4DEZA

Structure of msdpo4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
TKWVLHVDLDQFLASVELRRRPDLRGQPVIVGGSRKVVTCASYEAREFGVHAGMPLRAAARRCPDATFLPSDPAAYDEASEQVMGLLRDLGHPLEVWGWDEAYLGADLPDESDPVEVAERIRTVVAAETGLSCSVGISDNKQRAKVATGFAKPAGIYVLTEANWMTVMGDRPPDALWGVGPKTTKKLAAMGITTVADLAVTDPSVLTTAFGPSTGLWLLLLAKGGGDTEVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV 1
publication title The PAD region in the mycobacterial DinB homologue MsPolIV exhibits positional heterogeneity.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 75
structure length 232
sequence length 238
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dezA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4dezA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dezA01
3QO9A 3H4BA 4DLEA 3T5KA 4O3OA 4DOBA 4Y2CA 1LB2B 2BR0A 4PWDA 3C23A 4R64A 2R8GA 2AX0A 3OL9A 1C1BA 3HP6A 5F8NA 4TY9A 2FLNA 3ISNC 4YQWA 4EYHB 8ICXA 4X2BA 1ZQVA 4RNFA 3PW5A 4R5PB 4DS4A 3C6TB 2IM1A 5KG2A 1EP4B 3OL8A 2BE2B 1RZTA 1KLMA 4IR1A 5KT6A 4KLOA 4EZ9A 2WCXA 1RTHA 3HKWA 3ITHB 4TLRA 5CWRA 4PHPA 5CYMB 4EBDA 1JLBB 2BRKA 5HLFB 2ASJA 1C7YA 1RT3B 5DQIA 1ZQCA 1T7PA 4ZPDA 2ZJ5A 4RW4A 1MQ3A 2OH2A 5KG3A 1I6JA 4RQ6A 1NKEA 2VG6B 4RUAA 3DM2A 4TQSA 5KFAA 3HX0A 1ZETA 1QSLA 3RRHA 3E51A 3CDEA 1S0VA 8ICNA 4RQ2A 1RAJA 3D28A 3DRRA 4QW9A 4YMOA 7ICLA 5KFIA 1ZQGA 5HROB 1PZNA 3JPNA 5KFNA 3SYZA 4KB7A 3H8SA 2UVWA 4DL6A 2IC3B 5HP4A 3PMLA 4URSA 5J2NB 1S0OA 3M9NB 3RRGA 4J9MA 2IHNA 3UXNA 4NLVA 1ZQQA 3C6TA 1LW0A 2PFQA 2Q0ZX 9ICIA 1EP4A 1B43A 4FBUA 2BE2A 4B9VA 1IKYB 7ICVA 1JMSA 9ICGA 3ITHA 2Y1JA 5DBBA 2R2RA 2XWYA 4C8KA 5J2PA 5DDYA 4PHEA 3MDAA 4ECQA 3ICLA 4NLQA 1RT3A 3HWTA 3PW7A 5KFLA 4M9NA 4F5NA 2F1HA 5J2KA 1ZTTA 2WOMB 5CJ7A 1IXRA 2VG6A 5JXSA 4JUZA 4NLTA 4ZH4A 4I2JA 1CUKA 2I9GA 1NK4A 8ICOA 1RYSA 1JLGB 2JEFA 4URQU 1HNIA 3AU2A 4UB3A 8ICKA 5HROA 2D7SA 4DSLA 2CJQA 4K4XA 4R63A 4DFKA 5J2AA 1HUOA 1RXWA 4KTQA 9ICHA 4X5VA 4QW8A 2W8LA 3HW8A 5BOMA 2XGPA 4KLHA 2IC3A 2VG7A 1NK7A 5J2NA 4Q0BB 3H4DA 1S49A 1KHVA 2V0NA 4NZ0A 1U09A 1VRTB 4KN7A 3RB0A 4DL7A 5DBCA 3IG1B 4I2IA 4UB4A 3GV7B 3UQ0A 3V81A 1XR5A 4WE1B 3CWJA 2ZE2B 5DBAA 1OS5A 4C8NA 1S6PA 3MF5A 2R8IA 1ZQIA 3V6KA 4DL5A 2UVVA 2WOMA 4F4WA 4O4GA 4ECVA 4M47A 3Q8QB 1XSNA 3TFRA 8ICYA 3JPPA 4DQIA 1RT7B 2B5JB 1JLGA 7ICGA 4ECYA 5DB7A 8ICWA 4DOCA 4C8MA 1BPEA 4TQRA 5J2MB 4WXOA 4KN4A 5J0TA 4M6WB 4I2EA 2AQ4A 1KHWA 4R66A 1S48A 4NY8A 1LW2B 3MFIA 3AUOA 4XO0A 1QLNA 4QWEA 3N6MA 4PH5A 4C8LA 4Q0BA 3MDCA 3DRSB 1VRTA 3GDXA 4NLGA 3BR9A 4BXOB 3RB4A 1W25A 4KBIA 2BPFA 4NLDA 4RQ3A 5J0WA 4JV2A 3CIZA 5J0OA 4RQ8A 4ECSA 3MR5A 3BSAA 3PR5B 3DLEB 3LAKA 4GXKA 3PY8A 4QWDA 3RB6A 5KT5A 4ELVA 3CJ2A 4RT2A 3DRPB 3LDAA 1U45A 5KFVA 4IH6A 4ZHRB 3THVA 2JEIA 4RZRA 1HUZA 5KFYA 3N97B 4R65A 4F5PA 3EZUA 4UB5A 5KFCA 1ZQSA 3NBPB 2XI2A 3Q8PB 1S9GA 3B0XA 2B5JA 1ZQFA 4RPZA 3ZD9A 3LK9A 4J9SA 1X9SA 3KK1A 4M6WA 5DGAA 1X9WA 4TY8B 3KK2A 4O5CA 1NJYA 1LW2A 5DLFA 3MR6A 2WHOA 1UA1A 3B0YA 3DMJB 3HVTA 4M95A 3DRSA 4C8OA 1FK9B 1Z00B 1SV5B 4I27A 2YNGB 7ICUA 4RQ5A 3G6YA 2FMSA 4BXOA 3LWLA 5KG1A 4KITB 2KZMA 4KFBA 5HMLA 2KN7A 1D1UA 1LWEB 5KFPA 5KFHA 4B3OB 4RNHA 8ICQA 3DRPA 3PNCA 4QPXA 4UBBA 4JV1A 1SL1A 1C2PA 1S10A 5DB8A 1SKRA 1SH3A 1L3SA 3JPSA 3H5UA 3G86A 7ICJA 3KK3A 2IAJA 2R8JA 2ZJ8A 2HNYA 2XY7A 2W7OA 3IM1A 4O5EA 9ICEA 1SH2A 5IIOA 1KFTA 4DL3A 4EBEA 1JLEB 2NRWA 3MEGB 2VG5B 3IRXB 4IFVB 4UBCA 4DQRA 4MFFA 2AGPA 4IQUA 4GC6A 1DTQB 3KNAA 5CP2A 3GYNA 4B9LA 2B43A 1HQUB 3DMJA 3UDLA 5I3UB 4RT3A 3H7IA 3IS9B 1Z00A 1SV5A 1T03A 4FBTA 2YNGA 2XCAA 1HYSB 8ICTA 4IOBA 3KJVB 3EWAA 1LWEA 1HMVB 2F1IA 4NLNA 4DL4A 4JWNA 4QZEA 2HNDB 3KHGA 4F3OA 4IFYB 4NRUA 2I5JB 1LWCA 9ICSA 1N5YB 1JN3A 4NM1A 3M9OB 1RA7A 1RT6B 4RW9A 3RJFA 4I2QA 1DGSA 1SKSA 4QWBA 3PR4A 4WYLA 2IA6A 1WCLA 1ZQDA 5C42B 5J0SA 3UXOA 4ZPBA 1JLEA 3MGHA 4QWCA 2BCUA 9ICWA 1S0MA 4LQ3A 8ICHA 1ZQEA 3IRXA 4IFVA 4UAWA 2W9AA 4PUOB 1R0AB 1JLFA 2NRZA 2HVHA 3ETLA 4HKQA 3MABA 5KFXA 4I2HA 5KFZA 1C0UB 4I2DA 5I3UA 5KFOA 1S1UA 3IS9A 4PGQA 2HNZB 2R2SA 5J2CA 4ELTA 4M0AA 2OPPB 2A1JA 4NLSA 3OGUA 1RT2B 3KJVA 3PX0A 2ZUBA 3EW9A 1HMVA 1RTJB 9ICMA 4NLRA 2BQ3A 1S4FA 1ZQLA 1ZQZA 1CSJA 3PHEA 3JSMB 2HNDA 1KEJA 4R8UB 3V4IB 5CHGA 4IFYA 4B9UA 2I5JA 3MECB 5C24B 3SV4A 1QAJA 1IKWB 8ICCA 5L1IA 4WFZA 3BQTA 3ZDEA 7ICIA 4ID5B 2VA8A 2J6UA 4LSLB 4IQVA 1BPDA 5KFGA 1RDRA 1SL2A 5C42A 2UUWA 4P4OA 4QZIA 4BDPA 2BANB 1T05B 3I5AA 3T19A 5KFKA 4DG1B 3PW0A 1S9FA 4K4GA 3RJKA 3N6LA 3OHAA 4O3PA 4P2HA 3OJSA 4NLKA 1HQEB 2XY6A 2JEGA 3T3FA 3JPRA 3FQLA 1R0AA 4KO0B 4YMEA 2KTQA 3CDWA 8ICGA 4O44B 2PI5A 2BDPA 2H5XA 3SFGA 1XC9A 5F8MA 4U6PA 2F1JA 3H59A 3GQCA 3HHKA 2HNZA 3RBEA 1ZQWA 1QAIA 4NXZA 4G3IA 4K4UA 2OPPA 3PO4A 4KLEA 3QGHA 1NHUA 1RT2A 3KHHA 4ZPCA 2PFPA 1RTJA 5FDLB 2QV6A 2OPRA 4YP3A 5C5JA 3JSMA 4GLXA 3C1ZA 4R8UA 1TVRB 1RTIB 5KFQA 1UWBB 3MECA 5J0YA 2IJNA 4KMUA 2BCVA 2HAIA 2BHNA 4DF8A 4ID5A 3LP0B 4K4ZA 1D8LA 4LSLA 1MSWD 4F5OA 1JX4A 2ASLA 2BANA 4DG1A 1NJZA 1BQNB 4XRHA 4EYIB 2ZKUA 2WK4A 3BSNA 5EUHA 3V7KA 4IQWA 3IGNA 1KLNA 4KO0A 4KV8B 4K4VA 2BQRA 3K75D 3MFHA 4KLQA 1LWFB 1HPZB 2YKMA 4WZMA 3V6DB 4IH5A 1ZYQA 2FVSA 3ZDAA 5DG8A 3ZD8A 5CB1A 1RA6A 4WYWA 3OL6A 2VANA 4F4YA 1ZQOA 1REVB 3C21A 2YNFB 2D41A 2D3UA 4YN4A 4R5PA 4DSFA 1DLOB 4I7FB 4IDKB 3EZ5A 4QWAA 1RTIA 5K14B 2AX1A 3DYAB 3GV5B 3I0SB 3V72A 8ICMA 8ICJA 3Q8SB 8ICAA 2R8KA 4KKOB 9ICPA 1S9EB 3LP0A 5CYMA 1S76D 1JLBA 1BQMB 3M8QB 5HLFA 4ICLB 4I2PB 4YFKA 5F8GA 5J2FA 2DFLA 3MBYA 4MEYA 1BQNA 1UT8A 3HT3A 1BVSA 4YR0A 1TL3B 3C5GA 4NLWA 2PFNA 2PFOA 1S97A 4Q44A 4H4OB 4QZFA 4Q8EA 4PHAA 1TK5A 1S1WB 5KFEA 3V6DA 3H8JA 4FS1A 5DLGA 1COOA 4F2SA 1RT4B 3IN5A 1TK0A 5HMMA 4F50A 1D9FA 3TARA 3PMNA 4K4SA 1REVA 2DPJA 2YNFA 1K1SA 3FFIB 1S1TB 1Y88A 1TVAA 1DLOA 4ZP8A 1JKHB 1JIHA 4IDKA 3QIPB 4NLZA 5K14A 4O3NA 1IKYA 1A76A 3DYAA 4JK1A 3RBDA 3SZ2A 3I0SA 4F2RA 2HHTA 4RNNA 1S9EA 5BPCA 3RJIA 4DWIA 5J0UA 1BQMA 3M8QA 4ICLA 4I2PA 3RJGA 4TURA 1KTQA 3TFSA 2ZUCA 4IRDA 4GXIA 4LQ9A 4ED2A 1TL3A 4YMMA 3BGRB 4ZVHA 4K50A 1LV5A 2P6UA 4H4OA 4Z6FA 2BCRA 3RB3A 2EC0A 2AU0A 3RJEA 5EDWA 4IQXA 4ECWA 4NLPA 1VRUB 1RT4A 1HNVB 2BRLA 3ZDDA 2ASDA 4G1QB 5IILA 1U48A 5D3GB 4NLUA 3BJYA 1ZQKA 2JC1A 4ZP9A 3OSNA 1IKXB 3FFIA 1S1TA 1D8YA 3OLAA 1JKHA 1IKVB 4Y34A 1EXNA 5T14A 3GILA 2AGOA 4KAIA 3IG1A 2J6TA 4YCXA 4RQ7A 4F93B 2FLPA 4BWMA 4RNMA 4TYBA 4MF2A 1QE1B 4HYKA 2V4QA 2IM3A 4WE1A 1B22A 2ZE2A 2DPIA 3GV8B 2P6RA 1ZQBA 4RUCA 3C5FA 4TUQA 2J6SA 5F8HA 2HWHA 4I28A 7ICMA 1L3VA 1AROP 3D5MA 4J9KA 2NRXA 3BQ1A 4BWJA 2KZZA 3BSCA 4H54A 2UVRA 9ICJA 1HARA 1RT7A 2YNIB 4PGXA 5J2HA 1ZJNA 4NYZA 3Q8KA 3T5JA 2XC9A 1DTTB 4J9LA 5J2MA 3N6NA 1HNVA 4PQUB 1QSYA 4F4XA 3RTVA 5KG4A 3H5SA 3LWMA 1RT5B 1IKXA 1IKVA 4WZQA 2B6AB 2RDJA 3OL7A 1NKBA 4K4HA 3DLEA 3LANA 8ICUA 3ISDA 2FVCA 4NLOA 3UPFA 2OWOA 1QE1A 2UUTA 1U49A 4KE5A 4NCGB 5DGBA 3QIDA 2OPSB 4ZHRA 4PHDA 3ISBA 2JC0A 1NJXA 3LP1B 2KZ3A 4MF8A 9ICNA 9ICRA 3NBPA 2HHUA 2YNIA 2ILYA 1ZQXA 4DF4A 3MEDB 2C28A 3QLHB 2JZBB 4DSEA 1KDHA 3TAPA 3T5HA 1L5UA 4UB1A 2ISOA 1T8EA 2XY5A 1NK6A 1MMLA 4NLXA 4TY8A 3JPOA 4PQUA 5BOLA 4F5RA 4MKAA 3Q8LA 4YD1A 1S1VB 2BKEA 1FK9A 2P66A 4H4MB 3BQ0A 2B6AA 2R8HA 3CJ0A 5F9NA 4JV0A 2KFZA 1TV9A 2NRTA 2ILZA 7ICTA 5D49A 4J9OA 1BPZA 9ICKA 3PZPA 3CJ4A 4B3OA 1N6QB 5IIMA 2FPLA 4IRCA 9ICVA 4ZMMA 5HBMB 4FS2A 4IQTA 3KTQA 4ED7A 1QTMA 1KRPA 2B21A 1HJPA 2NRVA 3TANA 2ZD1B 5KG6A 4ED0A 1NK8A 4QZGA 3AU6A 3QE9Y 3LP1A 5KFRA 1ZQAA 4EO6A 4XQ8A 2MUTB 5IIIA 1MU2B 4IR9A 4R0EA 3DOKB 4B9MA 4ZVFA 1X2IA 1TAQA 3SFUA 4XPCA 3QLHA 1T3NA 1ZTWA 4KHMA 4DQQA 5J2EA 4WFYA 3KLHB 3MEGA 4KLGA 2VG5A 1BPBA 4OL8A 4KLDA 1RTDB 3KHLA 3RR7A 4K4WA 1DTQA 1RXVA 1BPYA 3QEBZ 4RNOA 1HQUA 5J2DA 2VA2A 1S1VA 2W9BB 5KG5A 4I2CA 3RH4A 4DQPA 5D46A 1UA0A 1HYSA 4WFXA 5KT2A 2PXIA 4B9SA 8ICFA 1U4BA 4KHRA 2GWSA 2IBKA 5TZVA 3HPOA 3M9MB 1N6QA 1FKOB 3QO9B 4KLFA 5HBMA 3H2LA 4PWDB 3KMQA 4F4KA 4P4PA 3LALA 3KLEB 7ICFA 1N5YA 5J2JA 1TP7A 2W9MA 4QZHA 3PO5A 2F8EX 1RT6A 2C2DA 4ED6A 1MC8A 2WRMA 1MU2A 4MFCA 1JLAB 3DOKA 1XO1A 3H5XA 4M04A 1H38A 2IJFA 3FDSA 4UQGA 4O3SA 9ICUA 4KLTA 1Z4UA 4WXWA 3UPQA 1RTHB 4DSKA 1FKPB 1S1XB 5C25B 2D3ZA 5J29A 3CJ3A 3KLHA 4EBCA 5I42B 4I2BA 3PX6A 3HVAA 4PUOA 3M8RA 1RTDA 4RPXA 3QYYA 3NGDA 7ICEA 2FJWA 5HNKA 1C0UA 5KT7A 3DLGB 5KFDA 2IHMA 4ELUA 3ISND 4ED1A 4IKAA 4LSNB 3CO9A 5J0XA 4RW6B 3MR3A 3K4GA 4M2YA 1QSSA 4B9NA 3DRRB 4RU9A 1TV6B 3H40A 2W7PA 3PVXA 3HVWA 4I2FA 5DKWA 3V4IA 1SL0A 5KFTA 2C2EA 1UT5A 4TUPA 3FQKA 4TUSA 5C24A 3KLEA 3QZ7A 5DQHA 1IKWA 2E9TA 2OPQB 5HHHA 4TYAA 3DOLB 1S6QB 4MH8A 5J0QA 1LW0B 9ICQA 4UAYA 3KLVA 1JLAA 4RQ0A 9ICBA 4MIAA 3C6UB 9ICXA 4U7CA 1T05A 4ZP6A 3KOAA 1RYRA 1ZQRA 1XR6A 4QZ9A 5KFWA 1FKPA 1S1XA 4IH7A 5C25A 1HQEA 5J2PB 5I42A 4MIBA 4P4MA 2C2RA 4O44A 4EO8A 3ZDCA 1C0TB 1ZQYA 3JPQA 7ICQA 3DLGA 1DOQA 1TKTB 1D9DA 1N56A 3PX4A 2BCSA 5KFJA 3V7JA 1JXLA 4LSNA 5DG7A 5L1LA 5KG0A 2IM0A 4RW6A 4J9RA 4DOAA 4PGYA 4ZPAA 1TV6A 2HHSA 1HNIB 4I2GA 2KFNA 2WONB 5FDLA 1XWLA 8ICSA 4KSEB 3OSPA 1YVFA 3PJXA 2ZTCA 1TVRA 1UWBA 3VQSA 3IHQB 1TAUA 3N4MB 4Z6DA 2OPQA 2VG7B 3DOLA 4MK9A 2BPGA 1S6QA 4ED8A 4J9PA 4M9GA 1IM4A 5J2BA 4B9TA 2QE5A 4M9JA 3CJ5A 1TL1B 4ECZA 1ZQMA 3BSOA 3C6UA 1D0EA 4F92B 4M94A 1X9MA 8ICBA 1XSPA 4E0DA 3UQSA 2HHWA 3MEEB 2BQUA 1WCNA 2FVPA 3V81B 9ICLA 1ZQPA 3E2EA 1EETB 3H8WA 2AQ0A 5EOZA 3MTKA 4KV8A 1SH0A 3DI6B 1C0TA 1LWFA 1S6PB 3NL0A 1HPZA 2O5DA 1SKWA 3TI0A 2XI3A 1TKTA 2JLEA 4O4GB 1QUVA 4EZ6A 3MGIA 5J0RA 2CKWA 3RJHA 2UVUA 2XGQA 5L1KA 2AJQA 2HMIB 2ATLA 5DG9A 2WONA 3NAIA 4NRTA 4I2AA 4I7FA 8ICZA 4GXJA 3I5CA 2I1RA 9ICAA 2BPCA 3DLKB 2AGQA 1ZQHA 4KKOA 3PV8A 2M9NA 4PPXA 4MK7A 5DB6A 1TL1A 1U9LA 1MQ2A 2W8KA 1S77D 1SUQB 4DL2A 4RW8B 2RKIB 3MEEA 1RPLA 2YNHB 4O0IA 3QGGA 4O9MA 4KLMA 1GX5A 4YMNA 1EETA 3SV3A 4RQ1A 3QEAZ 3H98A 4UB2A 3DI6A 3OJUA 4F8RA 4M9HA 4DS5A 2RF2B 3BQ2A 1S1WA 1ZJMA 4NLYA 4XPEA 5CA7A 1NOMA 8ICLA 1C1CB 3KLGB 3UXPA 1NKCA 4YD2A 2AWZA 3TAMB 9ICTA 3T1AA 1S9GB 3OHBA 2HMIA 3V6JA 1XSLA 3QIPA 3NKYA 4IG3B 4DO9A 4O4RA 2R2TA 3KK1B 4ED3A 5L9XA 2FVQA 3KK2B 3DLKA 5EWEA 3I0RB 3DDKA 1K1QA 4QZ8A 4ECUA 3HVTB 2FJXA 4QZAA 3PW4A 3EYZA 5CYQB 5F9LA 1XU4A 3C1YA 1SUQA 4MK8A 4F5QA 3BDPA 4RW8A 4KFBB 3CDUA 5L1JA 2RKIA 4YVZA 2YNHA 5J1EB 5CR0A 2XO7A 1KFDA 3H5YA 2FMPA 3BGRA 3TVKA 4YG2A 4IG0B 3KHRA 4Y2AA 3RH5A 4K4YA 5KFBA 1NK0A 4URGA 2RF2A 3GIKA 3JYTB 1KFSA 4RQ4A 4Q43A 7ICHA 1NHVA 3ORYA 5J2GA 4K4IA 3V7LA 3TAQA 3KLGA 1C1CA 2BGWA 4BGDA 1VRUA 4Z6EA 3KK3B 4G1QA 2IAJB 3TAMA 5IINA 5D3GA 5DB9A 4ZP7A 4TXSA 2R2UA 2HNYB 4MFBB 3E01B 4XUSA 4YXMA 4I29A 3PJWA 4Y3CA 5EWFA 3NTUA 4YXJA 4IG3A 5KFMA 2YKNB 3RAXA 4M9LA 2V9WA 1RT1B 3NAHA 4F4ZA 2IMWP 3FYHA 4RPYA 1T94A 5KFFA 5IIJA 4QZDA 3GIMA 1SZPA 2FPKA 4Q45A 3I5BA 3I0RA 4ECXA 1ZQUA 4DSJA 5HHIA 4ZVEA 1Z3EB 4O5KA 2LYHA 1ZQTA 5CYQA 1T03B 3RR8A 7ICSA 7ICPA 5KG7A 1XS9D 1WNEA 3ZDBA 3Q8MA 8ICEA 5F8IA 5J1EA 2VA3A 3PW2A 4MKBA 3GIIA 1JLCB 4IG0A 1NNDA 1J5OB 3ISCA 1V9PA 3RAQA 4QZBA 1LWCB 3JYTA 4K4TA 2GC8A 2V4RA 2XCPA 4LZGA 3EPGA 9ICFA 7ICRA 4RW9B 1DTTA 4I2QB 4KLIA 3Q8RB 4Z6CA 2W9CB 4Q8FA 2HHVA 4MFBA 3E01A 2C22A 3LP2B 1RT5A 7ICKA 9ICOA 4YR3A 2ZUDA 2YKNA 2ZJAA 4MFAA 1RT1A 2ZTDA 1NK9A 1TKXB 2GIQA 1N4LA 3KLFB 1TKZB 5KFUA 1JLFB 5DDMA 5KT4A 1JLQB 1TK8A 5JUMA 4EEYA 3M8PB 1S1UB 4O3QA 5J0PA 4NCGA 2MAXA 2OPSA 8ICRA 3C2KA 4ZVGA 4DSIA 3FSIA 2A1JB 5EWGA 4ECTA 4RW7B 3KMSA 2WB4A 3C2MA 5KT3A 1ZQJA 3GFKB 3RJJA 2HW3A 1JLCA 1J5OA 2ZTEA 4GC7A 4NM2A 5J2IA 2JEJA 4UAZA 2Y1IA 8ICIA 4KLUA 2HVIA 3MEDA 2ALZA 2FJVA 8ICPA 2JZBA 3JPTA 4DEZA 3CVKA 3LAMA 5IIKA 1T4GA 3T5LA 2WTFA 3G6VA 3GIJA 2BCQA 2W9CA 2FLLA 1NJWA 3LP2A 2I1QA 3UR0A 4MEXA 4KLSA 2E9RX 3V6HA 1S0NA 4H4MA 3KLIB 1TKXA 3OLBA 5KTQA 3RH6A 5HP1B 3KLFA 1TKZA 2HHQA 3IGVA 5DQGA 4O3RA 5KFSA 3TQ1A 1JLQA 3QZ8A 4DLGA 5J2QB 4CCHA 4LZDA 3M8PA 4DFMA 4KLLA 1BPXA 7ICOA 2HWIA 4KLJA 3MR2A 2E9ZA 2ZD1A 4J9NA 2ISPA 4TN2A 1L3UA 1C1BB 1TFRA 4RW7A 3QGIA 3FRZA 5F8JA 2PI4A 4QZCA 2MUTA 2OPRB 4J9QA 1BGXT 2IM2A 4F91B 1KLMB 2FPMA 2RDIA 3NMAA 4JWMA 1NK5A 4ECRA 1ZQNA 3SI8A 4XA5A 1L3TA 3UQ2A 3C2LA 4FO6A 4IRKA 3BREA 1CEZA 4YR2A 4DFPA 4RW4B 1U47A 2HHXA 8ICVA 2W9BA 5D4BA 3G6XA 1TQLA 1GX6A 3EPIA 1A77A 3M8SA 3KLIA 1N48A 5HP1A 3DM2B 1TKDA 5F8LA 9ICCA 4DFJA 1XR7A 2FMQA 1JXEA 4DQSA 7ICNA 2FVRA 1KSPA 2YKMB 4LVSA 2GIRA 5J2QA 1FKOA
chains in the Genus database with same CATH superfamily
4K2XA 4C4WA 3H4BA 2YX7A 1OQ3A 1T11A 3OVAA 2ZIXB 3ZZ0A 3OL9A 2MLYA 5IZHA 3R3TA 3ISNC 1XMQF 2XI9A 4JI4F 3PW5A 5G0RB 3CPWR 3WDOA 4CO2A 5KG2A 2W11A 5AI8A 2BE2B 4X4OA 2CPYA 3MMBB 3I55S 4EZ9A 3KJNB 2WCXA 4TLRA 2EFQA 1H73A 2XLJA 4EBDA 1S7IA 1G2EA 1WACA 4P0PA 2KG0A 3PRVA 2ZJ5A 2GVZB 5KAIU 4RW4A 3D2NA 4PG7A 5KG3A 4QYZJ 4RQ6A 3TRGA 2VG6B 4RUAA 4RBUA 5KFAA 1QSLA 3OTBA 3CDEA 3FBCA 8ICNA 1RAJA 4QW9A 1RA5A 4YMOA 7ICLA 3MAAB 2DNRA 5F3XB 2OEMA 3G4SS 4DL6A 4PR6A 1WC3A 1S0OA 2CDQA 3M6KA 4GO7X 4CLZA 1ZQQA 3C6TA 1LW0A 4C4RA 3BZQA 4DV2J 1V3RA 1UEUA 2JLFA 1T3QA 1TL4A 1V5VA 2XYHB 9ICGA 4DCOB 4DR3J 1U1KA 5DBBA 4C8KA 5J2PA 3HMJG 5DDYA 3MCSA 1X4CA 4BJQA 1S57A 1RWNB 1WF2A 1CQNA 3BYRA 4FNIA 1RK8A 4KGMA 4OJ5A 4F5NA 4HEA9 5J2KA 1ZTTA 5CJ7A 1MWYA 1IXRA 2RSQA 3IWXA 2MZQA 5JXSA 1POJA 2NXNA 2HQDA 1CUKA 2I9GA 2XEXA 3MM7B 2J9EA 1JLGB 2JEFA 2P50A 4URQU 4KY3A 4FPIA 3OXFA 1SIZA 3AA9A 8ICKA 4DSLA 3GJRB 1KRAC 5ALGA 1OW5A 4DFKA 5J2AA 4KTQA 1YRTA 2JXJA 5BOMA 2XGPA 2IC3A 2GQCA 4X65F 2VG7A 1NK7A 1T9WA 5J2NA 4M5NA 3K8VA 3H4DA 4GMKA 4NWBA 2GAGC 9ATCB 4NZ0A 4MMOA 3O0FA 2L41A 4KN7A 4ANDA 2MDAA 2D3DA 3RB0A 2LKYA 1GMWD 1GO3F 4U7UD 5AE2A 3ZZRA 2Y0BB 3OFEA 2ZIVB 3TEGA 3R9LA 1ZAWA 4LR9A 1S6PA 2R8IA 4DL5A 3SXLA 3TVZA 2J76E 2MY7A 1ONWA 2WOMA 2FJ6A 4M47A 2KT3A 4USMA 2DL0A 3TFRA 2HVZA 3E0LA 4J91A 3IO1A 3M05A 2CPHA 2E5JA 4CEUC 1RE1B 1FRIA 3AL0B 2EZXA 1EJWC 2B4VA 2FJAB 1FWFC 2M88A 2VC1A 3IWLA 5J0TA 4QOTA 2H5IB 4R66A 5T7LB 1LW2B 3MFIA 4WJBA 2W3SA 4XO0A 3WK7A 1QLNA 3ZZTA 1K70A 4Q0BA 2G3FA 2WVEA 1VRTA 4NLGA 4KBIA 5ITHA 3SQGB 2IYIA 4E98A 4JV2A 5HJXA 4G7EA 3BSAA 3PR5B 2GGPB 3MR7A 2BJDA 4DV1F 3VGTA 2FB0A 4G65A 1FWGC 4ZCKA 1X60A 4LF4F 3OVBA 3DRPB 2E1EA 1U45A 2R9LA 4YHHF 1SVDA 4RZRA 1HUZA 1EKSA 1RJPA 4KRWA 3D2QA 3EZUA 3OQ2A 1T02A 2IVFB 2NYHA 2B5JA 1RLDA 5KOXA 2X3GA 2GX8A 1NPPA 3HSZA 1UPPA 4J9SA 3LK9A 2RUGA 4M5HA 1N36J 5ALYA 1FNXH 4NZ7A 5DLFA 4AYBD 3UE2A 2F3NA 1GKQA 3DRSA 1FK9B 4OHZA 2FMSA 2FIUA 3LWLA 2W24A 4KITB 2XMAA 1EJVC 2ZC3A 2KN7A 2QL7B 3AOAA 3WZ0A 3D0HE 4DUTA 1M1GA 8ICQA 4QPXA 1FRMA 3AB4B 1IJFB 1C2PA 4DFDA 3CCRS 1YZ6A 4IS7A 1R8CA 1L3SA 5DDOC 5IXUA 2OUGA 2WFAA 2IMOA 3L3FX 2VFRA 3C14A 1CBKA 2HNYA 3IBFB 3M2RA 3VAMA 1EZZB 4RU2A 2JRZA 2AEFA 4DL3A 4CLKA 1RHUB 4EBEA 1JLEB 3NOGA 1NDCA 2KDOA 1V85A 2AGPA 4USIA 4OX9J 1NZ8A 5CP2A 1AZSB 1MWQA 3CMES 3DMJA 2XS2A 3NMRA 3H7IA 3IS9B 4PPDA 5A0YB 1Z00A 5AKQA 3AH6A 2UXBJ 1HYSB 1SPBP 2GAHC 4LUBA 2N4DA 4M5LA 4EFAC 3QWUA 4ZVRB 2KG5A 3W65A 1AFJA 2P2CB 3X1LB 2DF4B 3H0PA 2X1AA 2HNDB 1E6VB 1U7LA 1LWCA 3A13A 5CZXA 1FRHA 4Z37A 3MGJA 3MUMP 3W9IA 4I0WA 2CUYA 3LSBA 1RA7A 2ACMA 4YIWA 1Q8IA 3MD1A 3F2CA 4WYLA 3LVVA 3A8IA 2W2PP 3D1HA 3MMCA 1L7MA 5AE1A 3IRXA 4IFVA 5LMNF 4X4PA 1RWXB 4R85A 2FQQB 5KFXA 4KX3A 1CULB 2CPRA 4AL5A 3PXGa 2XVTA 1PAEX 4OIXA 4ELTA 1YKWA 1S79A 2KYXA 3TACB 4C7YA 1RT2B 2O3DA 3KJVA 3EW9A 2DNKA 3G96A 1RTJB 2KV2A 4EEKA 2BQ3A 1S4FA 2DGWA 2GJIA 3ETOA 4QIWF 1BNOA 4CLUA 3OR2B 5CHGA 4QIEA 4IFYA 3FZBA 2ROGA 3B8HA 5C24B 8ICCA 2Q3PA 1VBZA 3HDSA 3ZDEA 1ZQ1C 4K7QA 2G2OA 4ID5B 1Y11A 4ZPVR 1BPDA 1RDRA 3VZIA 2DB1A 4BDPA 3CCWA 1V97A 1VBXA 1NPKA 3RJKA 3OHAA 4O3PA 4C7QA 1Y5LB 4P2HA 1NMEB 3I6PA 2ZHAA 3HHDA 2XY6A 3TX0A 4ZK7M 3PRDA 3FQLA 2KTQA 4DR5J 2H5XA 1H2VZ 3SFGA 2JHDA 3H59A 3K5LA 2VBWA 3K1RB 2XMVA 4AC7C 5B0CA 1QAIA 3BO4A 2XZDB 1F9FA 1EJ7L 3Q2TC 1PO6A 2D3O1 1VFJA 4EI2A 1B4SA 1ONXA 4O23A 2OPRA 5C5JA 3JSMA 4PG4A 1BE4A 3MECA 3BPDA 2IJNA 3SDEB 4KMUA 5AXLA 2BCVA 4CNQA 2QC3A 3C28A 3NVYA 2BHNA 4DF8A 3FSXA 2C3OA 3LP0B 1WOOA 4K4ZA 1MSWD 2E5GA 3EM1A 1XNRJ 2ASLA 4OJLA 1SC6A 1BQNB 1YZ7A 4EYIB 4FYDA 2D6FC 2WK4A 4JV5J 2XLIA 2HBYB 1KLNA 4KO0A 2XNQA 4K4VA 1HPZB 3IC1A 3V6DB 5DETA 5IV4A 3QT5A 1K5OA 5EX3A 2FVSA 3GZ7A 3ZD8A 3WK5A 3ADAC 1Q3UA 1EJUC 3E74A 4M51A 2JH3A 2PMWA 2D41A 1AA1B 5G0RA 4HTIA 1DLOB 3WKCA 2XZTB 4PXCA 4I1TA 2F9JA 2NPIA 1RTIA 2AF6A 1A5NC 2IYGA 3V72A 1UFLA 3I96A 2HI0A 3HKZC 1SI9A 4RBTA 2ZOGA 1S9EB 5JU5A 1S76D 1JMTA 5AIBA 4QIFA 4YFKA 5J2FA 2ZH9A 1UT8A 1BVSA 2B56A 4YR0A 4BJHA 3QSIA 1P7DA 3WKAA 2PFOA 3VAIA 3N7SC 4QZFA 4PHAA 3HD2A 2DHHA 3MAAA 2M4MA 4UOFA 2GOLA 1RKJA 3M2UA 1RT4B 1Y3JA 2KM8C 2AQOA 1V38A 3IN5A 1TK0A 2Z2ZA 2K4IA 1D9FA 1WSRA 1REVA 2DPJA 1YITS 4N8OA 2WZ1A 4OZ1A 4ZP8A 1WKKA 2R7WA 1FJGJ 4O3NA 2HS4A 4ED4A 5D8HB 3DYAA 4JK1A 3RBDA 2BJ9A 5G4DA 1OYEA 2G1HA 2HHTA 4OHWA 2IBOA 3MKVA 2HSZA 2MSTA 3L95X 4USHA 4RNNA 3M1VB 3VAFA 4DX6A 4DWIA 5DDRC 2HK3A 3M8QA 4WKRA 1WEYA 4QIVA 2AJ2A 4D3HA 4TURA 2B8PA 3HULA 1KTQA 3TFSA 2ZUCA 4IRDA 2KVIA 4C6AA 4ALZA 4CLWA 4ZVHA 1UQVA 1RYUA 1SJQA 3CCLS 2BCRA 4MYTA 4JI8F 3CDAA 4LIRA 3SEOA 1NB7A 1EJXC 2D9PA 4JI5J 3OSNA 3FFIA 1RWMB 2DD8S 2Z30B 1IKVB 2CJBA 2J7WA 2W4DA 1IV8A 1VLBA 1HWJA 4RQ7A 4F93B 3IAS9 2FLPA 1DGJA 5K9FA 3SMVA 1H74A 2P9CA 3WK6A 1IQZA 1ZD4A 3QATA 1CQMA 2HQCA 2ZIVA 1JJHA 5IT9Y 3C5FA 2J6SA 3NY0A 5F8HA 4CQ1A 1Q8KA 4C7ZA 2ZEJA 1S5LU 1ZA2B 4P10A 4H54A 4J03A 1VQNS 2G2ZA 1ACMB 2CG8A 2DBBA 1F9EB 2QLFB 2PMHA 1F2HA 2HHHF 4JI6F 4NYZA 3Q8KA 4W4MA 2Q4TA 3MDUA 4J9LA 5AKXA 4HT7A 2VHLA 5T7LA 3WHIA 1QSYA 3RTVA 4F71A 4ATNA 3F5AA 2OODA 1S72S 1IKXA 4F04B 3MTWA 3K1ZA 2XIDA 4K4HA 3GG0A 1ZM3A 2ZFHA 2ALYB 1VISA 2N3LA 1QE1A 2MKSA 1U49A 4Y2JA 2LA4A 2QJ3A 2V8VA 2YMLA 4I64A 1YJNS 4C60A 3RW7A 4PHDA 3LP1B 1PK3A 2KZ3A 4RX6A 1HWIA 9ICNA 2AH5A 2HHUA 2ILYA 2ABYA 2BACA 3EGVA 4MKVA 1KRCC 3QLHB 3CC2S 3FBEA 2DISA 3PIPQ 4FYWB 3PEJA 1Q16B 4NA1A 2MKIA 2A2CA 5D4OA 1M1KT 4PQUA 5AK6A 3H42A 4F5RA 4MKAA 4OYOA 3UN5A 2IA0A 5CA5A 3MPDA 2YN4A 2MQ8A 4YD1A 3RAMA 2EANA 3WX4A 2BKEA 2LU2A 3SSSA 4ZJQA 1FK9A 2P66A 2FJBB 2B6AA 5F9NA 1UP1A 3W2WB 2CQDA 3SAHA 2DXEA 2ILZA 7ICTA 1XBWA 3KKFA 4CO0A 3HSDA 5D49A 3Q89A 4IRCA 1SV0C 4ZMMA 4IQTA 5K5MA 3KTQA 1QTMA 2H3ZA 2HZAA 4J37A 1SB6A 2P35A 2UP1A 4ED0A 3DRYA 3GIRA 5E3RA 2HLTA 1WF1A 1DQAA 1GKPA 4LMZA 1MU2B 3MAQA 1A9NB 1R43A 2ZIWB 1M7JA 4ZVFA 2R3VA 3BGFA 3V5RA 3HJVA 1V4YA 1BMQB 3KLHB 1ZM2A 3U1NA 3KHLA 3RR7A 1G3OA 2VODA 2KHVA 5AKKA 2WB1D 1AZSA 3BZKA 2CPXA 4RNOA 5J2DA 2VA2A 2W9BB 4I2CA 1EX8A 5D46A 4YFUA 2IRXA 1UA0A 1U6FA 2ZZTA 1A0PA 5JTIA 1HYSA 3JSBA 2B0CA 2W2OP 5J1NA 5KT2A 1NI3A 3QUTA 4KHRA 3HPOA 3M9MB 5ALNA 5F0UA 1E6VA 1NXIA 3KMQA 4P4PA 3IRUA 3LALA 5J2JA 2W9MA 3PO5A 4C8YA 2F8EX 5AXKA 1TFYA 2N1RA 3QPIA 2C2DA 4ED6A 2QARB 4DPUA 4MFCA 3DOKA 1XO1A 1A6SA 4ERDA 1DJ0A 4KLTA 4WXWA 5LMUJ 4CLYA 1P1TA 1FKPB 4WIQA 1S1XB 2Y1RI 1QAXA 2QL5B 1ZM9A 4EBCA 1O8BA 2AP6A 1WTFA 2CPEA 5FIIA 3PX6A 3HVAA 2DEJA 3PDNA 4BUGA 2FY8A 2E8PA 1CULA 2IY5B 2IHMA 1KNZA 3U27A 4IKAA 2KK0A 1NSKL 5J0XA 4UOCA 2X51A 3VZHA 4DV5J 5CAAA 3K4GA 2P8IA 3N4WA 3B9JA 4P0QB 5KOWA 5B0EA 3HVWA 4I2FA 5DKWA 1HR0F 1CLFA 3OR2A 5D4LA 5K8PA 1FESA 2DJWA 4TUSA 5C24A 2HDOA 5C2CA 4P7VA 5HHHA 2G08A 4D3GA 4C4TA 2CJ9A 1NU4A 1HKAA 2DIUA 2F8HA 4U67Q 3KFUF 2DNZA 1JLAA 1H7WA 9ICBA 2QFIA 2O1PA 1NRKA 4MIAA 1EARA 3CCES 2ZM6J 1V6HA 2PC6A 5IT0A 3OPKA 2XMTA 2BDUA 5C25A 2E8MA 4DR3F 5I42A 4MIBA 1IR0A 5LL6d 2K4PA 2QFJA 2DNMA 1XNSA 3ZDCA 1SJRA 5ALXA 3DDIA 1CJKB 1DOQA 3WQPA 2BCSA 3PFEA 3V7JA 2HIQA 4UZBA 2LLZA 3U1MA 4KH0B 4OI1A 1H7XA 1TV6A 4OJPA 2P9EA 5IWAJ 1HNIB 4I2GA 1XMBA 4CM0A 1XWLA 3A3PB 8ICSA 4B3RF 1WKJA 3ILJA 2HQFA 1YVFA 1XRTA 4XDCA 3SCLE 5SZTA 4HHHA 3PJXA 2ZTCA 4CF5A 3JS9A 5M2UA 3ENAA 3CMAS 2ZHBA 4LVOP 3IHQB 3NRBA 3N4MB 4Z6DA 3PSPA 5A8RA 4MK9A 4ED8A 1AT1B 4M9GA 2QE5A 4YB7A 1TL1B 3D3BJ 3C6UA 4M94A 2EFOA 2QGFB 4E0DA 1N5WA 3PTWA 2BQUA 4FZNA 1AFIA 1U6ZA 2FVPA 9ICLA 3D0IE 1BXNA 1EETB 4NXMF 2H3EB 1C0TA 5BR8J 4P2XA 1HPZA 2O5DA 3T8LA 4FYVB 3TI0A 3NP5A 1TKTA 2JLEA 1KBRA 2UXCF 4O4GB 1KR4A 4JI3J 1JRPA 3NNCA 5GADU 4J90A 1UEVA 2V5HG 3EVMA 1VIXA 2AJQA 2E7WA 2EVZA 4C5ZA 2HMIB 1FWIC 2WONA 1GK8A 2R7SA 2HBQB 8ICZA 3DV9A 3BH7B 3MPVA 4EELA 1PVRA 4GXJA 3I5CA 3TR5A 2M0NA 2GVDB 3DDNA 1X0FA 5LJ5Y 2LM1A 3NASA 2DO0A 3P49B 2HS0A 1U9LA 3OV7A 3FCHA 1S77D 2JH7A 5AKYA 3CNQP 2DHSA 1OSCA 2RKIB 3PHTA 5K8NA 3HM9A 2YNHB 2WSCC 3LO3A 4UAUA 4O9MA 2QYCA 4AL7A 1VYAA 2F44A 3H98A 4UB2A 2VF3A 4ES3A 4M9HA 4CEXC 1ZJMA 4NLYA 3H25A 1ZZNA 2HFUA 1GEHA 3KLGB 1C1CB 4CGZA 1FDBA 1NKCA 5DS7A 3ILLA 1VK3A 5AI0A 2LCWA 1AUDA 2EKNA 3TAMB 4DU8A 3A12A 5GMEA 4ZJLA 5U47A 3T1AA 3M30B 4DHVA 3SQIA 2JR5A 3AHPA 3LQVA 4J5OA 3OHBA 1Q5YA 2Z56B 2YB4A 1HW8A 2YY6A 1R8AA 4ACOA 1XERA 3KK1B 3FK4A 5EWEA 1R6VA 2J9DA 2FJXA 1KQFB 1FTCA 2EC2A 3H2UB 3QU4A 2LXUA 4MK8A 4KFBB 5H1SV 5CR0A 3TVKA 2UZ9A 3S7RA 2DTJA 4V19X 3P3DA 4Y2RA 4K4YA 1DHMA 2NZ4A 2X1FA 2CWKA 4M5KA 5E3AA 2VQFF 2DHGA 3R6GB 4Q43A 7ICHA 1NHVA 3ILIA 4WK3A 5J2GA 4CO3A 3L7OA 4AXJA 3BN4A 4OX8A 4CYUB 1T9UA 4Z6EA 2ZNZA 5DRKA 2VHGA 1AYEA 5GTHU 4ZP7A 4TXSA 2R2UA 2H3IA 2KSOB 3D66A 4PJ0U 3EUNA 3GZFA 5EWFA 1YBQB 4IG3A 2IMWP 1RDFA 3FYHA 4I56A 4Q45A 2ZBRA 4ZLPA 1ZQUA 4P52A 1KBUA 2ZC4A 3QGPA 4O5KA 1X66A 4OLOA 3Q2SC 2G0JA 7ICPA 3HRDD 3MM9B 4F0KA 2ZBPA 4FVMA 5B7WA 2SXLA 2PUZA 2VA3A 4USJC 4ILMA 3I32A 5B0AA 1ZZFA 1J5OB 1URRA 2LQ5A 1IUJA 3VAKA 3JYTA 3T1HJ 1WC0A 2XCPA 1RU1A 1A5MC 1LWXA 4I2QB 4KLIA 1FD8A 3RZAA 2GMLA 4Z6CA 2GA7A 3N2CA 5A8WB 1PG5B 2YPYA 9ICOA 2W25A 5GAEI 1KD1T 2QB0B 1PBAA 2YKNA 2VC0A 1NK9A 5JJBA 1N4LA 4HACB 3TUIC 1JLFB 5DDMA 5KT4A 2HVDA 4DR1J 2Z57B 1BC6A 2CVIA 4AXIA 5JUMA 1S1UB 5J0PA 5HMFA 4IQMA 3UI3A 1XEZA 2OOFA 4IO1A 2PGCA 5JVHQ 2WW8A 3C2KA 3FSIA 4DSIA 5SUHA 4PG5A 3KMSA 3C2MA 1ZQJA 3GFKB 3J81U 3DOMB 4N5SA 2HW3A 3KZXA 1JLCA 2FE9A 4GC7A 3IMQJ 1WWVA 3DXBA 2YTUA 2NUHA 5L38A 5AM1A 2FHMA 4NOHA 3QWPA 2LQ9A 3MPWA 3QFHA 3HVRA 1EAYC 2CADA 4DV4J 3D3CJ 2XG8A 1HNZJ 4RR5A 5ETNA 4C11B 3PSFA 3V6HA 4DUYJ 4UT4A 1TKXA 3I56S 3KLFA 5L8RC 3C2PA 4K0KF 1FWEC 3TQ1A 3RBXA 1S99A 1F3VA 1VJ5A 4OI6A 4DFMA 3KKAC 4KLLA 3FUYA 5GAGU 3TA0A 2HWIA 5E41A 4FF3A 2ISPA 4TN2A 1C1BB 4YN3B 2GO7A 1N2XA 3DDHA 4OX7A 2LYBA 4RW7A 5CCLA 1DZ5A 2MZ1A 3BGUA 3OXLA 2X7IA 4J9QA 2ZIWA 4LF5F 2KKHA 4JB8B 4KR0B 4CQBA 1KLMB 4OYZA 1RAOA 4C9DA 2AHOB 1ZQNA 3SI8A 3VF0B 1L3TA 2CXEA 1GTHA 2LBOA 4YR2A 2EAMA 4YUDA 2HHXA 1XNRF 2NPFA 2W9BA 3WKEA 1A77A 2V9KA 3M8SA 2W54A 2DK2A 3OFHA 4F4AA 3DM2B 2K8CB 1N52B 3CMQA 1XR7A 2L9NA 2FMQA 1SJ1A 1SQGA 2E8OA 2FPHX 2VPWB 2FVRA 1KSPA 2MRLA 5IC4B 3G71S 3NNAA 1RB0A 1WHYA 2GIRA 5AM2A 5J2QA 3NNHA 3AD9C 4DLEA 1HIWA 3T5KA 4O3OA 2ZH8A 3W2VA 1LB2B 1ITPA 2ZIUA 3RGIA 5F8NA 4C8ZA 2FLNA 3GIQA 4EYHB 4BS2A 2EAPA 3CD6S 4RNFA 4R5PB 3THTA 1U02A 2QARA 4DR7F 3M8ZA 1OJ4A 1XK8A 1ULRA 2OYYA 4N76A 4LF6F 1SIWB 4LF9F 1PVQA 4J9VA 2A1AA 3FMWA 5CWRA 5CYMB 1JLBB 1RT3B 5IT9U 1T7PA 1PYTA 1SC1B 1F44A 3R97A 2OH2A 1I6JA 1NKEA 3C3LA 3SIPB 4TQSA 1ZETA 3RRHA 3E51A 4P0QA 2EPIA 2EBEA 1S0VA 3D28A 4QR2A 4OJ3A 2G1DA 4C98A 3MHYA 2HZVA 5KFIA 4U9RA 5HROB 2CN1A 3JPNA 4N41A 1IG6A 5HP4A 2D74B 2W7AA 2IHNA 4B02A 4NLVA 2EFNA 4USKA 1VQKS 3UMCA 1EP4A 2OIHA 4QYZK 4JI2J 7ICVA 1K6WA 1AQ6A 3AQPA 1PJ6A 3ITHA 2Y1JA 4IL6U 2YQ0A 5IOLA 3IR6B 3MDAA 3ICLA 4NLQA 3HWTA 2ZJPQ 3PW7A 5KFLA 4M9NA 3CCJS 3QX7A 1FI4A 4LF7J 2F1HA 3TJ9A 3FNNA 2DR9A 2OD4A 1Q3VA 3S01A 4FF4A 2GIFA 4I2JA 2UUBJ 4EK2A 3CJQA 4NI2B 1RYSA 3CEDA 1HNIA 3AU2A 1HFEL 4UB3A 2B6GA 3PYEA 2D7SA 4A8OA 4Y2PA 2CJQA 2BKOA 4K4XA 1X8DA 9ICHA 1NUEA 4X5VA 1HWLA 2EK6A 1RQ0A 3HW8A 4KLHA 3VV2B 4X4UA 1TTHB 3Q0AA 3Q24A 5B0FA 2MZTA 2HRUA 3M6ZA 2CDRB 1J6PA 4YB1P 1VDVA 3MWBA 1LXNA 3K5PA 1DRGA 2P9BA 1RAGB 1XR5A 4WE1B 3VALA 3CWJA 4OD0A 4GVLA 2G06A 2QN6B 2KXHA 5E7OB 3HZGA 1QY7A 3FEXB 3V6KA 2V34A 1N54B 2UVVA 2Y0SD 4F4WA 4O4GA 2DKXA 4L72B 1FJEB 2P6SA 4A8YA 1CRXA 2CAJA 4P75A 1RM6C 4DQIA 2RU9A 1VQPS 2AIRB 4C3MA 7ICGA 5IQ6A 3OUYA 1LKYB 5AT1B 4C0HA 3GFZA 4CF4A 1RQNA 4TQRA 4KN4A 2FJDB 4I2EA 2AQ4A 1CJUB 1S48A 2VJVA 2GVDA 2ACYA 2RNEA 3CB4A 1MWZA 1M5HA 2GCFA 4QWEA 1OY6A 4PH5A 2AZ1A 4ENOA 3MPGA 2F8LA 2XMUA 1J5EJ 4CDIA 4AQYJ 3BR9A 1RADB 3RB4A 4RQ3A 2WVDA 2NV3A 3CIZA 2NZCA 4LRBA 2KN4A 3DLEB 3LAKA 3PY8A 3BE7A 3J81j 4LSZB 4ZOSA 5AJ3J 2H54B 4L9XA 3MMJA 2HG4A 2JEIA 2K8AA 4Y2UA 2AYGA 1E6YB 3OTQA 5KFYA 3N97B 2IDLA 3VR1A 1Z2ZA 2W4CA 3NBPB 4IC9A 3B0XA 3D67A 2Q43A 2G5HB 4RPZA 1X9SA 4ILLA 4CM2A 3KK1A 5T41A 4C80A 3QXGA 2D3OR 1TFWA 4M6WA 5DGAA 1X9WA 4X4RA 3JQKA 3LTOA 3WBZA 2V67A 3MR6A 2WHOA 1UA1A 3B0YA 4CQCA 2W4PA 1FT8A 2MPUA 1SV5B 4I27A 2X1GA 3G82A 7ICUA 4RQ5A 3G6YA 4BXOA 4UY8T 1L8OA 5KG1A 4JI1J 4KFBA 2PAJA 2KJ5A 3NGUA 5HMLA 1PIEA 5B09A 1HD1A 1LWEB 1FVQA 2Z2YB 2Y9TA 4OJHA 4B3OB 4UTGA 1XQIA 5D0HA 4JV1A 3DGPB 2XHWA 4ITSA 1S10A 1DBDA 4LFCJ 2B8QA 1HNXJ 3QAEA 1SH3A 3J7YU 4CYUA 2V69A 2R8JA 2WVFA 3M32B 2XYGB 2ZJ8A 4RPFA 2XY7A 3QT8A 2CVEA 2W7OA 2KSOA 1ZBTA 3IM1A 2OI2A 1FHTA 1ZRMA 9ICEA 1HHQA 1SH2A 3AJ2A 1RUSA 3D7SB 3IXQA 4FXWA 3TNVA 2VG5B 4UBCA 2WW4A 1SWVA 4IQUA 1DTQB 3PJ9A 4IOAQ 1O03A 2B43A 1HQUB 5I3UB 4FBTA 2YNGA 2DWQA 3MM9A 8ICTA 1QAYA 1QJHA 4IOBA 2F1IA 4DL4A 2R7QA 3GLJA 4P71A 3T81A 4MYUA 2I5JB 2GNKA 3GONA 2QMWA 5E5NA 1YBAA 1JN3A 2VDIA 4NM1A 5D77A 4I2QA 1N61A 1N63A 2X1BA 2CNLB 3GFYA 4WKYA 1WEXA 5A8WA 5C42B 3UXOA 1K8AT 1QVGR 4P2SA 2QB0A 5LMUF 4CT9A 9ICWA 2C42A 4DV0J 4UAWA 2W9AA 3MDFA 2CZ4A 2PKEA 1JLFA 1R0AB 2NRZA 2HVHA 5A8KB 3LF0A 2FDNA 4I2HA 2XO6A 1WG8A 5KFOA 2HBMA 1S1UA 3R5AA 4PGQA 2HNZB 3TX8A 2XHCA 3IG5A 1MW7A 2OD6A 3KOOA 3MUTP 2OPPB 1VHIA 3DUGA 4PEOA 2A6OA 1HMVA 5HK4A 9ICMA 4X84A 2KOBA 1CSJA 4LBHA 4QCLA 5IFMA 1KEJA 4R8UB 2E1PA 5C2GA 2RHSB 3SV4A 2FZCB 1QAJA 4ID8A 2UUCJ 2GOKA 4C5YA 1PILA 2J9DE 2J6UA 1HBMA 4LSLB 5KFGA 2YX1A 2UUWA 4P4OA 2CQ2A 3I5AA 3T19A 1T05B 4DG1B 1S9FA 2B9XA 4K4GA 1J2VA 3BR8A 4DN9A 2OJ3A 4LF8J 4NLKA 3KJFB 1XIQA 4QYRA 3MCMA 4ES1A 2FHOB 4O44B 3TADC 5AK3A 2BDPA 3DLJA 3PKMA 1XC9A 5F8MA 4KMOB 3MOZA 5HI7A 2B4PA 1ZS6A 2I0XA 4NXZA 4NPOA 4KLEA 2EZZA 3QGHA 4OJ6A 1KQQA 3T9NA 1W7WA 4RJVA 2DCUB 1L8LA 5FDLB 5IWAF 1L7PA 4OI2A 2EAOA 4GLXA 2BKNA 3C1ZA 1TVRB 5ETPA 4C0OC 2N82B 3IRWP 2B0GA 5KFQA 1X9XA 2VL1A 2Y3YA 3NRWA 4RKUC 3Q8YA 1ZD2P 4K59A 4WFNQ 4JI7F 4L76A 3UO0A 2XULA 3O6QA 1CG2A 2VIXA 2BANA 2K8GA 4QIWC 2EKYA 3BSNA 2EK1A 5EUHA 4IQWA 5HAOA 2VKZG 1J27A 3UDVA 3O2IA 1N32J 1CJTA 3MFHA 1Q53A 3TOQA 2GFFA 5BR8F 8ATCB 2KJ8A 4IH5A 4UUWA 3WK9A 2BUNA 3ZDAA 4C48A 3C19A 4OZ2A 4TLQA 4GKJJ 5CB1A 2BM0A 4WYWA 3F44A 3H90A 1ZQOA 2JWNA 3HHLD 1UJ6A 3OD2A 2YNFB 1VJQA 4R5PA 1TU0B 4IDKB 1RHQB 3EZ5A 5K14B 1RBLA 2E29A 1EJRC 1JUDA 3I0SB 8ICMA 8ICJA 4PXEA 3Q8SB 3CULA 2MQOA 2JJ4D 4DZDA 5CYMA 2DRBA 1JLBA 1BQMB 4ICLB 3BBBA 4I6WA 1YJUA 4CNUA 2I6XA 5CD4H 4NL9A 3WIUA 4MEYA 5A6WA 2JLGA 3N79A 3MOJB 2V8DA 1TL3B 2I2YA 4B3ZA 2ZDPA 2PFNA 1S97A 1XNQJ 4C2MA 3A0BU 1F6TA 3CCZA 1H6KX 3K7RA 1S8OA 4OYIA 3H8JA 2HPUA 3CC7S 3OTOJ 1COOA 4F2SA 1KCXA 3HFZB 2JDJA 2C2MB 1KN6A 2CPDA 4FKXA 3EX7B 4DCPB 4CLSA 3CGIA 1YJ7A 2GS8A 1ZRNA 1S1TB 4J9UE 1Y88A 2HGLA 2M52A 4NLZA 1VS3A 1Z1ZA 1FWBC 4DCCA 5CEHA 3ET6B 3Q86A 4UB6U 2WAQD 3PM9A 3IWNC 1FJCA 3DNCA 3RJIA 4QU7A 4I2PA 4HL9A 5JRTA 2CJYB 3JSRA 3Q22A 1F2GA 5E3PA 4NE9C 2QLBB 3K17A 3M2VA 1TUWA 4A8SA 4K50A 2P6UA 4H4OA 4LFAF 4B3SJ 4Z42C 1N0UA 2ZH6A 4UBPC 3V2UC 1MN9A 4ECWA 5DJBA 4DUZJ 2DH8A 2BRLA 2ASDA 4G1QB 3NWGA 2RD5C 2B7BB 5D3GB 4ZA1A 1C20A 1HWUA 3BJYA 1YTYA 3QBCA 1UEKA 4X62J 4AYBF 3GPAA 4QR0A 4C4SA 3OLAA 1JKHA 2AGOA 4KAIA 1GXTA 2I8EA 3C15B 2J6TA 1NFGA 5ALQA 3MD3A 4RNMA 4TYBA 4MF2A 2NYIA 4JI0F 4HYKA 3TQEA 2V4QA 4WE1A 1B22A 2DPIA 3GV8B 2P6RA 1KVJA 2BW2A 4F26A 1K1DA 4QJVA 1EF2A 2HWHA 2VKRA 3F2BA 2ZKTA 1AROP 2AV5A 2CA9A 4J9KA 2NRXA 1EHWA 4BWJA 4K8RA 3BSCA 5HQLA 4W92B 9ICJA 4WU2A 1HARA 2YNIB 3VVUA 4Y2YA 5J2HA 2DUYA 4X66F 4KGKA 1LKYA 1WUUA 3T5JA 2DNHA 1WYGA 5A2QU 5ALFA 3N6NA 1HNVA 1CJUA 2YB1A 3HILA 1KQKA 1DY3A 4OYWA 1EJTC 2ZH3A 2F76X 4DV7F 3H5SA 3H0MB 2M8DB 2E3TA 1Q46A 3TWZA 2DT9A 4WZQA 4DU7A 3OR1B 2DITA 4N47A 1F5BA 1NKBA 5ETLA 4LFBJ 4CLPA 4N8NA 4CNYA 4ZVQB 3SR6A 3DLEA 3ISDA 5ALLA 2FVCA 4NLOA 3UPFA 2R42A 2Z8QA 3R8YA 2UUTA 1GAOA 4S0MA 1VQ5S 4KE5A 4NCGB 3K59A 3QIDA 1M6YA 2W04A 1R3NA 4RLEA 1RZMA 1Y5NB 2JC0A 2G13A 1YG0A 3P96A 1GMUA 1JALA 1V3SA 9ICRA 3NBPA 3ZTOA 1UW9A 2Q6BA 1LQ9A 2JZBB 3QJJA 1FFGB 4UB1A 1T8EA 2V68A 3C29A 1NK6A 2FYXA 1MMLA 4DV4F 4IO9Q 4ZCMA 3Q8LA 2ZUAA 3FSYA 2CQ3A 1SIJA 4HDHA 1S1VB 2D69A 1Y4ZB 1XN9A 5B0BA 4H4MB 2XM3A 4DUYF 2K3IA 3D54A 3CJ0A 1L7OA 2KFZA 4NA3A 1MLAA 2GV1A 3MC1A 4A46A 3GB0A 1BPZA 2HOIA 3CJ4A 4B3OA 2W3RA 3M6UA 2RS2A 2FPLA 5HBMB 3DGVA 1KRPA 3DGPA 2B21A 3K2YA 5ETVA 4DOZA 5KG6A 3BBCA 1NK8A 1E9YB 3M8YA 1S6OA 1YJRA 4QZGA 5AIAA 3QE9Y 2BW7A 4DV6F 2YBVA 2MUTB 4R0EA 3M32A 5FLXY 1E9ZB 3FRYA 1X2IA 2VB6A 1TAQA 3SFUA 3L7PA 2K4EA 1UFWA 2UXDJ 3ETMA 4DQQA 2B4UA 3NVVA 2LFVA 5J2EA 1OPIA 4WFYA 2WF9A 4KLGA 2MQLA 2VG5A 1V5IB 4HLBA 2N3OA 3W60A 2ZBQA 4K4WA 1DTQA 1RXVA 1HQUA 1Z4OA 1H72C 5KG5A 3T9ZA 4LREA 3RH4A 2EBGA 3HFKA 2MQPA 5AM3A 4JBCA 2JZ5A 1R31A 3KFWX 3N7PD 4DV3F 3NS1A 3GCWP 3THPA 1O08A 3ZFVA 2COLA 1N6QA 2YH0A 5EN1A 1X5SA 2NYVA 2G2YA 4ED5A 3IFEA 3DHXA 2DXDA 2RS8A 1TP7A 1FNOA 1Z2LA 4RO0A 3CJKB 3SD7A 3FAHA 1PJ7A 1VQ4S 2WRMA 3L5KA 4M04A 2CPIA 3FDSA 2V6AA 4UQGA 5ALKA 4O3SA 1NHKL 4OV1A 2J0SD 3UPQA 3SAFA 2F9DA 2D3ZA 3W9HA 3F53A 1JWWA 1UCVA 4Y2MA 2IVMA 4W98A 3M8RA 1RTDA 2OLWA 1WKLA 5A8KA 3KUEA 1BNPA 2E44A 2FC8A 3HFVA 5K8OA 5GTIU 1BHNA 1BLUA 2F63A 5BJRA 4ELUA 1T9TA 1YK9A 3ISND 2MZRA 4LSNB 1B0TA 4ZVPB 3CO9A 3QMQA 4KPCA 4RW6B 2D1CA 4A8EA 2HBKA 3R2DJ 3AQFA 4RU9A 2KHQA 1RJJA 2KT5A 2LDIA 3OXGA 2OCEA 5KFTA 2C2EA 2Y9HA 4Y2IA 3VGUA 3LYSA 3FQKA 2P53A 3KLEA 5DQHA 2E9TA 2OPQB 1R9XA 3ENWA 3DOLB 3VVTA 5J0QA 9ICQA 4UAYA 1RABB 2CNNB 4RQ0A 4CLTA 2V2KA 4J7CA 9ICXA 3P4UB 1T05A 4ZP6A 1IIPA 3CTRA 1MROB 3N01A 1JJ2R 2G4BA 4Y0FA 2OAUA 2A0FB 2C2RA 2C2ZB 4H4KA 4O44A 2WF5A 4ZIWA 2Z2MA 1ZAXA 2Q79A 4NA2A 3DLGA 4ZIVA 2KXFA 3W5XA 5DG7A 5L1LA 5IQQA 3GJTB 5E79U 3UM9A 3ED5A 2H5JB 2BJ1A 1TELA 3D0GE 3L4PA 5FDLA 4KSEB 3OSPA 3QUBA 1TVRA 3EGZA 3RUBL 1FWKA 1W2BR 4HAIA 4WCEQ 1TAUA 4KT0C 2M9KA 1ICEB 2DNYA 3DKDA 3WKBA 1S6QA 2V8PA 2YVSA 4J9PA 1U8SA 4M9JA 2ZVSA 2BKPA 5FP0A 4EUVA 3ONNA 2K8BB 3MM6A 1D0EA 4F92B 1X4FA 1XSPA 2HHWA 1FFVA 3FC4A 1S6UA 4F0HA 4B6JA 1NB2A 2IDEA 3GJQB 4XK8C 4OHXA 3FCVA 3JAMU 2AQ0A 3SAGA 2W01A 3MTKA 2FGOA 3DI6B 3OT9A 2XYPB 3W5YA 2XI3A 4AUKA 3MGIA 1UMJA 3AD7C 2CKWA 1WC1A 2ATLA 5GADI 1YMYA 5LXYA 1HEKA 3PSTA 3MM5A 2I1RA 4XTTA 3NOCA 1RTZA 4QU6A 3DLKB 4DX8H 4F0LA 3RBZA 3OTEA 3PV8A 4PPXA 5GAHI 2IPOB 1UW4A 2DNLA 1J5EF 4DMZA 3MXHP 1SUQB 4AQYF 3CCTA 4DL2A 4RW8B 3UW1A 3MEEA 5ETQA 1ECWA 3MEKA 4M5DB 3KYLA 4RQ1A 1LK5A 4GO5X 4G1PA 3CCUS 2IOHA 4DS5A 4U7UK 2M70A 3B4DA 1NOMA 3D1OA 8ICLA 1FXRA 3M6WA 2DGZA 4P73A 1FVSA 1LXJA 4X65J 9ICTA 5ALPA 1QDUB 2NR0A 1S9GB 1W26A 1FD2A 2K1RA 1DQ8A 3PCOB 2BMBA 2VASA 3G9CA 5AHXA 2J7UA 5L9XA 2M7SA 3UVJA 2FVQA 3QYPA 2QT3A 1J2NA 1VIOA 3C46A 2QZ8A 1SQFA 1X42A 4QZ8A 4FXVA 3ET6A 2E5LF 2GH1A 3EYZA 3PW4A 4F0RA 5CYQB 4FVCA 1IBLJ 1C4AA 1VQOS 4GY7A 2DGVA 1A6LA 2LDYA 5E0OA 4F5QA 3BDPA 1MMDA 3QNWB 3IG8A 4YVZA 4JI1F 1D8BA 5J1EB 2IVYA 4WPAA 2XO7A 3TVYA 4YG2A 3KHRA 2JOQA 3SSQA 1NK0A 5BYQA 1Q79A 3M8WA 2E1MC 1QQ6A 2RF2A 3GIKA 3IGHX 1KFSA 4RQ4A 1HD0A 5KNIA 4K4IA 3ZZUA 4DCJB 3BYPA 3LGNA 4LFCF 3MAHA 2BGWA 4G1QA 2IAJB 2VM8A 2O66A 5D3GA 2KVQE 3VAGA 3ETRA 4OFZA 3E01B 4XUSA 4YXMA 4OCZA 4PYDA 4Y3CA 1HBOB 1WI8A 3FGVA 4YXJA 2JHEA 4M9LA 4M5JA 4CP5A 5KFFA 4QZDA 1W2IA 5D4PA 3GIMA 2FGCA 2FPKA 2WF6A 4DV1J 2PSZA 3I0RA 4ECXA 5JMNA 4Y2QA 1WG4A 4LF4J 1PSDA 2LYHA 1ZQTA 2AJ4A 3RR8A 3UNYA 4F36A 1WNEA 2I9UA 3ZDBA 3BO2A 4IG0A 1NNDA 1KQGB 1X4AA 1YSJA 1KOOA 3B82A 4QZBA 2YX4A 2ZBCA 2KRRA 2L48A 3RRKA 3I28A 2PE8A 4NCAA 3BQ7A 4I4BA 2E66A 1OQ6A 3UWTA 3RYLA 2J0QD 2WB1F 3QU5A 4M5IA 4MFBA 3B54A 4YY3J 2H4YB 1JXVA 4P74A 2KVCA 3LP2B 3NG8A 3G8QA 3TADA 2MGZB 1YJWS 4EP8C 2W03A 4CTAB 3OR1A 2GIQA 1RT1A 2ZH1A 1WELA 4LBPA 1TKZB 1T9XA 3JTNA 1FEZA 1JLQB 1WHVA 1OUQA 2AW0A 1YRXA 2HFNA 2QT7A 4NCGA 1TL7B 8ICRA 2CRXA 8AT1B 4ECTA 5HQMA 2YX8A 4UUXA 4NMLA 4Z7CA 5ETTA 5AICA 3TP2A 2DRDA 4NM2A 2NSBA 2JEJA 4UY85 2Y1IA 8ICIA 3M7DA 2IIHA 4O0NA 2HVIA 2ALZA 2FJVA 8ICPA 2JZBA 3AY0A 5IM0B 4NYOA 3CVKA 3G6VA 3EVWA 1JK9B 3GIJA 3US5A 2W9CA 3C16B 5THWA 1NJWA 1Y7PA 3UD3P 2I6WA 4KLSA 4ZN1A 4JYAJ 2QLXA 4H4MA 2GQ2A 3KLIB 2G09A 4FZMA 4HTJA 3LPEA 1QH9A 1U1RA 1B0VA 3RH6A 1VDHA 2PMZD 1Q0NA 2HGMA 4CH1A 5HP1B 4LF8F 1RWWB 2H5EA 2LU1A 4LZDA 1R0CB 3M8PA 2XWXA 1UZHA 3OFFA 4KLJA 4M5MA 3MR2A 2Q6CA 4L75A 1VQ6S 2WF7A 1UJ5A 5GAGI 5AKIA 1SV4A 1TFRA 5A6TC 3FRZA 4WP8A 2RQ5A 2MUTA 1KVIA 5KL8B 3R5DA 5RUBA 5ETMA 2IM2A 5J8YA 1U1NA 3HHLA 4B3TF 4XDDA 2RDDA 1UHUA 1CS4A 2V4JA 4FO6A 4UASA 2O67A 3UBPC 2DH7A 1KP6A 1UL3A 1VLYA 4DFPA 4RW4B 4HVZA 3KBBA 1TQLA 3EPIA 4X4SA 1M5KC 4P2FA 4PXBA 4U96A 2KNJA 2XSFA 3BBFA 4DFJA 3A8EA 2YH1A 4W90B 3GYXB 7ICNA 1UVJA 4YDXA 4DOBA 4Y2CA 4F3MA 2BR0A 3QUCA 3C23A 2R8GA 3NVZA 4M63A 2L3MA 2DGQA 4TY9A 4GKJF 1ZXIA 3NLCA 2BA9A 2CNOB 3I1YA 2GZOA 4YQWA 3MURP 4X2BA 1ZQVA 3CJKA 3MMAA 4DS4A 2ICSA 3JB9k 3C6TB 2IM1A 3ZZZA 3N7RC 3A1YG 3OL8A 2NSCA 4YS2A 3CD5A 2AXTU 3NEKA 5H9EJ 4KLOA 5IS2A 2XS5A 3NGTA 2A6MA 4CE6A 4PHPA 4ZS6A 4LR7A 2B9EA 2ASJA 1YBTA 5DQIA 1ZQCA 2A3VA 4ZPDA 4OI0A 5B66U 2K06A 2F4VF 2MB0B 3U7JA 3ZNUA 1PK1A 4WFAQ 2BE9B 2PD1A 5ADZA 7AT1B 1RAEB 5DZ6A 3HX0A 3AXKA 4OX6A 2ADCA 4RQ2A 5G5GA 4F25A 1RWUA 2AEJA 4WFBQ 5LXRA 2V63A 2DHXA 3POTA 1ZQGA 4KQNA 1PZNA 3SYZA 2ZIXA 3HKZD 4KB7A 4U8VA 3OTOF 2KYZA 2KH9A 2WBMA 2IC3B 1ZM4A 1Q8LA 3DU6A 3TUZC 4URSA 2PIIA 5J2NB 4NL5A 4J9MA 3NGRA 5KAKA 3J80U 3UXNA 4B17A 2F77X 1RCOB 4KHPF 2EQYA 1FWCC 1B43A 1Z1BA 2BE2A 4B9VA 3H8YA 4PL2A 5HMEA 2MKYA 3MMBA 1WC6A 1Q8BA 4AP9A 1R8HA 1MROA 3D68A 3SBMA 2XWYA 2R2RA 2DRAA 4KX5A 3GFXA 4PHEA 4ECQA 4FKYA 1VC5A 1MG7A 2GVZA 2V50A 6AT1B 4OZ3A 2DHAA 5DO2A 2WOMB 3TW0A 4NXNF 3RJMB 3IA0A 2VG6A 4JUZA 4NLTA 2UBPC 4ZVOB 4ZH4A 4FPRA 1IJEB 2F7VA 1FRKA 1WORA 2W1BA 8ICOA 4Y2KA 2F5GA 2DGTA 3KZIU 3IAM9 5C7PA 2BOAA 4R63A 1HUOA 1YNYA 2C3PA 1RXWA 4QW8A 2MYFA 2VDHA 2QG9B 3FEQA 4BC7A 3LA4A 1ZPWX 2OXOA 4Q0BB 3M4XA 1RHMB 1KHVA 3TEHB 1U09A 1VRTB 4X4NA 4ZN3A 5CXTA 5DBCA 2NXUA 4DX7A 1FO4A 1N5XA 2BM1A 4I2IA 4UB4A 3GV7B 1X31C 3WK4A 1BY9A 2RP5A 2N7CA 2A3JA 4GKKJ 4G1IA 3PACA 1OS5A 4C8NA 4BLGA 4ZLLA 1FXLA 4LF2A 1ZQIA 2GO9A 5GMKa 4ECVA 2KICA 3BM7A 3JPPA 3Q23A 2QB1A 1RT7B 1FWPA 3MM7A 2B5JB 1JLGA 2DR7A 1U26A 5D4NA 4DOCA 4Y00A 1N5QA 2JMGA 5J2MB 4WXOA 1KHWA 1IM6A 1OY9A 3AUOA 2LHTA 2ADBA 2YWKA 4MT1A 3N6MA 4C8LA 2IRUA 3MDCA 3LNPA 3DRSB 4NWIA 3AJDA 2FJEB 3PFOA 4FXDA 1W25A 2BPFA 5K8MA 1Z19A 5D6GA 5J0WA 5F0WA 3ZXWA 4RQ8A 1U1MA 4LFBF 2ZHOA 3V7PA 4GXKA 3N0VA 4QWDA 5KT5A 4ELVA 4NV0A 3CJ2A 4RT2A 3OFGA 3AM9A 3LDAA 2CQPA 1Y00A 4A8FA 4JI8J 3LPYA 1VBKA 2H1YA 3WK8A 4ZHRB 1SJ4P 3ONQA 4YOEA 3W7BA 5ALWA 4DPYA 3QUQA 1GTEA 2OGJA 5B08A 3D6FB 2V8GA 1S9GA 4DX5A 2IFXA 3GGMA 2HQGA 2MY8A 1N5TA 4OJOA 3M2RB 1VHFA 4ZVUB 2ZZMA 3ZD9A 4UOHA 2HBRB 1FERA 1WG1A 4OZNA 3DFEA 4IYQA 1HHSA 5AKGA 1NJYA 1LW2A 2DYAA 2LEPA 3CJSA 3GSDA 2DNNA 5HMYA 3DMJB 3QT6A 4M95A 4C8OA 1WJ9A 2OEHA 4USVA 1Z00B 3ULHA 2W2NP 3IBWA 2YQ1A 1JB0C 4DJBA 2ES6A 3SQGA 2KZMA 5H9FK 1D1UA 9RUBA 2GGPA 4ZCIA 1UCNA 3KG1A 3CUNA 4TVAB 4RNHA 4OYPA 2OMLA 3DRPA 3PNCA 2QYGA 4UBBA 3WX8A 1SL1A 1LVHA 5GVQA 2HHHJ 5DB8A 4ANCA 3U02A 2CJKA 1JNRB 2PFFB 3H5UA 2A19A 2MKKA 3G86A 7ICJA 3J7YI 2IAJA 2LVWA 1SXDA 4MAKA 4O5EA 4U95A 1HBOA 5CD4A 5F3TA 2UXDF 2FTRA 4PZVA 2NRWA 3H8MA 2J8SA 3MEGB 5K4LA 4NZ6A 3IRXB 4IFVB 1MMNA 1X4GA 4GC6A 3MTJA 2RRBA 1U6BA 4B9LA 3UDLA 4FDFA 2VOOA 4F67A 3PEHA 2KJVA 3P5BP 5K20B 3M1YA 4NLBA 4HHJA 2E7VA 2YPZA 2FLOA 2HLUA 2XCAA 2XMKA 3LS9A 1RBAA 4PG6A 4OYMA 4EGLA 2BOPA 3ZO7A 1UVLA 3KJVB 3ZTQA 1MN8A 4RDWA 2RQKA 1CJVB 4NLNA 3JXOA 4QZEA 3KHGA 4F3OA 1WI6A 4IFYB 4NRUA 3JQJA 1EIYB 3R2CJ 3OTCA 1RAAB 1S59A 1UETA 3M9OB 1RT6B 3RJFA 1H2TZ 1DGSA 3W66A 2QA2A 2C3UA 1QUPA 1ZOLA 4KJIA 1KVKA 5I3PA 2NLWA 4GBDA 3G8SA 1WCLA 1ZQDA 2LI6A 3GU3A 5J0SA 2E5IA 1X4EA 2QSWA 4DZHA 2Q1LA 4ZPBA 4HT5A 4CTAA 1JLEA 4QWCA 1ZQEA 1FIQA 1WHXA 4KQZA 4FF1A 4PUOB 2LPEA 3ETLA 3MABA 3VHQA 5KFZA 1C0UB 1Q81T 1Y3KA 3IS9A 5A0YA 5J2CA 5LJ3Y 2HEKA 1FDNA 4NLSA 2HGNA 3H0LB 2KM8B 3HT0A 2ZUBA 1TMJA 1HBNB 2PLMA 5CRXA 1ZQLA 3BGOP 3JSMB 2HNDA 3MECB 4QJFB 1IKWB 3QU7A 3R6LB 3GTYX 2A2DA 7ICIA 3K58A 1OMSA 1R8BA 3A8JA 2ROEA 4E8UA 1DQ9A 1M5PC 5KFKA 2WSFC 3PW0A 4FYYB 3GU0A 2FUG9 3P8BB 2ODGA 1Q95G 1RJQA 3T3FA 4KO0B 4YMEA 4HDGA 2GQQA 2PI5A 4NASA 2PFDA 1QM9A 3T1YJ 3HHKA 3U26A 1ZQWA 3QU9A 2E1FA 4G3IA 4K4UA 2AT1B 3PO4A 3EDRB 1NHUA 1CC8A 1RT2A 2P9GA 4ZPCA 2AMCB 2PFPA 1RTJA 2RILA 2QV6A 2YKQA 4YP3A 5KAFU 2RE1A 2KMDA 1RTIB 1H3DA 2KP7A 4CH7A 1PO9A 2CIMA 2LYVA 4G6VB 3A3NB 4F3QA 3UD5A 2HAIA 5B0GA 3BEGB 4NEYA 1ELOA 1XJWB 4ID5A 3E0FA 4A4JA 4F5OA 5AKZA 2HHPA 2E5SA 3AQEA 4DV2F 2CPFA 1JX4A 2HFSA 3Q83A 1VQLS 1NJZA 3BS9A 1HWKA 4XRHA 2U1AA 2ZKUA 3T6BA 2JGAA 2OHDA 3KDOA 3SMZA 1FWHC 4KV8B 1LWFB 4CRXA 1B70B 2GLEA 1HR0J 4WTOB 1YJTA 3M2UB 1R0BG 5DG8A 3AQOA 1RA6A 3R7SB 3OTDA 1NCLA 3OL6A 2KE7A 2VANA 2DR8A 4FE3A 4Y2TA 2FZGB 2HURA 1REVB 3C21A 1H2UX 2MU2A 1LK7A 2D3UA 4YN4A 2GMJA 1FX2A 5FSDC 3TO8A 4GVBB 3ENVA 4QWAA 4UW9A 3DYAB 3GV5B 4X4QA 2OTJS 3SDEA 8ICAA 4KKOB 1NLKL 2ZOFA 3LP0A 3M8QB 4X64J 4Q5VA 3GCXP 1I3OB 2Y0SF 1BQNA 3HT3A 4FZLA 4I69A 3C5GA 2APOA 2GO8A 3UCGA 4Q44A 2HQIA 3LW5C 3PNIA 4Q8EA 5CYJA 4B3RJ 1S1WB 3C8YA 3V6DA 1P9YA 4FS1A 3RU0A 5D0EA 5DLGA 1G1XA 4LF1A 1VQYA 4F50A 3GRIA 2E5HA 2YQ3A 4M1KA 4UZCA 3IM8A 4PWUA 3FFIB 3RFAA 4ZVSB 1B0XA 1IBCB 1DLOA 3QIPB 1UTAA 3KUGA 1RI7A 1A76A 2I5HA 3SZ2A 1YDLA 2LA6A 5GAHU 2P6TA 3HSGA 4NXMJ 1S9EA 4OZLA 3RJGA 2VQEJ 1IBLF 2DNOA 2MKHA 2FVMA 5TISU 2UXCJ 3VCDA 2IMRA 4LQ9A 4ED2A 2CPJA 3TJAA 4QQBA 1IBKJ 1LV5A 4CI0B 2DR5A 4Z6FA 2H3VA 2RQ4A 2EC0A 2AU0A 2YWGA 3RJEA 5EDWA 4NLPA 1RT4A 4UW2A 5D78A 1U48A 2FZKB 4ZCLA 4NLUA 2OKQA 4ZP9A 1MA7A 2AZ3A 3D6HB 1UWAA 1IKXB 1D8YA 5ALZA 2QRRA 3ZC4A 4Y34A 3GILA 2C3YA 1N36F 4DXLA 2R18A 3D2WA 1RWOB 3QRPA 1QE1B 3M1VA 2IM3A 2R7TA 1F0MA 1ZQBA 4O3MA 4RUCA 1MNEA 2IOFK 2FI1A 1L3VA 3D5MA 3QRQA 3H7HB 3NCQA 3BQ1A 1AXQA 2LQJA 5E3QA 4JOUA 2RLTA 1POKA 1RT7A 3G87A 2MHNA 2BZFA 2R7VA 1N33J 3L09A 1FNMA 3R5CA 5J2MA 1RG6A 4PQUB 2CQHA 1U1QA 3EGJA 2RRNA 2HCFA 4CT8A 4CF3A 3BDEA 4DL0C 5KG4A 1UPMB 5CZVA 4YY3F 3LWMA 1RT5B 3CSKA 1IKVA 1ED1A 2B6AB 1GXLA 3BV8A 1V3ZA 3LANA 4OX9F 3NCPA 2VQFJ 2LXFA 3CJRA 4UQTA 2OPSB 3CD0A 2DGUA 4AYBC 4ZHRA 4B3MJ 1AB8A 1T0TV 1UAWA 4DPOA 3O8WA 2UXBF 1NJIT 3NRZA 1NJXA 3KG0A 1B64A 3T6JA 5HMZA 4L74A 2YWEA 1N34J 2K4HA 3MEDB 2C28A 1KDHA 4DSEA 2PDAA 2KG1A 1HHTP 3TAPA 1L5UA 1U2CA 1N5SA 2ISOA 2XY5A 1YJ9S 3JPOA 1CC7A 5BOLA 3CCMS 3DLBA 1OSDA 1HI1A 2UUAJ 2Y9UA 3CE8A 1QQ7A 1S3TC 5G5HA 1ZAVA 4JYAF 2R8HA 1TV9A 2NO5A 2YKOA 2OFHX 1PJ5A 2CQIA 2M3DA 4J9OA 4B08A 9ICKA 3PZPA 1WUDA 1EKRA 2A10A 2EW9A 9ICVA 3QQCD 3SCKE 2GWNA 3AU6A 3LP1A 1ZQAA 3OPXA 2BV3A 4EO6A 4GFJA 4XQ8A 1Q4RA 4PABA 2MHEA 3DOKB 1PYOB 3CCVS 1JQGA 1RKIA 2KJWA 4XPCA 3X3UA 3QLHA 3C66A 3N5FA 1T3NA 1ZTWA 2V94A 2MKCA 3DC2A 3MEGA 2RB7A 1Y10A 3NXZA 4OL8A 1YI2S 2K60A 4KLDA 5F41A 2C2NA 4PQAA 3QEBZ 2H3FA 1X7VA 3VTIA 1YT3A 3AODA 3W2WA 3BS7A 3TUPA 3AOCA 2NO4A 8ICFA 3RF9A 2CQBA 2PMZC 2GWSA 1CJVA 4DR5F 2IBKA 4QZVB 5TZVA 1FDDA 1FKOB 3I82A 5LSOA 3QO9B 1ZD3A 3H2LA 4PWDB 1NSAA 5H2FU 2OFGX 1R6YA 4F4KA 7ICFA 1BWVA 2R7UA 4LJMA 1RT6A 1RXOB 1YX2A 1NSPA 4ZPTR 4R88A 1MU2A 4ZITA 1JLAB 1P1LA 2R4FA 1NPRA 2EFVA 1H38A 3N9UC 2YWWA 2XQCA 2KHCA 2QMXA 2XBPA 9ICUA 2KKVA 4A8KA 1G7CB 1XMOJ 5CH7B 1RTHB 1AUSL 3MPYA 5C25B 3QJPA 3KLHA 3CJ3A 1N60A 5ALSA 1YGYA 5I42B 4K0KJ 5AM5A 4PUOA 4HI2A 1X4HA 1FWJC 4RPXA 2FC9A 2FJWA 3IP0A 5HNKA 1C0UA 5KT7A 1PC4A 2JH1A 5KFDA 1FWLA 4ED1A 1TUVA 4TNOA 1OXJA 3MR3A 2BJEA 2DGSA 4JV5F 2G9OA 3AA8A 4ETXA 4B9NA 3DRRB 1TV6B 3DCAA 3VGVA 1HBNA 5AI4A 4OMFG 5AKLA 2W7PA 5HSPA 2HQ3A 4LF5J 3GP9A 4E2FB 2G5IB 1M5OC 1UT5A 4TUPA 1XRFA 3NVWA 5MLCV 1IKWA 5M2PA 4TYAA 5A8RB 3HK2A 1CVJA 1IVZA 3WU2U 3QJLA 2KI2A 4OZJA 1IBMJ 4UARA 4RWXA 3AOBA 1R8PA 2DCLA 2ERRA 3C6UB 4KYZA 3KOAA 1ZQRA 1XR6A 4QZ9A 2K89A 5KFWA 1FKPA 1S1XA 1VR6A 3ENQA 4CDGA 3F2DA 4FYXB 1WTBA 3L3CA 1VGYA 2Y8YA 4EO8A 1C0TB 3TKAA 4L3NA 1ZQYA 1Y5IB 3ELHA 3JPQA 7ICQA 3LH2S 2A18A 2BB0A 2EFGA 5HMDA 1TKTB 1N56A 3PX4A 4CLFA 1KOHA 3IV6A 2JVRA 4NEZA 1HIYA 2IM0A 3F41A 2ATCB 2HSEB 2G0CA 4DOAA 3BKUA 4PGYA 2KT2A 1F3FA 2HHSA 1A0OB 4P9SA 2KFNA 2WONB 3J81Y 4JB3A 4FZVA 2Z00A 4DR7J 1PYSB 2CWXA 5L1MA 3HHNB 3BKTA 3K57A 4LF6J 4LF9J 2CNKB 3DU5A 1X40A 2YMMA 2WAQF 2KXNB 3HO1A 2C1EB 2RQMA 3BSOA 2CXYA 4M8LA 3UNGC 8ICBA 1RJRA 1FJGF 2JV3A 3CCSS 2RVJA 1HI0P 3A3OB 3V81B 2R7RA 2GMHA 2QLJB 3H8WA 2KIVA 5EOZA 1WC5A 3GFHA 4KV8A 4GKKF 1SH0A 3MM8B 1LWFA 1CJKA 2M0GB 3NL0A 2OSQA 3WC0A 2B3TB 4OO1J 1DAXA 1QUVA 2G07A 4DR2J 2WSEC 3RJHA 2UVUA 5L1KA 5CABA 1QVFR 2RQCA 1TAMA 3D6JA 4NRTA 4I2AA 2HBZB 5LT5A 4GVBA 3S6JA 2BPCA 3BZCA 2AGQA 5AKHA 4EPDC 4KKOA 1X4DA 2ZNYA 4JI5F 5DB6A 1WOSA 1T9YA 4UB9A 1TL1A 3W5ZA 1F1BB 2HS3A 1MQ2A 2W8KA 2GHVC 2CRLA 2GJFA 1OO0B 1YRRA 2ZDOA 4LH8A 3NUQA 1IXKA 1A7GE 4KLMA 1EETA 3QEAZ 3BH6B 5JVGQ 3TZWA 3OJUA 3IDWA 2DO4A 3L7UA 3BQ2A 5EX0A 1IR2A 1QD1A 1S1WA 1VC0A 2WVCA 4XPEA 1L7NA 3CW2C 2DY9A 3UXPA 1KWMA 1VC6A 4C0BA 3CCQS 1TZ0A 3PYDA 2AYMA 5E33A 1BWEA 1RISA 2DKOB 2HMIA 4ZLNA 2LMRA 2RMLA 3V6JA 1XSLA 2VJ5A 3W8PA 3QIPA 3NKYA 4IG3B 5DM6Q 4DO9A 4O4RA 2R2TA 4ED3A 3KK2B 2AKWB 3IV8A 3EJMA 2XNRA 1HI8A 1K1QA 4ECUA 5EE9A 3HVTB 7FD1A