8A 1A5LC 1Q5YA 1VR6A 4L73A 1WKKA 4OMFG 1YT3A 2FZCB 7ICTA 1CQNA 1TTHB 4ZLNA 2R7TA 3DOLB 3J81Y 3DRYA 2H54B 1TK8A 1EQMA 5EX3A 2K7JA 2NYIA 4LR7A 4HLBA 4JI8J 5J2NA 4DR7F 2GVDA 3RB6A 3NTUA 4UOCA 1PYOB 3BGFA 4C0BA 2B9YA 1Y00A 4TU7A 1XMQJ 2BDPA 4HT7A 3JAMY 2F1IA 1WKJA 1WC5A 3B4DA 5IQQA 1HNXJ 2F4FA 2FLOA 3R7NB 2FGOA 4ECWA 5C0YA 4A8MP 1V85A 3VALA 2WF7A 4OV6A 3IWLA 3AU6A 3M6UA 4UB6U 3V7JA 4MF2A 3MM6B 1XMOF 5EGYA 1FD8A 2OCEA 2BKOA 3G6ES 3NGSA 3OT9A 2B7BB 4RT3A 4LF9J 3CDBA 3TZWA 2GO8A 1VQ5S 2XMMA 3QWUA 3QIPB 4NXMF 3K75D 2VDHA 1MQ2A 1O12A 2ZBRA 3QAEA 4R88A 3DOKB 1WSVA 1Q78A 4JI4J 5AKIA 1OW5A 3KHHA 1ZQDA 4URQU 1HNVB 1ZQHA 3MDFA 3R1LA 3BN4A 4HHHA 4LIWA 4O3NA 1XSPA 5KFDA 2HNYA 2HHHJ 2BKNA 4WK1A 4I68A 3I32A 8ICZA 4DUYJ 1LW0A 3R6GB 3NWRA 2XLIA 1U7LA 3IRUA 5ALXA 1Z3EB 4DL7A 2HFNA 3UMCA 1S1TA 3QFHA 5J2JA 2VU5A 1RTJB 1HNZJ 4JI5J 2XGPA 4B3RF 1CQMA 1VBXA 2NO5A 1T03A 4F0MA 1RQ0A 1Q3UA 1REVA 4NL9C 1S6PA 3IRWP 1J5OA 4UB3A 2YQEA 4UBCA 1J2NA 5DBCA 1XSLA 4CCHA 3DLGB 4KV8A 4HT5A 3WKDA 3PHTA 2OFGX 3G86A 4M5JA 1S0OA 2FDNA 2HSZA 3F5EA 2OPPB 8ATCB 3RAMA 3JYTA 2DR8A 3I1YA 2XY6A 3UPQA 3KJVB 3N4MB 5ETMA 4CTAB 5J29A 9ATCB 3M9NB 3HVWA 5LM7E 3TWZA 3T3FA 5EWEA 3EGVA 2F7VA 2PFOA 4IQTA 3MPVA 4Q0BA 3MC1A 2V34A 3BYPA 3I56S 2YH0A 4C3KA 2XCPA 1ZQYA 4Y00A 8ICAA 3L7PA 4MT1A 2FQQB 1RYUA 5EE3A 3OSNA 4LH8A 2F1JA 3HZEA 5ALKA 1EJWC 1N34F 3J7Z5 2YQ1A 2WAQF 2XWYA 2Z0GA 4HI2A 1FX4A 2LEBA 4DV6F 2G0IA 1KOHA 4R66A 3ZZZA 4PPXA 1JJCB 2DGSA 1LKYA 1FF2A 2C2EA 1M5HA 4K59A 2KIWA 1B43A 2ASDA 3OL8A 3L7UA 4OYAA 4DR4J 2KRBA 2X3GA 1AZSA 4B17A 1HR0F 2ZJPQ 1OSDA 3N2CA 3QT6A 4NLQA 1MWYA 3GU3A 3EVOA 3R9LA 4ANCA 1VRUB 5AKHA 5HMZA 3WC2A 4FBUA 5EWFA 2JFDA 5GTHU 3Q8QB 3LQVA 4RQNA 1QY7A 4PR6A 1GKRA 4JV0A 2DR9A 3PX4A 2LYHA 4RBUA 5LXXA 1RJQA 2IC3A 2RRNA 2HVDA 3LW5C 4YDDB 1JLBB 3ITHA 2R7RA 2BJEA 4OZ3A 1EETA 3ZDDA 1S77D 1ZQUA 4YR0A 2J0QD 2EC0A 2UXDF 1CJUA 2J9EA 4G1QB 4UB4A 3MCMA 1SKRA 3GV8B 1HR0J 1N88A 1W25A 1UVIA 2OLWA 3B4MA 2K1RB 3WK8A 2BANA 4G9BA 4JV5J 1RK5A 2FHOB 3EGWB 4ID8A 2Z57B 2LQ8A 1O8BA 4KKOA 4I2IA 2AQVA 2B43A 4QYZK 4HDGA 1IBMF 5A2QY 1ZYQA 9ICCA 3KK2A 3MDUA 2RRDA 2EFNA 2DY9A 1Z00A 7ICHA 3HHEA 5J2GA 3C6TB 2BM1A 3BO2A 5HAOA 2N4CA 4KC5A 3M6KA 1Q81T 3TADC 5J2QB 3HHLC 3D6NA 4RNFA 3NL0A 2DFLA 4M0AA 5J2EA 1CJVA 2VUNA 3AM9A 4OO1J 5HR7A 2JR5A 3QZ7A 5LT5A 1EIYB 2CUYA 1N0UA 4LF5J 2WOMB 1UJ4A 5E0OA 1HLWA 2WFAA 2HFUA 2RUSA 8ICFA 4OQJA 1DTQB 4F5PA 4DR6F 2I9SA 4PUOB 1JLAA 2BPCA 1HFEL 2HFSA 2BGWA 1NHVA 4TQRA 4Y0FA 1ZJNA 1S1TB 5B5EU 5SZTA 2H5XA 3AJDA 2B9WA 1R8CA 2R2SA 3J7A1 1JNZB 1L7MA 1TAQA 2OPRB 4HTJA 3QJJA 3TR5A 1L7NA 2A0FB 4AQLA 3M2UA 4TUQA 5LSLA 2ISPA 3GYGA 3V7PA 4FVCA 4M9LA 3VGTA 2ZH9A 2ZUAA 3NUQA 5H9FK 5HP1B 1N32J 4QJVA 1BPEA 3H0PA 3EDQB 2J0WA 5ITHA 3NVWA 3NAHA 2GQQA 1B99A 2E9RX 1YQHA 2GJ2A 4N56A 1J2MA 4LRBA 3ZNUA 3QUQA 4ZS6A 5ALMA 1X9XA 1L8LA 5DG8A 1U1MA 2MZRA 2ZIUB 3HX0A 1L7OA 4NJ8A 2V68A 2WONB 3RR8A 1VC0A 2F8LA 2CPHA 4QIEA 2FLLA 2W4DA 5E5NA 2ROGA 1COKA 5K20B 3JQKA 2I0XA 3QUCA 4K4WA 2KE7A 1M5SA 1UVKA 4FYXB 4OZ2A 3KLGA 5CYQB 1IJEB 5L1IA 3OOQA 4QOTA 2D8CA 3H7IA 2AX1A 4IL6U 3PKYA 7ICOA 2L9WA 2I1RA 1F5CA 1D9AA 2YX4A 5AJ3J 2OO4A 3AT1B 2B6AA 2QLJB 2OEJA 2ZH8A 1R8HA 4KGKA 1TVRA 1IM4A 4KJIA 2HZVA 2DGTA 4QWCA 8ICSA 2ZH4A 2CKWA 2Q4TA 1ZQXA 3DGVA 5KT5A 1U25A 1SXDA 3GZFA 4RX6A 2BACA 2D41A 2W43A 3VZHA 1T05B 4UB2A 2D3OR 1ZQWA 2Y1IA 4KR0B 2XIDA 1RI7A 4NA2A 1BHNA 5FSDC 2KH9A 4DL0C 4FNHA 4X84A 4R25A 3R7BB 4MKYA 1S72S 3WBZA 1X5OA 4RUCA 3UVJA 3GWCA 3VQSA 1N34J 2HI0A 2ZBQA 2Q66A 2NXJA 1FRKA 3EMTA 2K8GA 3GDXA 2QKQA 2MKJA 3F53A 3NS7B 3CW2C 4IO1A 2ASYA 3QWPA 2NXUA 3MPGA 4C3LA 4DZDA 3ZTOA 3N7SC 3PFEA 2UXBF 2XVTA 1N63A 1F3VA 5KT4A 3DGPA 3I5AA 4PQUB 3QGAC 3UWTA 3WIVA 1URNA 3UCGA 9ICNA 2UXCJ 4Q44A 1X5PA 3QU5A 4A8YA 1N52B 2J0XA 2G08A 3RRGA 6FD1A 4YG2A 1V97A 1Q0NA 1KP6A 1JXVA 1M7JA 3CJ4A 1H73A 4LF8F 1ZQOA 5HANA 4Z37A 3OR1B 3MM6A 3EXCX 4OZ0A 4Y2UA 4ZCMA 1XEZA 4DO9A 3N7PD 2IJFA 1VFJA 1RT5A 1TZ0A 2OGUA 3PV8A 3C2KA 1ZH5A 3U1LA 1TR0A 4F7VA 2P9EA 5AK6A 3MECB 2DIVA 1EJ7L 3QEAZ 5IFMA 2QL5B 3V6KA 1XNQF 4LSNB 4YUDA 5J2KA 2BKPA 2XYGB 4KN7A 2CWKA 2KRRA 2ZH3A 3ICLA 2JC1A 3W64A 4NL9A 3PW2A 1HMVA 3MMAB 5CB1A 3A3NB 1CS4B 2UV8G 3ZNJ1 1B22A 3BSNA 4TY9A 3IS9B 5DDQC 3POTA 4OZJA 1EJVC 3W60A 4F4WA 3DFEA 8ICNA 3MDWA 4JV2A 2EPIA 2H3EB 1FEEA 2KJ9A 4LR9A 1EARA 4NA1A 2NS1B 3N7RC 2W4PA 5KFEA 4FF3A 1LW2B 4CQ1A 2RE1A 4FZNA 5HVHA 1RT7A 3F41A 1FWHC 2L5YA 3JPTA 1N36F 1UPHA 3SZ2A 4TY8A 1D1UA 3WZ0A 4CNUA 4CO1A 2MZSA 1HNWJ 1F9HA 1DURA 5KFQA 2XHCA 1X4HA 5B0EA 1DAXA 2W7AA 3Q86A 4DV2J 3UPFA 2N82B 2UZAA 3FEQA 2DXFA 4RU9A 4RWWA 4L9XA 2W04A 2ILYA 4YS2A 3UMGA 1VQKS 4WFYA 3OR2A 1RU1A 3BYRA 2E9TA 4KT0C 2C3UA 4PQUA 1SXLA 1HEKA 4ZVRB 2KHQA 4IC9A 2JX2A 2QZ8A 3S8SA 1RHUB 1HHTP 5KFVA 3DMJA 1V5VA 3JPPA 3CTRA 4Y2XA 2MKHA 3T9ZA 4DN9A 2W7PA 3DLHA 4ECRA 3PW7A 1U45A 1U26A 1CUKA 1VQSA 4C4RA 3BR8A 2MZ1A 3QGIA 1Q82T 1Z00B 3TANA 4ZKAA 1Q86T 4GKKJ 2WCXA 2WSFC 2F76X 1QQ7A 3I55S 4X4UA 5ETSA 1N36J 3UDEA 3FBFA 1KKXA 2QA4G 2QSWA 3M9MB 1X4CA 2GMLA 3GMGA 2ZE2B 1H2TZ 2DPJA 1P1LA 4F2RA 4DSFA 5CYQA 5G4HC 5FDLA 3W66A 2BJ9A 3HHLD 4ZVOB 7AT1B 3M1VA 3MM5B 4YQWA 2NCKL 4A8XA 4PUOA 3KLVA 2VKRA 1WF2A 4OZ5A 7ICVA 4Z42C 4V1XA 4DPXA 8ICVA 3DYAB 5C42B 3HHLB 4GVBA 4RQ8A 1N32F 3FEYB 5BOLA 4EEKA 2D3ZA 3D6TB 2MQOA 2D1CA 2HFZA 3CD5A 1HQEB 1UVJA 1KQSR 5J2CA 4DV4F 1HHSA 3MM5A 1BQNA 3B82A 1ZQ1C 4RZRA 1U1PA 3KLHB 3JPNA 2EFVA 2QEXS 2GA7A 1GTEA 2POKA 3QSYB 2FPHX 3HHDA 4KHPJ 4UUXA 4C8KA 3I9ZA 2ERRA 4TU9A 1HBMB 3FDSA 4J9SA 2HWTA 4QZBA 4ZJQA 2L48A 3BS5A 4K5SA 2W9CA 5L8RC 1S1UB 2W9BB 1WWHA 4NLWA 2DF4B 4CNSA 4HH0A 1BGXT 3CDAA 2A6OA 2Y9HA 5AKGA 4DHVA 4LSZB 3GFYA 3RB0A 2PMZC 5M2RA 4B9MA 2N4DA 4QZVB 4W90B 3DOMB 4HL9A 3Q2TC 4YB7A 9ICEA 4RLEA 3NEKA 1NB2A 1EJUC 4RDVA 4MIAA 2D7SA 4K4GA 2B3TB 4M2YA 1C2PA 1FRHA 2XLKA 5GADU 1GMWA 2VG7A 5ALTA 5D0EA 3EXYA 2DCUB 4PG7A 1YSJA 3R0DA 2QSFA 1FWEC 3OTCA 4LMZA 3WK4A 3GGMA 2ZH7A 3TUZC 4RNMA 2C3OA 3L7OA 1RT3B 5ALYA 2FUG9 2C22A 1ZOLA 3B78A 1TKDA 5AE2A 4L72B 2AHOB 3NY0A 5J8YC 2K3IA 4ZMMA 4PEOA 2BCVA 2VOPA 3E01A 4DL3A 1FKPA 1RB0A 2F9JA 5HR6A 4B3SF 4X62J 3R27A 1Z4OA 2CQHA 4R0JA 4NLTA 4V19X 5EE9A 4R0EA 1NBEB 3OFFA 2OYYA 1KS2A 5F8IA 2BOPA 3C14A 3D0GE 2AYGA 5ETTA 1U6FA 5A2QU 8ICLA 4ZVTB 3C6UB 3HVAA 4QBUA 4M5KA 4RZBA 4P71A 3TVZA 4OIXA 3SQOP 1B3TA 4P74A 3S01A 1XRTA 3OTQA 5HBMA 2K3KA 3RH4A 5HATA 2ZTCA 3UW1A 1GEHA 4O44B 1IBKF 1EHWA 4YP3A 4LF8J 3NRWA 2DHHA 1XNQJ 2ZHOA 3RU0A 3H8WA 4C8LA 1Z2LA 4NL5A 3QX7A 3TI0A 4M5IA 4RL1A 4LZDA 1HNIA 2GS8A 2GWSA 1AUSL 2C3PA 2NV3A 3E0LA 5IQ6A 2XMJA 2J7WA 3MWBA 2E8PA 2VFUA 3MURP 2CQ0A 3EWGA 3K2YA 2EG2A 3V2UC 4F91B 3D1HA 4DF8A 1HWIA 2CPEA 8ICRA 4MFFA 1YTYA 3JSMA 5CYMA 4PH5A 3RBDA 4B3SJ 2E8NA 1HNIB 4FO6A 5IT4A 5HROA 3AAWB 3CMQA 2A3JA 2G2YA 4Y2QA 5ALHA 2OPPA 1LFWA 2AGPA 2YNHA 2LHTA 2OODA 2HURA 1ZQJA 4NXNF 2ZWPA 4ECTA 3AOBA 3RAXA 4F8RA 5L9XA 2UXBJ 1KHWA 3ONQA 3TACB 2Q3PA 2KTQA 2YKMB 4B3OB 1N5TA 4KE5A 3LVVA 1R0BG 4DPWA 4XK8C 2C2KB 5ETRA 1BNOA 1QVFR 2MHEA 2N3LA 4KLTA 4LREA 1R9XA 2JRSA 1H3DA 2ZTDA 2J5AA 3IXQA 3KMSA 2NQPA 2BCUA 4NEYA 1FVSA 2IY5B 2BJ3A 4ZA1A 4A48A 4K50A 3FBCA 1IBCB 1UA1A 3BQ0A 3JPQA 2UXCF 4QQBA 4EBDA 2H9ZA 1OWXA 3PJWA 5DS7A 4BX9C 4F4AA 5J1PA 3ISBA 5K5MA 4Q2MA 1XWLA 4C8ZA 1P9QC 3SAGA 2HNYB 3C23A 2G0JA 5J0PA 4ZHRB 3KDOA 1RT7B 3CJQA 1PO9A 2C28A 3MEEA 4X2BA 2DXDA 5HROB 5AKYA 2PXIA 3F2CA 3CE8A 3CRXA 2WVFA 2WOMA 4NLXA 4QU6A 9ICTA 1SV4A 3HK2A 4HACA 4DWIA 5BPCA 2MQQA 4MFBA 2KL8A 1YZ7A 1HUZA 4DMZA 2EEYA 3K58A 3NNHA 2DO0A 1JLQB 3N6MA 1I6JA 3CMAS 2KJ8A 1FD2A 1WC3A 2U1AA 5AM1A 1FCAA 2ZUGA 2ZITA 4WIIA 1ITPA 3LP1A 1HQUA 4OV1A 4LR8A 3GIPA 3O3LA 4KH1B 4JMUA 3AXKA 4EP8C 3LP2B 3PG9A 3PDNA 5CYJA 4EPEC 1NJXA 3FFIB 3FAHA 5DDMA 4CYUA 1FWIC 2CXYA 1F1BB 1GH8A 3HT3A 1UVLA 4KGZB 2CPJA 4EPBC 2FZGB 2GHVC 1YJUA 5JVHQ 5KFPA 3IAS9 2ATCB 2HAFA 2IVMA 1U9LA 3NBPB 2XTJP 1VJQA 3H5SA 3QXGA 4NWBA 1FJGF 1QJHA 5A8RB 3AFGA 5ETLA 3W61A 5DGBA 2CADA 4KN4A 1VI7A 2DKXA 3WU2U 4BC9A 4QW8A 1Y7PA 4P0PB 3MGVA 4F50A 4U7UK 1ZS6A 1IV8A 3ISZA 1HBMA 1FO4A 2ZDPA 3CO9A 4HHUA 1T9XA 3V6HA 2B8QA 1P27B 1RAHB 1BNPA 4DL5A 4DCOB 3MEDB 2VL1A 3CJTA 1DGSA 2ZH5A 1IQZA 1R6YA 1U48A 2W55A 8ICMA 1COOA 3TJAA 3G6VA 2CPDA 3UVJB 2VKZG 1KQFB 3DMJB 3SSRA 3T1YF 2B6GA 1U8SA 1Z19A 1EJXC 1VRTB 4PWDB 3I0RA 1YIJS 1GT8A 4ANDA 4ZP6A 3M8PA 1NK6A 1OMSA 2M52A 4CYUB 5T41A 3GG1A 4FS1A 8ICXA 2ZD1B 3VR1A 5GADI 3JSMB 3BF4A 3TUJC 3NMAA 2AZ1A 3PR4A 1KRAC 5BXIA 7ICGA 4F4ZA 3FNNA 1TUVA 1R43A 4U9RA 2HFOA 3BKFA 1HWUA 1U47A 3OTOF 2AJFE 4MF8A 3SQGB 2G06A 3GFXA 1NJIT 4F0KA 2GFFA 4NOHA 5LJ3Y 2CPYA 4TYAA 1B70B 2IAJA 4M5DB 1NK7A 4KQNA 3FSXA 2M5YA 2MJNA 4ZN1A 3VCDA 2QFIA 4I2JA 3QNMA 3RAQA 4W92B 4B3TF 4AXIA 1WI6A 1ZQVA 5ETKA 1BQMB 2V63A 5RUBA 3I82A 3HVTA 1PC5A 2MGZB 4LJMA 1UT8A 2KN4A 3QZ8A 3QUTA 1HWKA 1FWLA 3VF0B 3SI8A 5F0UA 2X3DA 3H20A 3KK3B 5K14A 5IT9Y 1MROB 1V3SA 5ETOA 1X7VA 2XMTA 4QW9A 3GZ7A 1WG4A 3ULHA 1W2BR 4R5PA 1NK5A 1OUQA 3PCOB 1S9EB 2B9XA 2VC0A 4JI3J 4FVMA 3NOCA 2K60A 4KLEA 3FQLA 1FJ7A 2J6SA 2WB4A 3GSIA 3SFUA 6AT1B 2AYEA 1HA1A 4LT6A 3QJPA 3WK5A 1K73T 4OYOA 2CJBA 4KLFA 2Z56B 1S1VA 3MECA 7ICMA 1F5SA 4FF1A 4IYQA 4WXWA 2RP5A 2JGAA 1TQLA 5KL1B 1GMWD 2QA4S 3KTQA 5IS2A 3RR7A 1F3FA 4IUFA 5E3PA 3MMCA 2RQCA 4ED3A 4F92B 1FKOB 4DX6A 6FDRA 5DKWA 4XA5A 4I2HA 2P50A 1RJJA 1VK3A 1ZRNA 4RPXA 2V9KA 3THTA 2E9ZA 4XDCA 2LA6A 4YMNA 3A13A 3R2CJ 1OPZA 4KLSA 4K4VA 2E3TA 2CA9A 3MDAA 1A0OB 3K57A 2MQ8A 4MAKA 2HS3A 4H9MA 1RCOB 3D4JA 4Y2YA 1TE2A 1FJCA 3QU9A 4DX8H 2M70A 3KLEA 2BUNA 1TAUA 4MK9A 4DXLA 2K4EA 2W9CB 3A0HU 3OTDA 1HPZB 2FHKA 5AXKA 2X51A 1A7GE 1EP4A 3T41A 1SB6A 2FTYA 3ICXA 2M8HA 3RH6A 2DRAA 3QQCD 1CBKA 2DGZA 7ICKA 2L3MA 3MEKA 1X6JA 4GFJA 4ES3A 4OYZA 4ZVEA 2WF6A 1ZPVA 1XO1A 2GAGC 1U6ZA 1NM2A 4UY8T 3AUOA 1NLKL 2ZOGA 2MU2A 2FVPA 4O4RA 1Q7YT 3M32A 2V4JA 5HVGA 5AM4A 4ACOA 4AL7A 2CQIA 3O5TB 4ZVUB 2DCLA 1TL4A 1SIWB 2RLTA 1SJFA 4CT8A 2YWKA 2DH8A 1RXVA 2J7KA 4YY3F 1RSCA 1DQ9A 5HMMA 1Z4UA 4RQ1A 1FEZA 3TW0A 2FZKB 4QPXA 4C0ZA 4WE1A 2P53A 5G4DA 2XC9A 4XIUA 2QE5A 1OSCA 1NPPA 4EPDC 3OFHA 4IOBA 3ZDEA 3M7DA 3US5A 1WOSA 3OD2A 3MCSA 4QIGA 9ICSA 3LWLA 4WFZA 2AQOA 4JI1J 2P6RA 4C11A 4MHVA 3CXCR 2LU1A 3N28A 2UUCF 4CI0B 2KT5A 4YEAA 2ZTEA 7ICRA 1NSKL 3A8JA 3G8SA 2DRBA 5A6TC 7ICIA 2X1GA 1S6UA 4TYBA 4O9MA 4IRCA 2WVBA 2G09A 4USAA 1IR0A 5KFFA 3B54A 4H4MB 5DDYA 3NGTA 5J2HA 2HRTA 3NGKA 3KUEA 2ZIVA 2AD9A 1UBPC 1ZQSA 4DS4A 3SBMA 4UW2A 1IKWB 3HKZD 3D7SB 2YNIA 3PACA 3TA1A 2IHMA 2QL9B 5LL6d 4X4SA 4WCEQ 8ICIA 3DRRB 1OQ6A 4M9HA 2DGUA 4OX9F 1RAGB 4ED5A 4DSJA 3TFSA 2F9DA 3TZZA 1O5JA 5FIIA 4LBIA 1UJ6A 4N77A 3BN7A 5AIBA 3I96A 4DV1F 4HYKA 2XMWA 2ES6A 2HFVA 1NCLA 3N6LA 3MABA 4RW4A 4A8FA 4NE9C 5CYMB 1SIJA 1RT4A 2YKQA 5AE3A 3HM9A 3BREA 3P8BB 5J0YA 3CCTA 2Y0SC 3A0BU 1I5OB 1LVHA 1RAKA 5GAGI 2ZIXB 5D46A 3O6QA 2UBPC 1K5OA 3MR3A 5G5GA 1VRUA 2XZWA 4CP5A 3CSKA 1N4LA 4FKXA 3IWNC 4RDWA 3PIPQ 1I94F 3CD6S 3C2PA 2HWIA 4DV6J 2XB2D 3OVBA 1DGJA 3IDWA 4TLQA 1HWJA 2WSCC 1Y9OA 2JH3A 2BYCA 2QLXA 4DR7J 5J2PA 2OPQA 1PYSB 3F44A 2I6WA 2XY7A 1SI9A 4QZFA 3KUHA 3F5AA 2FMSA 4DUTA 3BQ7A 1Z2ZA 3PX6A 3DRRA 4YMEA 5AIAA 1YNYA 4A8KA 1R8BA 3RRHA 1ZJMA 3C1ZA 1T11A 3IGVA 3ILIA 3IM1A 3GONA 1R8AA 4BBYA 4ZJLA 1LWFB 3DEEA 2LM1A 4CH1A 1FESA 2GSEA 1KOOA 3DI6B 4P72A 5AI8A 4ZJOA 1FFGB 1KKHA 1FJGJ 1RWUA 2AYMA 4DQIA 2CRLA 1RAIB 2VFRA 4UAUA 3UR0A 1TL1A 3H5YA 4GKJF 4C65A 1F44A 5L39A 1U1OA 1UW4A 1FI4A 5F8NA 1A5OC 1H2VZ 1NZAA 4DDFA 4OI0A 2CRXA 4ICAA 3BDEA 1FWPA 2DQNB 1SQFA 3IMQJ 2KV2A 2YNIB 3HPOA 4LSLA 5AXNA 3ZDAA 4Y2MA 3Q8KA 3QAUA 4B9TA 3MR2A 4YB5A 2KHCA 3AOCA 2FVQA 2CJAA 5L1JA 4R63A 4YD1A 4FF2A 3L4BC 3PRDA 4DS5A 5J0WA 3NVVA 2AYBA 1RM6C 1NK9A 3J80U 4QCLA 2DY1A 2EKYA 4DV7J 1NZBA 5B7WA 3UN5A 2HVEA 1EJSC 2IRXA 3IA0A 2NZCA 3T19A 3QPIA 2XSJA 3D68A 4PGQA 5DDPC 5HP1A 5A0LA 2F3NA 1DBDA 2BJ7A 3CJ2A 3W5ZA 5H1SV 1NB7A 2HQFA 4RNHA 1OPIA 1PBUA 5A8KA 2LQ9A 3T8LA 2LEAA 4JI2F 4HTIA 1HPZA 4D3GA 1EP4B 2G07A 3LO3A 3A3OB 3QLHB 2M2BA 3W2VB 2P6TA 4F4KA 1KTVA 2R7SA 3K5MA 3M6XA 4YN4A 5E79U 2W7OA 2O5DA 4FYDA 2EI5A 2UUBJ 1H74A 1DLOB 4DV3J 4DL4A 2FMQA 2VPYB 4A4JA 4M04A 3F73A 3TFRA 1CJTA 3TX8A 2CNKB 2BVZA 4IQWA 1QVGR 5C2GA 4C4WA 3M9OB 2YKAA 3VAJA 2CWXA 3GJSB 4P73A 4IRKA 3LDAA 1Y4ZB 4Y2AA 4MJKA 3UNGC 5JMNA 1NU4A 4CM0A 1T3NA 1U0HB 1GO3F 1XMOJ 5KFCA 4JI0F 3RJKA 3M8YA 2Q43A 3E2EA 2NUUG 1XQIA 1LQ9A 3ZTRA 3T1AA 4E0DA 3QSIA 3H2LA 2AMCB 1WNEA 3GJQB 2YH1A 1WF1A 1RTIA 4IO9Q 4EX7A 3P5TL 4FXWA 3OXFA 1N33J 1VQYA 3WK9A 1UVMA 2R2TA 2I38A 2APOA 5I3UA 2WSEC 5DGAA 4Z6CA 5AKEA 1VHIA 1IBLF 1SUQB 1QQ6A 2LQJA 3DLLQ 5J0TA 1VQ6S 4C6AA 5DM7Q 3TQ1A 1HNXF 1GKPA 3LA0A 2V4JB 2NRXA 1ZQRA 4X64F 3CDWA 2E5LF 1ONXA 5DLGA 3E8OA 3DLGA 2MY7A 2RVJA 1S8OA 5AJ3F 3KOOA 5KG7A 1V9OA 3KZIU 3DC2A 5IWAJ 3CF5Q 4H4OB 5KFTA 3MMBB 2E1MC 3SENA 1UA0A 2K8BB 3ITHB 3RG6A 2YPYA 2FB0A 2M9NA 1OYEA 5CP2A 1NEEA 4X65J 4LJXA 1AXQA 1SZHA 2VFVA 4J90A 3LSBA 4X62F 4AL6A 3GIRA 1LNQA 2KJVA 4I2PB 2Q1LA 3B6BA 2BW2A 1KONA 3DLJA 1ZTWA 2HGMA 2GJIA 2A19A 2HHUA 1VK8A 1GMVA 2HMIB 2OI2A 1HW9A 4O4GB 4NM2A 4F2SA 2I1QA 5THWA 1S1WA 2ACYA 5E2QA 2RQ4A 4GVLA 4OI3A 1SL1A 1FEHA 3M30A 2YKPA 4FN5A 3LS9A 1A0PA 2HQDA 3WK7A 1CVJA 2XCAA 4CQDA 2QIFA 4I2EA 1XR6A 2OEKA 1T0TV 1NFGA 2RQ5A 3MPYA 1RT6A 5LSRA 4C3MA 2DYAA 4ECVA 2VA2A 5DBBA 3CDUA 1FNMA 4AC7C 3WIUA 2XULA 2EC2A 1X9WA 4O4GA 1H7WA 5B0GA 3H5UA 2A2CA 1NZPA 1Z4NA 5MLCV 4GKKF 1QDUB 4UB9A 3IM8A 5DZ6A 3KLHA 2QJ3A 1LK5A 5J2PB 2ZE2A 4F3OA 1FFSB 1XR7A 1UHUA 1Q8IA 4RW9A 3AOAA 5SUHA 3QT5A 3QBCA 2EZZA 1LK7A 2A1BA 5DB8A 3G4SS 2GVDB 3FK4A 2V8DA 1J27A 3MM9A 2V67A 1IQTA 4TQSA 1C1BA 2J76E 5ALZA 3HCXA 4NYPA 1B4SA 2VD3A 2A1AA 1Q7LB 1FDDA 2HMIA 3DLEB 3OJSA 1ZTTA 1TL5A 2IMOA 3DNCA 4FF4A 2AZ3A 4KLOA 4PL2A 1MWZA 1B4FA 1CSJA 5HN0A 4ILMA 3HD2A 1H7XA 4HR2A 2VONA 1RA5A 3PKMA 4DR1J 2UUAF 2E5IA 3DRSA 1U02A 3GR1A 3BB5A 2G5HB 3VGSA 4A46A 3C28A 1VQ8S 4DZHA 5LMUF 1BWVA 9ICBA 5EDWA 5HQ8A 2GO9A 3CCZA 5C24B 1Y10A 3NWGA 2HS4A 4GIBA 2G9OA 3DDIA 3JSRA 4Y6IA 1X40A 4ZPBA 4JK1A 4HAIA 1JXLA 1OO0B 1Y3JA 2F3JA 4U7UD 3LP0A 4O0NA 4USJC 2NYVA 3D67A 2V94A 2R7UA 2QT7A 1TKZA 3K5PA 2HK2A 2VQEF 4HACB 2PMHA 4IDKA 4KLUA 1S6QA 2NRWA 3N9UC 3CJ0A 2QGFB 4GXJA 3OW2R 4WBFA 3F2BA 2VG5A 3GIKA 1KRBC 3LSCA 2YKNB 5L46A 2FMPA 4WFBQ 1BQMA 4DV0J 1DHMA 2KVIA 3T1YJ 1HQUB 4K0KF 2P9GA 3TP2A 5IM0A 3ZTSA 4F5QA 1HBUB 1GAOA 2DGOA 2KP7A 3BGLA 1F60B 1N56A 1IVZA 2RNEA 2OSQA 2B4UA 4ILRA 4RW8B 3NS6A 3MOZA 1WHWA 1BPZA 1YLXA 3I76A 2JL9A 3CC4S 2ZC3A 4ED6A 3UR3C 1S99A 3NASA 2EANA 2VQEJ 5HLFA 3N0VA 1SH3A 4URGA 2HRUA 2YWEA 4BJHA 5DG9A 2JZ5A 4DL2A 3D6FB 4RW4B 2RQKA 5ALRA 2KZMA 1NNLA 1CEZA 5KFUA 3L5KA 2Z00A 4LVOP 5B0CA 1MC8A 1RT2B 4YHHJ 2ADCA 2ZWOA 2HVIA 2ZIWB 3UD4P 4P6QA 2BA9A 2OM6A 1XJWB 2HCFA 3LGMA 4KRWA 2E8MA 2AF6A 2VF3A 2YNHB 4TNOA 4PHEA 1WWUA 4PGXA 2GGPB 9ICAA 3MMJA 1XERA 2HLUA 5DG7A 2OD4A 2E7WA 2HQIA 1CRXA 3QLHA 1FRJA 3BSAA 3UE2A 3RGIA 1RDRA 3UXNA 2LCWA 2FVRA 1SWWA 2Y9TA 2SXLA 4UOFA 1YHQS 3CCUS 1L3TA 1T9UA 1JN3A 4C8YA 1OS5A 1CLFA 3Q8YA 1SB3C 1SV0A 1M5OC 1WCNA 2DTJA 5HMFA 5AXLA 2W24A 3LWMA 2E5HA 2IOFA 5HMLA 4KHMA 4PXEA 2IJNA 4OZ1A 1FRIA 4KPYA 3A3PB 1P9YA 1RHJB 3NG8A 3C15B 2WB1D 2XSFA 1S48A 4MIWA 4X66J 4S0MA 2E5SA 2E5LJ 1DY3A 1QQ5A 5IT9U 5KFNA 1MW7A 4I7FA 4NZ6A 2BHNA 1ZOTA 2V2VA 1S6OA 4G65A 2M0NA 1EJRC 4C0HA 3HMJG 5D15A 5CZXA 2XNQA 3W62A 4C48A 5EHHA 3FMWA 4P4PA 1S1XB 5AKKA 1PO6A 1HJPA 1S0MA 1S12A 1U2RA 3K59A 3Q8PB 1PKUA 3EYZA 4Y65A 3K5OA 3LK9A 5A8WA 4NCGB 4LVNP 1X9MA 4WGXA 2AGOA 2KT3A 2RDDA 3WKEA 3CPWR 5E3QA 4N7TA 4ZP7A 4DCJB 4MK8A 1VS3A 4B08A 2E1RA 3N5BA 2J8SA 1NKBA 1F9EB 1R9YA 4ZPDA 4IOAQ 3WDOA 5D4LA 1R8PA 3EZUA 2FLNA 4KSEB 1HL6A 1GX6A 2HVZA 2UVWA 8ICYA 1NSPA 1IXKA 4DZ6A 3EUNA 4CLTA 4Q2LA 2G1HA 2CDRB 3NRBA 4QZ8A 3GG0A 2X1AA 4C60A 4LFAJ 1O03A 2KK0A 3IRXB 3OJUA 3QIDA 5J8YA 5ALPA 1RHKB 1VISA 1Z1VA 4GVBB 3DKDA 4PHDA 4J9LA 4P0QA 5I3QA 4C5ZA 4ED2A 1YBAA 5A8RA 3N01A 1HNVA 5CHGA 2KT2A 1UQVA 3TYTA 1ZD5A 5C25B 3WQPA 3LVWA 3O7UA 3SD7A 1ZZNA 2RRBA 4QZGA 2F8MA 5LXRA 1ACMB 1D8BA 4B9VA 3AD7C 3VCBA 4DV5J 4FKYA 2PN6A 1KN5A 2QARB 3DRPA 2VH7A 2DGWA 7ICPA 4X64J 3MFIA 1S10A 3MAHA 2A10A 4M63A 4I67A 2AEFA 3CMES 1MLAA 4I2FA 2J7UA 1URRA 1OIAA 4NRUA 1HKAA 1SH0A 2I5JB 3RBXA 1NPRA 8RUCA 2DR5A 2BRKA 1JIHA 1ECWA 4YB6A 4F67A 3THPA 1RBLA 2XMVA 3QEBZ 5HQMA 3G87A 4QJFB 1WC4A 1JWWA 2GV1A 4C8MA 4GBDA 1HYSB 3G9CA 4KYZA 4FPRA 2UUAJ 1IXRA 1S6PB 2JNJA 1KNZA 5KT7A 3CT9A 1A5KC 1N5YB 1I1GA 1MN9A 2FJXA 3IR5B 3W9HA 3DDNA 1IJFB 3CO0P 1TKZB 1I51B 2B7CB 2ZIXA 3U02A 4ATNA 4NZ0A 3BV8A 1VIXA 7FD1A 5JVGQ 2FPKA 1Q4RA 2R7XA 1FKPB 4QYZJ 1D8ZA 1YBTA 2DGQA 2RS2A 2KFNA 3WKBA 2PT0A 5HBMB 4CO4A 3PM9A 2I9GA 2H65B 3BH6B 1RTDB 2I5JA 3OPKA 2F44A 4A8SA 2AKWB 2C2MB 4NCGA 3G6YA 4CF4A 1M1GA 4U95A 4ER8A 1KQGB 2V4RA 4IR1A 2LYVA 4XPCA 5DZ7A 1S4FA 1QLNA 1FWBC 1NSAA 1LV5A 2KG1A 3QRPA 1K1QA 3T5HA 1CC7A 3TA2A 1UEUA 2XLJA 2D74B 4OX6A 1R9ZA 5KTQA 1VRQC 2KFYA 2UUCJ 3PSTA 2WHEA 2HDOA 3MD3A 2FJWA 1J6PA 1K44A 3KBBA 2F4VJ 5KFBA 4IG3B 1TFYA 3VAFA 2PAJA 3RJJA 1P6TA 2BJ1A 3MCOA 3EUB2 4LF4F 3QGPA 5I4MA 3HJVA 3UBPC 3TARA 2CIMA 3D2NA 5E33A 2E5JA 2YB4A 4NLZA 5LMUJ 2QB1A 4UY85 2VG7B 4IFYA 5ALQA 5GMEA 2FJAB 4AT1B 1FDBA 1IE7C 1K8AT 3JTPA 2O67A 4O3RA 2HHPA 5LOQA 1SCJB 1RABB 2W9AA 2ZKUA 3VV2B 1RK6A 2OSRA 3L95X 3KG4A 1V3RA 5ALEA 3M2RB 5KFXA 2QL7B 1Y5NB 5M2PA 4WHBA 1XU4A 2Z7JA 1W26A 1ZQKA 1JKHA 2HPUA 2W2PP 1JX4A 4PCQA 3MM8A 2CXEA 2QB0A 1JLEB 2GHWA 4O0IA 2V9WA 1YG0A 4NI2B 2M8DB 3UCUP 4P9SA 1IKVB 1PAUB 3A8EA 3HSJA 3KJVA 2KB2A 4OI6A 2PD1A 1HBNA 3KJQB 4TLRA 3OFGA 2A1JB 3BKUA 3ORYA 1PJ7A 3QO9B 5CCLA 2BW7A 2ZOMA 1N8RT 2VIHA 4KLHA 3MTJA 3ETOA 4RQMA 3JSYA 2MUTA 1R3NA 3X1LB 2CVIA 2YWGA 2W8LA 2MKCA 2HHHF 4JWMA