2PLMA

Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
404
structure length
404
Chain Sequence
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure-based activity prediction for an enzyme of unknown function
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
total genus 146
structure length 404
sequence length 404
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2plmA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2plmA02
4RZBA 4EP8C 2VM8A 2O4MA 3URQA 3IV8A 2EG8A 1A4MA 1M68A 3IARA 1UIOA 4XD5A 3ORWA 4CEUC 4IGNA 1P6CA 4V1YA 4KESA 1FWCC 3B0YA 1I0BA 4IFKB 4V1XA 4I6VA 4XD6A 3IPWA 2FVMA 1POJA 1WXZA 4XAGA 2GWNA 4CQDA 3GG7A 1R9YA 3UR2A 4GK8A 1I0DA 3EWDA 4IFOA 2ADAA 2P50A 4F0LA 4LCRA 1E9YB 4QS5A 2Z4GA 3TN3A 3GTXA 3PANA 3QGAC 2GOKA 2FTYA 4Z42C 3FEQA 1EJTC 3ID7A 1K6WA 2OOFA 3ISIX 3IACA 3IGHX 3TNBA 2QT3A 4BJHA 3QGKC 4G7EB 1JGMA 3QY8A 3LA4A 2DVTA 3EWCA 4KEVA 1UBPC 3DC8A 3NEHA 3LSBA 4DI8A 1XRFA 1RAKA 2HNHA 4WGXA 4LFYA 2DVUA 4ICMA 2Z26A 2Z28A 4NG3A 3O7UA 2Z2AA 4CNUA 1KRAC 4J2MA 2E25A 2Z00A 3EGJA 1RJQA 3WYZA 3PNUA 3N2CA 3E2VA 3QY7A 1PTAA 2QPXA 2WJDA 1O12A 4GX8A 3UR5A 3S2NA 4DNMA 4IFKA 1EF2A 3F2CA 1ZZMA 1KRBC 4M51A 4KQNA 2FFIA 4IH3A 4LALA 4YIWA 3MSRA 3DCPA 3RN6A 3PBMA 4H01A 2ZC1A 4DZIA 2GWGA 4QRNA 2FTWA 4BY3A 2EG7A 2Z24A 2EG6A 3MDWA 4C6DA 3F2BA 3K5XA 2YB1A 1KRCC 1FWFC 4CQBA 2AMXA 3S4TA 1YBQB 4C6IA 4G7EA 4WHBA 3TN6A 4C5YA 2Z29A 3LS9A 3LY0A 2HBVA 1EJSC 3GRIA 4PCNA 1A5KC 1V51A 1KRMA 4GXWA 4C6NA 5FSEC 2O4QA 3DUGA 3F2DA 5CH9A 4DO7A 4H9VA 2HPMA 2YZ5A 2HBXA 3GTFA 4LANA 1FWDC 2VHLA 1R9XA 4LCSA 4KIRA 3QY6A 2R1PA 4WVXA 3ICJA 4IF2A 2VC5A 2PLMA 4HK5A 1K1DA 1VFLA 3LNPA 4C6CA 2F6KA 1FWHC 1BF6A 3O0FA 4C60A 4KERA 1A4LA 3OU8A 1NDWA 4B91A 2Q01A 2WJEA 2Y1HA 3K4WA 3BE7A 1YNYA 2RAGA 1FWEC 1V4YA 4C6JA 1V7AA 5FSDC 3PAOA 1YBQA 3A3XA 3AU6A 2D2HA 4C65A 1WXYA 3OODA 4PBEA 2QVNA 3LGDA 4J35A 1EZ2A 1HZYA 4XAZA 2HQAA 3OQEA 1YIXA 4GOAA 2P53A 2Z7GA 4B92A 4PCPA 4B90A 4XD3A 4H00A 2Q09A 4C6LA 3S2LA 3WZ0E 1J79A 4IG2B 4KETA 5AKQA 2R1LA 1PB0A 4CNTA 4UBPC 3MDUA 3ITCA 3FDKA 2IMRA 4AC7C 4IGMA 1YRRA 3V7PA 3SO7A 4PBFA 4EPBC 4ERIA 2Z25A 4HJWA 4LAMA 2D2GA 3URBA 4DLMA 2WJFA 4R85A 2YXOA 1RJPA 1NFGA 3FDGA 1M7JA 1FWIC 4KEUA 2VC7A 1FWBC 3AUOA 4GY7A 2GSEA 4QTGA 4F0SA 2A3LA 2OGJA 3T8LA 1NDYA 1EYWA 4CQCA 1GKRA 3CS2A 4C6EA 3TN4A 1ITQA 4GC3A 2DVXA 2I5GA 2WM1A 3GU2A 1ONXA 2CZVA 3MJMA 3GU9A 1PSCA 1XGEA 1A5LC 2YB4A 3IJ6A 4QSFA 1IE7C 4C6FA 2D2JA 3LU2A 3GTIA 4RDVA 4XAFA 3CAKA 3RCMA 3IRSA 3HM7A 4DIAA 3SFWA 1UIPA 3MKVA 3HPAA 4C6MA 4C5ZA 4R88A 3CJPA 2AQVA 3GU1A 3URNA 2G3FA 4H9XA 3E3HA 4H9UA 3LGGA 1FWAC 3UPMA 5HMFA 3RHGA 3F4DA 1XRTA 4EPKA 4B3ZA 2PUZA 1FKXA 1A5NC 4DZHA 4GY1A 4PE8A 3JZEA 4CNSA 4ZSTA 3MVTA 4HA0A 3G77A 3UF9A 2KAUC 1A5MC 5HMDA 4EPEC 2HPIA 2VR2A 4CEXC 4R7WA 3GIQA 3MVIA 4H9ZA 3GIPA 1EJUC 5E5CA 2Z2BA 1ITUA 1P6BA 4KF1A 1RA5A 1NDZA 4DYKA 3B0XA 3OJGA 2BB0A 1EJXC 1UMLA 1ADDA 4RE0A 1A5OC 4C6BA 1GKPA 2ANUA 3R0DA 4C6QA 1RA0A 1J6PA 4INFA 1QW7A 1RK6A 3UBPC 4NI8A 1EJRC 4P5UA 1GKQA 1QXLA 2R1MA 4XD4A 4H9MA 2Z27A 1ONWA 4E3TA 2OB3A 2GZXA 4XAYA 4C6PA 1POKA 3GTHA 4LH8A 4LEFA 1RJRA 2PGFA 3E74A 4IQJA 1DPMA 3K2GA 3RYSA 4HK6A 5LXXA 4MUPA 1S3TC 3F4CA 4ZSUA 1O5RA 4C6OA 4GY0A 2P9BA 4I6KA 4GZ7A 5HMEA 1FKWA 4L9XA 2UZ9A 1EJWC 4H9TA 1NDVA 1XWYA 3T81A 4TQTA 3E0LA 4LAKA 3E0FA 3URAA 3TN5A 2AQOA 4L6DA 1FWJC 2BGNE 1W1IE 1P1MA 3MTWA 2R1NA 1KCXA 4QROA 1V77A 1YMYA 4HK7A 2E1WA 2UBPC 3KM8A 3C86A 4D8LA 1J6OA 1R9ZA 2XIOA 4QS6A 4GX9A 4DI9A 1J5SA 3B40A 2I9UA 3OOQA 4RDWA 3A3WA 3HTWA 4F0RA 1K70A 2PGRA 3E38A 3GUWA 4GYFA 2W9MA 4IG2A 4ERAA 4C6KA 1V79A 2ICSA 4LAOA 4RDYA 2OODA 2OQLA 4KEZA 3OVGA 1RK5A 4RDZA 3D6NA 1M65A 4J5NA 4JOMA 4IFRA 1EJVC 2R1KA 4AQLA 2FVKA 3A4JA 2QS8A 3PNZA 3S2MA 4EPDC 4ERGA 3T1GA 1E9ZB 4NP7A 3GGMA 3WMLA 5A6TC 4LCQA 4UB9A 4OFCA 2VUNA 4G2DA 4H9YA 3NQBA 3AU2A 1PO9A 3S2JA 1FWGC 5G4HC 3NURA 4BKNA 4DLFA 3MPGA 3LSCA 4GBDA 2PAJA
chains in the Genus database with same CATH superfamily
5AHLA 4F50A 1IEIA 3IV8A 4LVBA 4MJMA 2GDUA 1K8XA 2DFAA 3F4WA 5FJRA 4ED7A 3S46A 4CEUC 2Y5EA 2J7GA 2OO6A 1B1YA 3RO6A 5KT5A 1ALDA 1H7XA 2DW6A 3TXZA 4GWEA 4UTWC 1R9YA 4BQ2A 3ARXA 4JFTA 4J4KA 4B5NA 1Y7VA 3L2IA 4QS5A 5KFSA 2W8KA 3WQFA 1F7BA 1UD5A 1JD9A 3QZ8A 1K6WA 4HU4A 2OKTA 1AVAA 1GZGA 3EPMA 3V36A 4KT2A 3DC0A 5BXPA 2OSXA 4G9PA 3LA4A 3R5EA 2EBNA 3HGOA 5T9BG 4HVXA 2Z1BA 3VX1A 4AEEA 4CLMA 4P8VA 3MMDA 4RXFA 4ICMA 1O5XA 2Z2AA 3VC6A 4GUHA 1XC6A 1EA0A 2H9AB 3GM8A 5TIMA 3V16A 3WFLA 3IANA 3QLDA 5BOEA 2HV5A 1F76A 1EUAA 2RJGA 3M0YA 3MMTA 4QLLA 3AIBA 2VZOA 4IH3A 3NVDA 4R33A 4ES4A 3CTLA 3IJ7A 1A53A 4F4RA 1H63A 3NPUA 1M5WA 2NX1A 2PDPA 3UG5A 2W92A 3H2FA 4H6QA 1J11A 1XYZA 1G01A 2AMXA 4JXCA 3ZZ1A 1PAMA 4RPQA 1OX4A 3LHZA 4CCEA 1J93A 3H8AA 3M9NB 2V8ZA 5TNVA 4LXFA 1MZRA 3LS9A 1B3YA 1GPFA 2X7WA 3RFAA 1QASA 4UFKA 1WNOA 2AGTA 2PSNA 2D2OA 3WLIA 5CH9A 2FJKA 3P82A 3NO1A 2J6SA 2QF7A 2FLIA 5L1KA 4MMWA 1IEVA 3F4VA 3ABOA 2OTDA 4NI3A 2AKZA 1S2VA 3OVPA 1KA9F 2NQHA 2ODOA 1I2RA 3GHUA 1PVNA 3BLOA 3W1NA 5D4YA 1QBBA 4B2DD 4A8NA 1VFLA 3LNPA 4Q8NA 4I7VA 4WD0A 3O0FA 2VC6A 3BZJA 1LOLA 1SO3A 3FW6A 1NTHA 1SZNA 1REQA 2TYSA 2A3CA 4Y2WA 4C6JA 3A5FA 3MYPA 1GK8A 3EWUA 1W3HA 3SZ8A 1R30A 2F84A 3KP0A 1PIGA 2WZEA 5CGMA 4XD3A 1DIDA 1J79A 3BG3A 4A29A 5CBIA 4F4WA 1PB0A 4HYRA 3U0HA 5CPQA 3F5LA 1LQ0A 2JEQA 3UG8A 2ABBA 1T3NA 1Z48A 4RKAA 3M9MB 1P0KA 1XLGA 3OGRA 4O1EA 3PF3A 4H8HA 4UTWA 1QI2A 2CLFA 1DJXA 2UWFA 2YXOA 4EWND 1M7JA 3QHNA 4HZMA 4UR9A 1H62A 2B7OA 3TX9A 1ISYA 1YDNA 4O1CA 3H4XA 1KBBA 1LOSA 5DRIA 3A22A 3TN4A 2YL5A 3E2QA 3BQ2A 1HJVA 1ZRQA 2PB1A 3NFUA 1R6WA 1XI3A 4TQSA 3QYQA 3AIQA 2VMFA 4KPLA 4QSFA 3BQ1A 2E67A 3LTYA 2YBVA 4CQAA 2C28A 4ML9A 4HQVA 3NDZA 5EMYA 4IUOA 6CGTA 1OT2A 1I9CB 3E12A 3H2AA 1CTNA 3CJPA 3GU1A 4OBTA 4H9XA 2PPGA 2EEXA 4EPKA 1DTUA 2X2YA 1A50A 3PM6A 5KG6A 1XG3A 5M3WA 5AY7A 1S5TA 5I2UA 1H7OA 1W5PA 2BHUA 3EDEA 3AHYA 3UY8A 4N9BA 1TMQA 3ABSA 4NXKA 4D8ZA 4MPQA 5G1MA 3QFEA 2PP1A 2DPJA 1QRQA 3MB9A 3AC0A 2E5DA 1QR7A 2VRKA 1XBXA 3QV9A 3TW7A 5MKGA 3QW3A 5AC8A 4U5IA 1RA0A 3CZ8A 4O0KA 3RLUA 1J6PA 4INFA 1QFEA 5BXSA 4N2YA 1ICPA 3JRKA 4NI8A 1KB3A 4H7VA 1V8EA 3PTQA 4QJ5B 3KFTA 1AK5A 1F9CA 3FYYA 3DI0A 1B5TA 2BY2A 3MP3A 3I7SA 3OQ8A 3O0KA 4PUWA 5M2FX 1XR2A 1GOWA 2O9TA 1U5VA 3CMGA 4DM2A 3T0AA 5DY2A 2QCGA 3PZQA 4GVIA 4L9XA 3VDGA 4NYUA 2C8NA 3C2EA 2ZX6A 3FDSA 3E0LA 3IEBA 1KLZA 4ATLA 2PI6A 4QIUA 4IWWA 3O3RA 4RUCA 1Z69A 3VKCA 3GVRA 4N9DA 1W1PA 4S3DA 4NXSA 2YPIA 1MYRA 3B4YA 3VKJA 4U2ZA 3OOQA 2A3HA 3QTPA 4RDWA 3TE9A 3ZIZA 4Q8TA 2JF7A 3GUWA 4RE2A 3IIZA 1TMLA 3MBFA 3G1FA 3W2LA 2OWCA 3KZSA 3IUDA 3WSUA 4PMZA 3VO0A 2OO0A 4UCFA 3LHTA 5A6MA 1Q7MA 4MYAA 2R14A 4ZO7A 7CGTA 3G6VA 1S46A 1OB0A 1P7TA 4DNHA 4E2DA 2J8TA 3A4JA 5EWFA 4BQ3A 1ISVA 3HPFA 2DZTA 3K46A 4KRZA 4UZUA 3GGMA 4PMNA 4Y9MA 1D9EA 3C2VA 5K7JA 5KG3A 4JY9A 5E1QA 5GNYA 5IHRA 3NA8A 1C8VA 3IARA 3GNDA 1KM0A 1Q2SA 3SM0A 1DHKA 4JCMA 4I6VA 4KH2A 3IK2A 4LBSA 1O94A 4O1AA 5M1TA 2NUXA 1KM3A 5CZSA 4OU1A 3W1TA 3EYPA 4LC6A 4LYRA 3M6DA 3PBVA 3V3WA 4U28A 2Z4GA 1LUCA 2NQ9A 2BQ3A 4O8RA 3WEMA 1H3GA 1XYMA 3ISIX 2ZUWA 3TNBA 2AAMA 3PB0A 4RUBA 3ARUA 2OOGA 1XIJA 3GKFA 3NL3A 4WGXA 2OU4A 3A21A 2IKGA 2BTMA 3SY5A 1S0OA 3CAQA 3ZVHB 1ENUA 3SFKA 4J9QA 2V5CA 4HHHA 1R85A 2DGAA 4BI5A 2QCCA 1TWSA 1IR1A 4HT3A 3DI1A 4JTQA 4LALA 2AMGA 4I8DA 4DZIA 3BLPX 4R9OA 4ZOAA 3VM7A 5F2MA 1C8QA 4XB3A 4HTYA 5KFRA 2P8BA 4PRRA 4BEQA 4PRTA 1AJZA 1VPQA 1VRXA 4I7UA 4B5XA 1MFVA 3BK0A 1OFDA 2FPTA 3TR9A 4S3CA 4JV2A 5DG9A 4A8IA 1RPKA 2RUSA 5I0DA 2B31A 2XN0A 4NNCA 2QJJA 4DWSB 1PIFA 2CFFA 1JRBA 1J8VA 3HQOA 1GQNA 3PZ9A 2RKXA 1S1PA 5DO8A 2OH2A 3LY0A 5DF0A 2OT1A 1RXOB 3TQVA 5FOOA 4G6CA 3GRIA 3CHDA 4OUIA 5LIKX 1KRMA 4K8HA 4AX7A 4CN1A 3NQ7A 1AG1O 1VYRA 4PUJA 3GR7A 2VHLA 2F6UA 3CUJA 4GUFA 1OG6A 2Y24A 1NQ6A 2VQTA 3G6LA 4CD4A 4IF2A 2H3BA 2PLMA 4F79A 4AIUA 4CNNA 4HNNA 1R47A 4C6CA 3DBPA 4C60A 1A4LA 4R7OA 1JQXA 2JKPA 1A5SA 4E8CA 3ZT7A 1XPGA 1VHCA 4S3BA 4UTJA 1U30A 3IVUA 4HYKA 3NIYA 4DJFC 1W2VA 2XWEA 3C56A 1LJYA 5EL1A 3C0SA 4B5WA 2IXVA 4EWJA 3MMWA 2DZXA 3REQA 1RCOB 4UOQA 2JE8A 4J3XA 3UWEA 1J0JA 1E40A 5C2GA 2IPWA 2WBKA 3GDMA 3W37A 1JDCA 1F05A 5I79A 2P8CA 4GRSA 1OIFA 2ALRA 4GZIA 1QW9A 4QNWA 1WP6A 1W32A 5FAJA 4PMOA 3S9IA 3WNMA 2BOEX 1UOKA 4GA8A 1NFGA 1RSCA 2VWSA 2VNCA 2PRLA 4L7ZA 3KHRA 4Y90A 3WH6A 1VLWA 3QGVA 1QI4A 5DY3A 2E9BA 2NSOA 2PDYA 1B3ZA 1KTNA 4XG1A 5E0CA 4MUZA 1DORA 5T9CE 2OG9A 4ED8A 4L65A 1J0ZA 3W07A 3MCOA 3W7QA 1RP9A 3VIMA 3LG3A 5FF4A 3F5KA 3OYZA 1GGOA 4P8XA 1DJQA 1XQKA 4DAFA 5G1TA 5LIYX 4XAFA 4FS9A 1QNSA 4LF2A 1A5BA 1H0GA 2W0UA 1VP5A 4E0CA 2G8ZA 5KZDA 1O66A 1Z44A 1G9HA 1Q8AA 2ATMA 3W1AA 1M53A 1B31A 4JD4A 2DEPA 1EC7A 3TVAA 1H5VA 1PKLA 3LQGA 1KFJA 4KS0A 4ZO6A 4X22A 4GY1A 2EPNA 5AYYA 3EMCA 5KT4A 4XZWA 3N1AA 1EIXA 2PZNA 4LEQA 3UCQA 1KR0A 2ZADA 2VR2A 3VOIA 4Y7EA 5F4WA 3K13A 2CLLA 2YR1A 4R7WA 1IYXA 4H9ZA 3WNOA 4REQB 4RLIA 3TWBA 3VDCA 1XLDA 2QF8A 1F73A 4C6QA 4QEEA 2GYIA 4L1WA 4M6QA 4YWIA 1Q13A 2D23A 4L64A 1UCWA 3TDFA 5HJYA 5KFGA 3WQ4A 1NWUA 3W2JA 5AB3A 3BV7A 5H6HA 4IQJA 1DPMA 4TIMA 3RYSA 2BASA 3Q67A 3S6OA 2P9BA 1NP0A 2GUUA 4ZVJA 3FVDA 4DJFA 2H8ZA 5BMXA 1IWBA 4PMDA 2ZXQA 2WV8A 3WF3A 1US3A 2F7FA 2DIKA 1LWIA 4L6DA 1CZ1A 1SQ7A 1LLOA 4NZCA 3TSBA 5DMMA 1AQ0A 3KM8A 4YHGA 3S5NA 4G1NA 5CAHA 4AVFA 1UB3A 1YTKA 2FB3A 4C7GA 2JIWA 3QBUA 1HKMA 3HFYA 2CLHA 3UPWA 1NAL1 4E2OA 3ARVA 3SQMA 4LYKA 3AMKA 2ICSA 4ZTYA 2BGSA 1B90A 1UR9A 2OODA 1T94A 2Q3OA 1L2UA 3GG0A 3MP5A 4FMVA 5D30A 3AXKA 3GXNA 2GK1B 4RDZA 3D6NA 1M65A 4UOZA 2AL1A 3AIWA 1EJVC 3A6OA 3EPGA 1UZ1A 4NAEA 1F3WA 1BXCA 4Q7NA 2NWSA 3LPOA 1O68A 2FHCA 3PNZA 3OEXA 3WLHA 4NP7A 4A3QA 1Q2RA 3OZYA 1X6NA 1UD8A 3RX3A 5G4HC 1V02E 2I57A 5GJMA 1KTCA 3BO9A 1H51A 5CPTA 1VFOA 4R27A 1HJSA 3BOXA 1AFSA 4JICA 2AGPA 3LNMA 3WQ5A 3QV8A 1NQKA 2PWGA 1I0BA 3OGSA 5I09A 3WNLA 3W7EA 1YNQA 3EXTA 3TH6A 3DIPA 3UJRA 3ABRA 5HNNA 1JYVA 4GK8A 1JYXA 4K1WA 1B3VA 3UXIA 4IFOA 4I5XA 2P50A 1XYLA 2J7BA 3CPRA 4Q4KA 4W93A 3LUTA 1J01A 3MUCA 3CGTA 1I2NA 1YEYA 4PMYA 1FHDA 5KFQA 1OX4B 3MU7A 2X1TA 1R2RA 4AVNA 5MF5A 4Q32A 4R5EA 1LQAA 4Z2JA 1Q6LA 4J3SA 2PA6A 2CWXA 2ZTJA 1E0VA 3IJQA 3HV9A 3GDTA 1KRAC 3R8HA 4KCTA 3LERA 3VOFA 4DJDD 2XGZA 4ZQPA 4B9ZA 4GC7A 3EGJA 4M24A 4AAJA 3QTGA 1UR1A 3E2VA 3OA3A 3UR5A 4DNMA 6A3HA 4MAVA 2X8RA 4DQWA 1DQWA 1M1BA 2X41A 1MNSA 3KBVA 4FZIA 1X1OA 3MO4A 4Q33A 3MI2A 2FTWA 4BY3A 4UTMA 1XH2A 4JV1A 4XZBA 5HWMA 4M6PA 2C71A 1TYGA 1XFCA 1S97A 4N9EA 2XCPA 4DJEC 4JDYA 3MY9A 1REQB 4Q8MA 4YCPA 4GYJA 4QFUA 3AHVA 1H7PA 3C2YA 3ZJKA 2CZ5A 1JZ2A 3GNXA 2ZX9A 4FXFA 2FMOA 3WLPA 1UKSA 5KETA 3TN6A 5AYZA 1DYSA 1AD4A 3DXIA 4ZXOA 4LC8A 2DSUA 1Z6KA 4GJIA 1F07A 2WJZA 3BQ0A 7ENLA 5FEXA 4MY8A 1V5XA 1JPMA 1EBGA 3SRHA 5A6BA 4QAWA 1BPLB 4Q8VA 2UVRA 3LHUA 3M0VA 3WLKX 1GONA 3UXKA 3W1MA 4BF5A 1R9XA 5I00A 5LGXA 3B04A 2OMAA 2O92A 2GUBA 1XSKA 4EVZA 1K1DA 4QE5A 3UETA 1FWHC 1BF6A 3ES8A 2W4XA 1F4AA 2E5BA 3N11A 5C9WA 1K77A 8A3HA 1U33A 3L5AA 3B9EA 1V4YA 4XKYA 3JZUA 1O5KA 4W85A 4FAMA 1BYAA 4ROPA 4JL1A 1WXYA 4CU7A 3RAXA 2XGQA 3HOJA 1IZKA 1XDJA 3PJTA 1R87A 1H60A 4QE1A 1UR3M 4FB7A 1P0NA 3HURA 4TV6A 1VS1A 3TJLA 3SAZA 2WSKA 3UP8A 1OCNA 3W81A 4DL7A 4JTTA 3KL3A 3KVKA 4DL4A 5FAGA 1JEZA 3SQLA 5I07A 5D05A 1MUWA 2D2GA 1SR9A 4L4MA 5C55A 3GB6A 1DOSA 3WCZA 1XINA 1RP8A 4GKTA 3AUOA 1ZBVA 4TXEA 2VEPA 4P7LA 3RU6A 2A3BA 4FLQA 2NWRA 3VOHA 4Q8QA 1EZWA 1JZ8A 1TPEA 1WDQA 1E4NA 2GVYA 2YCLA 1WO2A 3O07A 2YDAA 1MSSA 6REQA 4JIEA 5HOSA 3GXTA 4FBTA 4ZQCA 3LBMA 3SEPA 5KFYA 3QZ7A 5DGBA 4WRHA 4KGLA 4XQ6A 1SVDA 2BOFX 3BSGA 2YCEA 1BKSA 3PVXA 4RDVA 2C6QA 3TLLA 3CAKA 2W7PA 4DIAA 1OVDA 2WO5A 2D3NA 3PR5B 1UIPA 3EA3A 2BODX 1PWLA 3D47A 2F8QA 4GCXA 3LGGA 2JIEA 1R0MA 7XIMA 1HG3A 8XIAA 3FJNA 2PUZA 4UFHA 3W7LA 3C8FA 4QCFA 1HGWA 1QPOA 3H6OA 5HMSA 4DJEA 3NQAA 3CAWA 1TX2A 1JZ4A 3ITTA 4H2HA 2WC7A 2NZLA 1JFHA 3C3UA 1JZ7A 5KFMA 2V5JA 1VZWA 4PTNA 2OQHA 3VMOA 2ISDA 3OLDA 1OD8A 2ZQ0A 4JEJA 4JY8A 4BFAA 9RUBA 1R46A 2CIPA 4UMBA 1IEXA 2XSXA 4QM1A 2J7EA 1YPIA 3NM1A 3BG9A 1FP9A 1HT6A 4IIEA 3PZOA 3Q8RB 4JYEA 5FEZA 4LAUA 2OR2A 2YSWA 4MFEA 1TQXA 4YTSA 3W76A 4Y8FA 4LBRA 3BMVA 1YHTA 5CSUA 1S3TC 2WLZA 1P7TB 4GY0A 5G2IA 5LNWA 3DG6A 4JQ1A 4UQBA 1VYSX 4FHAA 1ZCOA 1E70M 2VUYA 3SY1A 2ZE0A 2RH9A 1O5QA 5D2XA 1XH0A 1XCFA 3S1VA 2QGHA 1T40A 4LAKA 2R24A 2A6NA 1UUQA 1YKWA 3QRHA 3P84A 3MUIA 5EKYA 1UQZA 3M64A 5B80A 3O6YX 1TIWA 2QJIA 3VK5A 4WZHA 1EH9A 3WF1A 1I6NA 3V6KA 3E0IA 3UWVA 1JQVA 1AMYA 3H70A 2QDEA 1XBZA 2WHLA 5I3JA 2Z1WA 1LUCB 4LSBA 4I90A 3ATYA 4U3AA 4MJ4A 5LZLA 4J5NA 1T8QA 3BOFA 3NOYA 2PDWA 1NOUA 1JUEA 3T1GA 3ZT6A 1YQ2A 5DQPA 4GNVA 5D09A 1KGWA 3NQBA 4UNIA 3T40A 4O17A 4D6GA 3TA9A 1EO5A 3W25A 4ZCWA 2ZA2A 1XYCA 3VMPA 3ECQA 2VO5A 1BKHA 4N6FA 3W0KA 4H2CA 3UWYA 1PL9A 4TTGA 1BTMA 5ECUA 3LLDA 1XUZA 1JDDA 3DERA 2V63A 4B5VA 5KFWA 1TVNA 5I3GA 4FX8A 1EWEA 1GORA 4XAGA 2ZE3A 4IRDA 2WMFA 3MT1A 4UFMA 2PE4A 3UJEA 1F4HA 3GSMA 3ZFHA 4D6JA 3TN3A 4BI6A 1ITCA 2PFHA 2DJLA 4KGJA 5J5RA 4H8VA 2BXVA 2ESCA 2AL2A 4HA1A 4U4MA 4ATDA 4RK8A 2XVGA 1G1YA 3QV6A 3BJYA 2XN1A 2W9BA 4JTIA 3QY8A 2DVTA 3VI2A 1YYAA 1BRLA 4ZE4A 1S2UA 1V0LA 3V18A 2TSYA 4LUSA 4YJ5A 1MEHA 2Y7DA 1XH1A 2Y7EA 2FIQA 3H4GA 3GV8B 2E25A 4BS0A 5CGQA 4RE4A 2OSYA 2PDMA 3PNUA 3GVQA 5JH1A 4M0XA 5AN7A 2QPXA 4GX8A 3DFNA 1EF2A 4TR9A 5JIPA 4GD0A 1ZJBA 2DPIA 4M51A 2FFIA 4WJXA 2A6LA 4PUDA 1UQYA 3LPPA 3ATZA 2GWGA 1YLVA 2FYMA 2BG5A 3UWWA 3K5XA 4TX9A 2VGBA 1KRCC 1W1VA 2WCGA 1ZJHA 3L65A 1UR0A 2YGYA 1X38A 3L12A 1XGDA 1GVEA 2VKZG 3ZO9A 3CAVA 3P81A 2QVHA 1HKVA 3Q58A 3WUGA 1UBSA 3U4AA 1SJAA 4WDWA 3REQB 1E9IA 4IICA 4JIQA 3RB3A 4A6GA 2HWGA 3TYAA 4O3PA 1V51A 1EF3A 1BEUA 3FA4A 2QJMA 3QQ1A 2PDIA 2QCMA 2HBXA 3GTFA 1DIKA 3E2RA 4LCSA 5C5JA 2E9LA 2GFTA 3QY6A 4QAIA 5CPMA 3OBEA 1S0NA 9XIAA 3WLTA 1M7OA 1Y65A 1HN1A 1Z89A 2PC4A 3SCWA 3WQCA 1E51A 4GVFA 1KM6A 3INPA 3VNZA 2ASJA 3N73A 3K4WA 2YJQA 1V6XA 1G4PA 4MKSA 2PTYA 1V3IA 1XBVA 4Q4SA 3AU6A 3UCDA 1LT8A 3KL0A 2QVNA 2IW0A 4DBWA 3NWRA 4WX2A 4TV5A 1JGIA 2WMIA 5D2WA 5KZ6A 4DUOA 4TO8A 4D6CA 5KFTA 4ZGYA 5CBJA 4JHZA 3SCVA 1K1QA 4UZSA 2VZTA 1YRRA 4JIPA 4WDTA 4O11A 4CNOA 4DUWA 1LLZA 3AO0A 3O2LA 5JVLA 1TWZA 2YCIX 1RV8A 2C3ZA 3C0QA 3G1VA 3GUGA 3LRMA 3O16A 5JQ9A 5I3IA 4HCHA 4G7FA 2EPMX 5HQEA 5EBUA 1VPYA 2XVNA 2OGJA 1EP2A 3LV5A 1EYWA 3IUIA 2C79A 3S5ZA 4AYSA 4MPKA 1HJXA 2WNQA 2DVXA 3GXDA 1JUBA 2AAAA 5AOUA 2ISWA 4K6AA 3M07A 2W9CA 1MRAA 2NVDA 3UZJA 1VD6A 4Q8OA 1TZ7A 3EOEA 4NT0A 3IRSA 4ZO8A 4RUAA 2BOGX 3WUFA 1UH4A 5FI8A 5HBFA 3RMEA 5JIWA 1EO7A 3QOKA 3L0NA 2OX1A 1KGXA 2H6RA 5LKYA 1K9EA 3WF4A 3W3OA 1S3HA 4O14A 3QPYA 2BSLA 1FHLA 1Z41A 5J04A 5DQHA 4J9NA 1W9UA 2OYMA 2B81A 1W9DM 5M03A 3NL6A 4UXDA 1FVPA 1FFQA 1XIEA 1Z42A 4GI8A 1E4LA 1L6FA 3EX1A 3NGFA 2BFGA 4UNLA 2UVVA 1MRQA 2BWGA 4MNLA 9XIMA 4XVDA 4PB4A 3QZAA 4KF1A 1SU5A 3ZR5A 4TU1A 3BAJA 3ERPA 1V02A 4QQ3A 3THQA 3W6LA 1S5NA 4LYPA 3ZMRA 3LI0A 1Q6OA 4QEHA 1MDRA 3T8QA 3CHVA 3DENA 3P0XA 3TTQA 4P5UA 3PSVA 3FN9A 1JNDA 2Z27A 4E3TA 1FWTA 4XAYA 4YTUA 4NY2A 4MB3A 5XIAA 1OFEA 5DEZA 4NU7A 4DL3A 2VR5A 4CCDA 2O9OA 4LEFA 1R8LA 4LX4A 3TQ1A 3NQMA 1OX5A 3EAUA 3DHDA 4WY0F 2VP8A 3G3DA 4NAEB 2W91A 1E6XM 4GUIA 7PTDA 5HWNA 3ZYZA 1D3CA 1WA3A 1QBAA 3VAVA 5LNRA 1P1MA 3OP2A 2E1DA 4EIVA 3ARTA 3C86A 2P5NA 3BJFA 3EPIA 4I3GA 4AZBA 2A7PA 3AFBA 3MR2A 3MO7A 5D8WA 1V0KA 3AZSA 4I9MA 1DTNA 2C1GA 2NXHA 4A2SA 4DWSD 4HCDA 1QNOA 3IUHA 4L9ZA 2VQUA 1K70A 4HSNA 4FLRA 3BH4A 4RJEA 5I23A 4GC4A 2QCEA 3FJLA 4Z2GA 2DUAA 4DO4A 4HZ7A 1J5TA 4RW5A 3T42A 4H4IA 2ZX5A 4GCAA 4ZL1A 3MKCA 4FXRA 4Q4QA 1RK5A 1MW0A 1PX4A 4DM1A 1AZ1A 5LYRA 4IFRA 1V93A 2CKRA 4GISA 1V6TA 3UG4A 4KFOA 5FA5A 2NUYA 5LGZA 3S2JA 4EEYA 1ZP3A 4F8XA 4RZBA 2OPJA 1JIHA 3RBDA 5CC3A 1O7AA 1OK6A 3CH9A 4UTUA 3PZVA 5G1YA 4YMZA 4QX4A 3GXMA 2XIJA 2FKPA 3ITYA 1JVNA 1EIBA 3CU2A 2ADAA 4F0LA 2V3FA 4AY8A 1PEZA 1LCOA 1LT7A 3TOYA 2HMCA 2DPEA 4MLJA 3GBEA 1OT1A 1KCKA 4A3UA 3PULA 1TE1A 4O3NA 5IBXC 1Q5MA 3AI0A 2J8FA 1EL3A 3I7RA 3BDKA 3CWOX 5BCAA 1E0XA 1ZENA 4HHMA 1TPC1 3I7QA 4DXXA 1XIMA 1GYLA 2G96A 4PRWA 5HXMA 3EPOA 2YDSA 3AS0A 1AW2A 3KRBA 4FF5A 4YN5A 2ABAA 1OC5A 1Q45A 3G1AA 4HMEA 1WKDA 1OQFA 1TV3A 3HMJG 1D2KA 2ZUMA 4GH1A 3DCPA 1ADSA 2XFWA 5HNTA 5KFVA 2WCAA 4PTVA 5E0KA 1SW7A 1UZHA 1EX1A 1TR1A 4CD7A 5GVJA 3THUA 1FWSA 2WSYA 4FX7A 5BRPA 1QCWA 4NZ1A 3QEZA 3U2EA 4AW7A 1YDOA 1A3XA 4XKYB 3W74A 4QWBA 1QW8A 5U4NA 4PN2A 2ISSA 4QCEA 4QW8A 1P0BA 4QJ3B 1EJSC 5BYWA 4ECZA 3SN4A 2BZNA 2JFEX 5IOBA 2BX7A 1F6PA 5KFIA 3ITLA 4EYIB 2HPMA 4ZQMA 3RX4A 3KBSA 1VJIA 5EY5A 4ZA0A 1ITXA 3BOLA 3D0CA 4FX6M 2V5KA 3LYEA 4NJJA 1KV8A 5SWUA 3CM4A 3LTPA 1EGZA 1Z3NA 4YTRA 2JGYA 3VIHA 3WLSA 1VCFA 1FY6A 3I3DA 4AU0A 2QIIA 1HIZA 1YE6A 4WF7A 1CCWB 3IGUA 4YPJA 4PSPA 1TX0A 3TJXA 2YCLB 3AMLA 6REQB 3B0UX 3R94A 3RRAA 1E4IA 3DHUA 5XINA 3E5BA 5D38A 2Z7GA 2ATSA 4HNUA 3CHCA 1H1NA 2XFYA 3B06A 3PBUA 4FSAA 4PGLA 1MDLA 2BHZA 4B16A 4Q8FA 2YA0A 2R1LA 5DRCA 4GI6A 4UBPC 2ZXBA 1W31A 1XIFA 2ZRYA 2ZRXA 4DRSA 4PSRA 2HE5A 3GHTA 4NIRA 2Z25A 3I3BA 4HJWA 1LWJA 4IMAA 3VIJA 3H7UA 1CXLA 4FXSA 3NR0A 4C1KA 3H53A 3QSRA 2DIEA 4ORIA 5KT3A 3L67A 5BZAA 4QTGA 1JXLA 3GV7B 2E68A 4GGBA 3B9AA 4Z1BA 4L4OA 1EPXA 3T5HA 1G6CA 2JEFA 5F2LA 3WDJA 3B8IA 4HA4A 5IBXA 3C8NA 3LX9A 3LEPA 4FR6A 3PPFA 2ZUTA 3SJ3A 1ZP4A 3VE9A 1HKJA 2YCKX 1G4TA 3WH8A 4AHPA 3KCOA 1ZL1A 2FVLA 2PRMA 3Q8QB 3MJMA 3BV4A 5CZKA 1PSCA 2RGMA 1C7SA 2OVLA 4YVVA 1UASA 4PBGA 1WZMA 1FUYA 3GTIA 3FSTA 1CB2A 2HEJA 3BW3A 2DSVA 3PJXA 3W82A 3VIFA 1PX3A 2YBUA 2GOUA 4JFVA 3SW6A 3S3GA 5BOOA 2AQVA 3T5LA 5A94A 3ARSA 3CH0A 1F6KA 1W5QA 1PZ0A 3F4DA 1U1UA 1FKXA 1UMYA 3W87A 1A5NC 2PDLA 3SADA 1L6SA 4U7CA 2J62A 5EA9A 2G4FA 1EUNA 1MFUA 4WIWA 3QZ6A 1LL4A 3THCA 2C14A 2TODA 3RPTA 1UR4A 2ZRVA 3ABXA 2JF6A 3CLMA 1KXTA 2DZSA 3IAPA 1BQCA 1ITUA 2XYLA 2BB0A 2WAGA 2PTXA 4FK9A 3L4YA 3RUBL 4NZFA 3NJ3A 5BMWA 4FOKA 4JTRA 5A8PA 3KWXA 2ZCGA 2FDMA 2OT0A 2WMGA 4RV3A 4FNSA 4LS1A 3NOEA 2VDGA 4JHOA 4XO7A 4A3RA 1BD0A 3MQTA 3UR7A 2ZC8A 5BRBA 4C6PA 4JL2A 4L5ZA 3SI9A 3GTHA 4LH8A 1G0CA 4H6EA 3UWUA 4UTTC 5DN1A 1ZY9A 3RG6A 4LUIA 4AD0A 5LXXA 3LQLA 3U48A 2INEA 1DQXA 1EEPA 2C19A 4I6KA 4JTFA 3IIXA 4QHRA 3QHOA 4I9JA 3UNTA 3SCNA 1IXNA 1XIHA 3WD4A 5MHBA 3E96A 3T81A 5A3HA 1US0A 4CCZA 4XZ9A 3S5OA 1DEDA 4HMCA 3BUVA 1GPWA 3MTWA 2QYGA 2PU0A 3CEPA 2WHKA 4ZOBA 4DY1A 4TQRA 4QS6A 3EKLA 5HPOA 3GFYA 1ZBKA 5LA0A 4A8RA 3G0SA 1WV2A 3ZR6A 4S23A 1L9WA 5LSMA 1GYMA 4GYFA 4JTHA 1RQHA 2Y8UA 4IG2A 3UXLA 1B0IA 2GGGA 4GUJA 4BHYA 5A8NA 3GO2A 1XRVA 4KBXA 4KEZA 4Y6GA 1GZ1A 3HN3A 4ZFMA 3OG2A 3E9AA 1YX1A 5TBOA 5F1VA 1CB7B 1IT7A 1HF6A 4GI4A 2W9BB 2CLIA 2DUXA 1TZZA 2CZDA 4YVXA 3EWBX 2W67A 4MSSA 1BGGA 1PKNA 3WEOA 1BRLB 1YTDA 1THFD 1RD5A 4LUSB 1CGVA 1SZFA 4GBDA 2QLYA 1BG9A 3R79A 4E5TA 3CV1A 2PDGA 3HQNA 1GVOA 3RPMA 1XRSA 2OKOA 1IT8A 2OWXA 2NT0A 4H1ZA 5JH2A 4IPPA 3EEGA 3RCNA 5HA7A 2FZBA 3BCFA 3W1UA 1FDZA 3UD6A 3K8MA 3IPWA 4F4YA 1IM4A 1IEWA 3CNYA 5D9MA 2CBJA 4JTJA 4DF0A 1WXJA 2Y7FA 1QT1A 3E0VA 3UZYA 3S5SA 5FL0A 4NUWA 2XH7A 3QH2A 2VEFA 2FTYA 4IR1A 3VD4A 2P1FA 3QJAA 2WNWA 1UUOA 2VA3A 3TW9A 2XINA 1JGMA 2JEPA 3W00A 4DI8A 4ADUA 3CWHA 3DFPA 3M5XA 1H50A 2NVAA 2VENA 3FGCA 2Z26A 2Z28A 3WQEA 2ZDSA 3KXQA 1QWGA 4ASTA 1BWKA 4YL2A 4NVTA 5T8GA 1IGWA 3G1RA 5KFXA 4QWEA 4CU6A 2DDXA 2SFPA 2ZUUA 2X09A 1L6YA 2G5WA 4ZENA 3CZJA 1RUSA 5D02A 4AB4A 4KWUA 3C61A 3K8KA 4HNOA 1QO5A 4UTTA 2PLJA 1QOQA 3QF0A 3S1WA 4POCA 2J75A 3KP1A 2F6XA 3BTNA 4NRSA 2HXTA 3UW6A 5F9LA 5E93A 1ZB5A 4G56A 3TA6A 4MNMA 4Q6JA 4R7JA 2WWDA 4US6A 4AVOA 2WMIB 1JCXA 2VZSA 1E15A 3MSYA 3ZR4A 3NPXA 1C9WA 3F2DA 3PFRA 3M47A 5A2AA 3BQ6A 3AROA 4DBSA 4NF7A 4AD4A 4IL0A 4QJ1A 5I6SA 4UWMA 3POCA 2Y4SA 5ABEA 1H2JA 1Q6RA 3QMSA 3APYA 2RDJA 1UA7A 2WC3A 3JW7A 3N2BA 3N2TA 4Y9OA 3OHIA 3VDBA 3GD6A 3L2MA 3MR6A 4BQ5A 3B0PA 4TMBA 4NSBA 4HPHA 3TZNA 1NP2A 4O54A 5D33A 1ZGDA 4GYKA 3WLNA 1TA3A 5C7HA 3A3XA 3EOOA 4F9JA 3LGDA 2R8GA 1CDGA 2PGWA 4YYFA 3EXRA 3W7IA 4Q45A 1S2AA 4BQ4A 4X0NA 4PCPA 1XYAA 1VC4A 3WDHA 3FFSA 3MFHA 2V81A 3ZOAA 3HZ3A 1TG7A 2QQ6A 1OZMA 2Y5JA 3SCSA 1TJ1A 4D6EA 3M0IA 3M5YA 3WQGA 3RDKA 4J9JA 1XYBA 2XSBA 3W2KA 4DLMA 1TIMA 3QPZA 1RD6A 4ATWA 4YR3A 1T8XA 2XIBA 3N18A 2GSEA 3TWAA 2G97A 2A3LA 3T8LA 4IP5A 1SFTA 1R7AA 3PZUA 3HPZA 3PR4A 3KUMA 6XIAA 1UP3A 1CGTA 1UD6A 3WLLA 1UH2A 1IV8A 1XQLA 4V28A 3AWNA 3GU2A 3CO4A 1XISA 4ENLA 3PZPA 3PPGA 4NNAA 1FX6A 2HJPA 4IJRA 1H4PA 2D2JA 2YYUA 4AD5A 2WB5A 1UKTA 4WR3A 3AJXA 4PMQA 4ECVA 3W7GA 5DFAA 5LNVA 2HS6A 3CASA 2ZDRA 5H91A 4LUYA 1GG1A 1MWOA 2VFIA 3RCYA 4O4VA 1HKIA 1FWAC 1UJQA 3CWNA 1C8XA 2J88A 3PP7A 1NWSA 4ED1A 1HO4A 1B9ZA 3HO8A 4YYCA 3CIVA 3WH5A 4HA0A 3AZTA 4ECLA 1UD2A 3GYCA 4M56A 4GACA 1DKWA 1SFJA 4OIFA 3MBDA 3M41A 1IIHA 2X40A 3PBWA 4NZ4A 4PR4A 4UMAA 4WJ8A 4D2JA 1CX9A 4RZ6A 1V6WA 2OEMA 1XLMA 4XUYA 3PW7A 3TEVA 1NOFA 1XYFA 3GDLA 5KTLA 4Z2LA 1JULA 4LS0A 4LGXA 4AY7A 1VEMA 4IIFA 1RCQA 3SCUA 3ZWTA 1F8IA 2ZXAA 4RNFA 3UY7A 4ACZA 1RQEA 4X2RA 3CUHA 3IJDA 4JIRA 2X05A 3NL5A 3PPHA 4JTDA 3TTOA 1ELSA 1VQTA 1W9PA 1B54A 4PMUA 2DW7A 5C70A 2GQ3A 3OPSA 2VGFA 1QMLA 2HSAA 3NQCA 3M9YA 1NVMA 5CG0A 2E6DA 4PTMA 3P0WA 1X96A 3N17A 1XG4A 2CZFA 2POZA 4OT7A 3PFMA 4PEEA 2EHHA 1FH8A 4E4PA 1S39A 4QROA 1ADOA 3KHDA 3DHPA 3KE0A 3P62A 3W86A 4HK7A 2J6UA 3H2NA 3V4BA 1OCJA 4D8LA 5F4XA 3BJSA 1R9ZA 4U3CA 3C4UA 1W9BM 2QUMA 3KVLA 1DJHA 5A6AA 1FCUA 3LMZA 1HQTA 3TR2A 3MZ2A 3PVFA 3G0XA 1Q6QA 2QIWA 4H8NA 3ARWA 3QFWA 4LAOA 4HNLA 4KEMA 3ITOA 5FJIA 4IRKA 3VM5A 1UZ4A 3NSNA 3G6MA 1GVQA 2I7GA 3GHRA 4S38A 4E2VA 1OF8A 1LOQA 5D37A 3TFCA 4HU8A 1YTEA 2GDVA 1XKJA 2PMQA 4QWAA 1TJPA 3OVRA 1PO9A 4HHPA 1ZFJA 4K2SA 1L6GA 3CV6A 4HNTA 3A4AA 3MSDA 2J7FA 3DFOA 3BAYA 2PWHA 2ZA1A 5DQIA 1OG0A 3PBYA 4JTGA 3UG3A 4E2BA 2EKCA 3HJEA 5K9DA 2XHYA 3U7VA 4KESA 3B0YA 5M5DA 2I1OA 1IQ8A 3S2CA 1US2A 4Z2KA 3NSXA 1DJIA 4GFSA 2J6VA 1KV5A 1X7IA 3UR2A 4W87A 4JFWA 3H7RA 1I0DA 1W0MA 2R8JA 3R8GA 4NZ5A 3ARRA 3L23A 4GIRA 4L1XA 2EXOA 1KQYA 3VDAA 4B5UA 2EKGA 4BJHA 3QC3A 1OFAA 4G5DA 5CPLA 2AU0A 5FJTA 2HNHA 4A21A 2CITA 3RM4A 1DVJA 1TPB1 2D0HA 5C5YA 3UWZA 4AWUA 4JYFA 1JAEA 4WLCA 1BSIA 1LL6A 1WDRA 5D9OA 1MXDA 3THAA 5TQLA 1A49A 1RJQA 1UR8A 3CB8A 2NQ5A 2Z6JA 2QMKA 3VIKA 2G4JA 4JFUA 4NKCA 4AY1A 1EOMA 1QNRA 2EG7A 4HPXA 4AHQA 4Y9PA 1B3WA 1DJNA 1ZAJA 2PS2A 2O55A 1E55A 2D20A 3P2VA 3W2UA 2QNEA 1Z7AA 2QHAA 1PPIA 2XH2A 6TAAA 4O3SA 5HPCA 4G7EA 2A79A 4EOUA 5CZTA 3DOPA 2V5BA 4LJ3A 1CXEA 1SMAA 4FNRA 4JN8A 4L61A 3DZ1A 4HIBA 1A80A 3V5FA 1GJUA 1L8PA 3A13A 3HFTA 3VYLA 4AD2A 4AIOA 2O4QA 3R6IA 2J7DA 4HMDA 3L4VA 3CMJA 4JR5A 3AUJA 4KFPA 4XK2A 3L0KA 4RR4A 1E56A 3VXGA 3TZFA 2R1PA 3S8HA 5KZMA 3LDVA 4NNBA 2VC5A 3P8IA 2HK0A 2WLYA 5A8QA 1OADA 1W2PA 3CYJA 3UXDA 1M3UA 3LLXA 4P7NA 3FSUA 4LUJA 2QULA 3GAKA 4JEQA 2WVVA 3C0JA 1U83A 2DZPA 5C8BB 1P6WA 3GIMA 2FLLA 5I3HA 3DFHA 1SO6A 1W3NA 3WJSA 3HG3A 3NDYA 3P3BA 4AHOA 3VKKA 4B90A 1VLIA 3ANVA 3T5KA 3QZEA 4DXVA 4KRTA 7A3HA 2CYGA 2IMRA 3VILA 2GUYA 3CIXA 2QV4A 4FNTA 5A8OA 1NF0A 2Z7KA 3EX3A 2XFRA 1MW3A 3GIIA 2WJFA 1DXFA 4Q3MA 4Q8UA 3WH9A 4AZIA 3P5YA 3KCJA 3POHA 1CLVA 5AFDA 3KOZA 4YR2A 2E8YA 4OOUA 4PUKA 4C6EA 3T09A 3R1ZA 5KFBA 2UY5A 1ESWA 3MKKA 1E0UA 1DWHM 2W6RA 4B3LA 1L0PA 4KCUA 1PJ9A 1XHGA 5EMKA 1I45A 1JDEA 1UWUA 5K9XA 2HVOA 1B57A 2C0AA 3F7JA 3PSWA 1AJ0A 4I9AA 2CKSA 3RHGA 2G0WA 3HGJA 4O1FA 1XSJA 2C16A 4QDWA 1FCQA 2PRHA 2PWFA 3KLKA 4FLSA 1MW2A 4F4XA 3MVTA 2KAUC 2O7QA 2E6YA 2WKGA 5HMDA 4EPEC 3EOSA 3CYVA 4MNKA 5AC4A 1E5JA 2YL8A 2J9YA 1J18A 3EDDA 1D8CA 3PZNA 3VKDA 1JCNA 2Z2BA 3B0XA 4AUBA 2A85A 5DCDA 1OFRA 4JPGA 5DLGA 3SQSA 1V7YA 2Y62A 4YWSA 4K3ZA 3E02A 4KW2A 4J9MA 2C2RA 1HJQA 3WBWA 4HNVA 2D0GA 2VDHA 3CXOA 1EJRC 1EFZA 2QZRA 2DH3A 1NJJA 5D03A 3GXFA 2PLCA 3CL6A 4ECWA 1UWQA 2HNEA 3DESA 3VDHA 5L6UA 1GOKA 3EWZA 3BLKA 2W9AA 5A6BD 1UWSA 4HK6A 2X1SA 3FXYA 5LA2A 4JN7A 3W7HA 3V1PA 3CHFA 3A24A 2YOCA 1FWRA 3T08A 4JIHA 1WAWA 4GZ7A 3M0JA 3DYMA 5CJMA 1WUEA 1MW1A 5G5IA 3HG5A 1G7UA 2EPLX 4RZ5A 1GCYA 1XF0A 1GVSA 2BGNE 4LQ1A 1OYCA 4HU0A 4C1NA 4EXBA 3FKRA 4O0ZA 4F2BA 1YNPA 2WW5A 4UQEA 5C7VA 4X60A 1KM1A 3NM3A 1Q65A 3OLGA 1LTDA 5CPNA 3WX7A 3LGEA 1TR9A 4GJ1A 2QKFA 4FXJA 5H8PA 4FOUA 4W8BA 1UZDA 4GABA 4NASA 2ZA3A 3ALGA 4RDYA 4MM1A 4YHEA 4Z08A 5XIMA 3BGAA 3OVGA 2FHBA 4JOMA 2OEJA 4MWAE 3E6EA 2ZUVA 4AQLA 5CGTA 3O6AA 3W27A 3N6JA 2ACUA 1OK4A 3AIUA 4BA0A 3LM7A 4MOZA 1HTIA 3LK6A 2I14A 3V5CA 3EKZA 2BY3A 3FGCB 3CT7A 4OTKA 1H1ZA 4KWSA 5E9AA 1QOPA 2DJXA 1GVIA 4JTEA 3NQ8A 1JDAA 1OFQA 3S9YA 1A4MA 5I03A 1M68A 2BQUA 5JXQA 3SRKA 1DWGM 1LBLA 3JU2A 3ORWA 1ZUAX 4IM4A 6ENLA 4N02A 3PW0A 4K7YA 3WG6A 1VBJA 1R38A 1TWIA 2B7QA 3P8JA 3WEZA 1VB9A 2XTKA 3VCRA 4B15A 4LCRA 3AYRA 2HISA 5DMLA 3CZGA 3WQDA 2J27A 2WQDA 1JPKA 3QGKC 1A5AA 4W8LA 5DELA 2BMBA 3LCFA 3SDOA 4XTDA 2VT0A 1UBPC 3W01A 1E1CB 1ODUA 2DT3A 3U4FA 5FEPA 3DAQA 5JBDA 1GVFA 2NV9A 3W84A 3GFZA 5JUVA 3STPA 4NG3A 3PG8A 1I2OA 1OABA 3B9DA 1RY8A 4DJED 3CO8A 4OUEA 3UVIA 1Q4NX 3AYSA 3EEZA 4FR1A 3GZAA 5K9CA 2RDIA 1LROA 3WMSA 4IFKA 1RYSA 5A8GA 4ZEPA 2CLOA 2CCRA 4KQNA 2ATLA 3H2CA 1AH3A 1JFXA 4HZ6A 4JV0A 3VNYA 5KFNA 2RDXA 1A5UA 3S1GA 3OA5A 2EG6A 3Q45A 1LDCA 4PTWA 1MNZA 5F1UA 1F6YA 1F8MA 1XM3A 4O57A 4RE3A 3AQUA 2QGYA 1TA3B 3R2GA 5DBTA 4GUGA 5F4SA 4CCCA 3S1XA 4ACYA 1HW6A 4IMCA 1CI1A 2JEGA 3V5OA 1WZKA 1S5MA 2C2EA 2CHOA 5KMYA 2ONEA 4J3WA 2F2HA 4ZOCA 2EO7A 2YZ5A 1TTJA 1H7WA 3TK7A 1VFSA 1AL8A 4WVXA 4JCLA 2GL5A 1Q8JA 2PDNA 3USBA 3VINA 2F6KA 3T0BA 2R94A 1Y8BA 4LVDA 4PH6A 3CUXA 3GNRA 1MUCA 1YNYA 2J79A 2RAGA 1E3ZA 2GDQA 3PZMA 3D46A 3U5YA 1KW1A 3GQCA 4ROQA 1MEIA 3HMCA 3GKAA 4GKLA 5CPSA 4BK9A 4PCFA 1I2QA 2P53A 4QISA 1KR1A 2YFOA 4B92A 5LHEA 2BS9A 1AQMA 1Y5XA 1BG4A 4DEZA 5CSSA 1LWHA 1Q66A 3GR8A 3U6WA 2RDTA 4V15A 2R82A 4Y9NA 5CBBA 1QO2A 5CZJA 4O19A 3AALA 3B03A 4WK9A 1KC7A 1G94A 1X6UA 3AOFA 2VL4A 3RU8X 3NQDA 3SURA 3QR3A 4OZOA 4K38A 1FCBA 1H0IA 1RLCL 2D73A 4GY7A 2W66A 4GG9A 5ABFA 4FS1A 3WFAA 2ACSA 2J9XA 2X1UA 3TSDA 4CQCA 3A23A 1GT8A 1VAHA 2E8ZA 3CTTA 3S1UA 1ZU8A 3MHFA 1DJZA 1R2SA 2V67A 1CW2A 3QM3A 2DSZA 4GC3A 3L21A 3R7MA 4GI9A 2VFEA 4IXXA 4XBSA 3ZS4A 3ZSSA 1TPH1 1Q85A 2LLEA 3RM9A 1A5LC 4QXIA 3KOYA 3SFWA 5A6JA 3MKVA 1XLIA 4V27A 4C6MA 2VXNA 2Z1VA 4BEUA 2G3FA 4XAPA 2E4TA 4GQGA 1QK2A 2NUWA 4ACZB 4I9TA 3Q65A 2I16A 3OTRA 4D6DA 3GH4A 1QPRA 4IL2A 1U5HA 2ZZ7A 1JYNA 3A9BA 2OYLA 3HA1A 4BR1A 1GOMA 3GG8A 3GLCA 4E4FA 1MZHA 5T14A 3WF0A 5F2GA 2ZOXA 4M7TA 1WYIA 3BWWA 3HIJA 4XWUA 3W72A 4IMDA 2CESA 1NDZA 3OJGA 1EJ7L 3VKBA 4IPNB 4QBXA 4RU9A 3SCOA 4C6BA 3V75A 4E8DA 3CQJA 4O3RA 1WDDA 4CU8A 2ANUA 2EAWA 2VI0A 5EGRA 1R3YA 2YZRA 4MZYA 2WNNA 2OSWA 4P61A 5REQB 5LHFA 3EOUA 3CUZA 3CT2A 3PJUA 1NARA 2XGBA 3WQOA 1C9DA 1UROA 1BXNA 3MUZ1 1RJRA 5FJOA 5FKYA 1M03A 3W7OA 1HGYA 2YW4A 1V3MA 2E6FA 5DXXA 4RNMA 1ONRA 5HANA 3B8VA 4IGHA 3W1QA 4Q4OA 4YLWA 2P3ZA 4BF7A 1XWYA 2QDDA 3UT0A 3E0FA 3GTNA 4J9SA 4AF0A 3GH7A 3P7YA 4ED2A 3I65A 5EMLA 2J77A 2UBPC 1SW0A 3RR1A 4MIMA 3ZVIA 3SUSA 1X1NA 4M80A 4PODA 2XC9A 2XM1A 4B5SA 1OWQA 3WLRA 3LXAA 1KFWA 3NTYA 5KFPA 3HPXA 2F61A 3VUPA 1E6NA 3B40A 4ORMA 2Q71A 2ASLA 4GMEA 3WNPA 3GDBA 3HTWA 3GG1A 1YPFA 4RNJA 1LL7A 4XZHA 1V79A 2YA1A 3CQKA 4AMCA 2XFFA 3WO8A 4GPNA 4LT9A 3RRXA 2WZMA 2Z2UA 3CK5A 4L1GA 3K4DA 3JR2A 3ZLHA 3CL8A 3VIOA 1XIIA 4IPLA 2CXGA 1DWJM 1LBMA 3KDOA 1KO0A 4S3AA 1UWRA 2REQA 1U22A 3PWGA 4U6PA 4LCQA 1Q6CA 5I5RA 4PULA 5JU6A 2YXXA 3UGVA 1QNPA 4TX6A 1UD3A 1A3HA 2WBGA 4S2CA 3GW3A 3RLGA 2O9PA 2ZUNA 3QHMA 5AC7A 4XD5A 5DLCA 1H7RA 1Q6EA 1LM1A 1VENA 3EX2A 4GFIA 3W9ZA 3O8AA 3MFIA 3M5ZA 3WENA 4GINA 2FGZA 1EEXA 3W6MA 1CBGA 3MV11 4TVUA 1S5WA 1SUXA 2IPGA 2X0YA 5C9ZA 3BAIA 4PB5A 2J8GA 1OGBA 4P2VA 1E9YB 5IDIA 1E71M 3PANA 5EFFA 1LORA 2A7NA 4R53A 3ENLA 2OOFA 1W5NA 1R3WA 1UR2A 2QT3A 5CLWA 2GQ8A 3GVWA 3V6JA 1N82A 4FEZA 3KHJA 4G7EB 4KEVA 3VMNA 1EX5A 2DQXA 2GJNA 4LFYA 3MWCA 1TV2A 1AODA 3WQPA 1KNWA 4IJBA 4CNUA 3G6YA 1MQPA 3WLOA 1X39A 1UP2A 3ES7A 1PHWA 3GXPA 4UQDA 2IPFA 2BXZA 2QJGA 2VZUA 2G95A 3OG3A 5KFLA 4TX8A 1WKFA 4H01A 1EQPA 1KGUA 3DFTA 3I68A 4JNYA 4DPPA 3U2OA 5J8LA 4ZB0A 2BVDA 3F2BA 3LRKA 4IR9A 2ALZA 1ME9A 3HG2A 2V68A 3O15A 4JX6A 4MZ8A 3TMLA 1EWDA 4LUTA 4JDBA 4MWAC 3G1YA 4ICNA 2GGEA 2CHRA 3FHQA 1AD1A 2WVVB 5CC6A 3H7VA 5I24A 3TONA 3QQ0A 2XVKA 4DXKA 3G6XA 5G4EA 3N4EA 3WD0A 3FNDA 1HFBA 3RJXA 2JGQA 1JIBA 1C3FA 1PYFA 2CW6A 4BZYA 2NVCA 3LI1A 1CECA 4K39A 1XLJA 4QDPA 5B7YA 2DZAA 4IPJA 4AH7A 3W7RA 3ITVA 1KFLA 3WBYA 1M41A 1NDWA 3EX4A 3GV5B 2I9EA 1JCYA 3GNOA 4GNJA 1GTEA 5T26A 3MV01 3W38A 1B9BA 3SCPA 3MI6A 5EPDA 1CENA 3PBGA 2HQAA 5KT6A 1BF2A 3KTCA 2YW3A 1OC7A 4EXAA 2NT1A 3VCNA 3VX0A 2C91A 3T2QA 3VNIA 5FJJA 4Z2HA 3GC5A 1DE6A 2GGHA 3G24A 1IIGA 1FP8A 1HKWA 3QV7A 4DUXA 3TSMA 2QCDA 1YW1A 2B4GA 4MKVA 3MI3A 2GVJA 7REQA 2VOMA 1P5BA 2YFNA 4HYVA 3C6CA 2VC7A 4HYWA 1JF6A 4WKFA 3N25A 3H23A 3SCRA 4ZZ9A 4NQ1A 1T6MA 3IVTA 4XBKA 1F3TA 1NM9A 3TUUA 3WD3A 4KCWA 3T55A 2I5QA 3TYZA 4MVAA 2Y6ZA 4WXZA 4PB3A 3KHHA 4DBDA 3JUGA 3MHGA 2O56A 1KM2A 3FOKA 3DEQA 1ZAIA 3IN5A 2XIQA 3FX4A 3HBLA 1PKMA 2Z0IA 3NZQA 4PMJA 1EB3A 2A1YA 4J1OA 1ICQA 1QI0A 1JF5A 2E9MA 1V6YA 5GJNA 1C93A 3EWYA 3NYZA 4EACA 3VZYA 3RX2A 1LRTA 3T9PA 1UPPA 2XH4A 1CLXA 3KL5A 4DZHA 1WUFA 3TQKA 1PKYA 5IRPA 3PUEA 1CXFA 4CNSA 3S5YA 1TQJA 2OLHA 4MWAA 4ZOEA 3MR3A 5LNUA 1XC4A 3MVIA 2V4RA 4LPCA 1VPXA 1AW1A 4C1NB 4RE0A 1BVWA 4BWLC 1B4EA 1OGGA 5AHIA 2A2IA 1EDTA 1K8CA 2C2DA 3VA8A 2CETA 2V69A 4JKMA 4H6RA 2VX6A 1DJGA 1XLKA 1QNQA 3R11A 1HJWA 1EDQA 1ONWA 2POTA 1G7VA 1OSEA 2GQAA 2OB3A 1SGJA 2ZTKA 1S2TA 1ZAHA 3T0DA 4IHCA 3RO8A 4Q6XA 1ISXA 3T6CA 2ZFAA 4O1DA 1XLBA 2C1IA 2HXUA 1DIEA 1ME8A 5I3KA 2JKAA 1TFVA 4GIAA 3OIXA 3NUKA 2VELA 5DG8A 1D8WA 3M46A 4DAIA 1X8FA 3URAA 4OKDA 3TN5A 2VX4A 3A5VA 3G0UA 4GGHA 2XIOA 3V0UA 3R12A 3HQPA 4CN6A 1N48A 4EANA 2PWUA 1M6JA 4AYGA 4HOZA 1HP4A 1B3OA 1RH9A 2OELA 1I1XA 1VBUA 2R91A 1HVXA 2G3MA 1XIGA 4KWVA 2XGPA 2H8XA 5CC5A 2PZ0A 4Q7BA 3LBCA 4H8UA 1KQZA 4RPPA 1W3LA 4GJJA 1RCXB 3C3NA 4G3IA 5KFOA 5KG0A 4M1RA 2NX9A 4OFCA 1K9DA 1W8GA 2FFCA 2QCNA 3SIMA 3M1ZA 2PLKA 2RHGA 2E7FA 5E6ZA 2FTPA 5KT7A 4BKNA 3LSCA 1BAGA 2DSWA 2R8WA 4B4FA 4U10A 2PF0A 3W29A 2EG8A 3VGBA 3APGA 4MJ2A 4US5A 3VOJA 2XWDA 7ODCA 1J0IA 4IGNA 4IQLA 2JK2A 4NRRA 1DE5A 5KG5A 1F5ZA 4IFKB 1GW1A 1T0OA 1DXIA 4O1BA 3W53A 3WK0A 1E5NA 1J96A 1S10A 3H26A 2OWWA 1W91A 2GVLA 3AMCA 3G8RA 1KWGA 1KFKA 3EWDA 4M19A 9CGTA 2NV2A 3WFZA 3GTXA 3QGAC 2VZVA 1NELA 3FEQA 1EJTC 5F9NA 1W37A 3TYBA 2HCVA 1F74A 2QDHA 3TLQA 2UVWA 3UXAA 3IACA 4Q8PA 4XO6A 3MMUA 3V0TA 3WQ6A 2Q8XA 4KCVA 1OM0A 2HROA 1R86A 5AYXA 3BJTA 2PTWA 1WE5A 4GQQA 3DC8A 3YPIA 3GR4A 2X7VA 1J2BA 3N2XA 4J2MA 1FCVA 2PURA 4BWLA 4HZ8A 2Z00A 2ZZ1A 3BLEA 8CGTA 3WYZA 4MNJA 2CBIA 3PK7A 3R10A 4W8AA 4U5KA 1E3XA 1SM9A 4YIWA 3MSRA 3PBMA 2FZ8A 3KTXA 2Z24A 4JFSA 5HJXA 3UYCA 5GQBA 1CXKA 3IGXA 1TPWA 5DLFA 4DL6A 3EDKA 1TTQA 4P8WA 4CQBA 3W1XA 5KEZA 4NYYA 3C2FA 3BAXA 4K8EA 3WL1A 4RZ4A 3QPEA 1XSIA 3WJYA 5MKGB 4G1KA 2HBVA 4NZJA 3H40A 1PX8A 1OGSA 1QATA 1XBYA 1U2YA 1JR1A 4J3TA 5KFEA 5FSEC 1GNXA 5H1WA 1OCQA 3AAMA 3KOWA 2V2DA 4AZCA 3NXFA 3OW1A 3MR5A 1R3VA 1JRCA 3T05A 2V0TA 4FPSA 4XSLA 3T5JA 1UC5A 1NWRA 1JG9A 4FOJA 1JPHA 3IWPA 3UA4A 4B91A 5ABFB 2WJEA 3PJWA 4JBRA 3TYDA 3HB9A 4LB4A 1F3EA 3RPDA 3H22A 5HINA 3P60A 3WDPP 2AQWA 2GK1A 3CQHA 3B4UA 4NX5A 3JVAA 5H2ZA 1EZ2A 4XAZA 1YDYA 2BLEA 5TAOA 4A22A 1JPIA 2W8LA 2VVNA 5DCEA 5HQMA 4EYHB 1KM4A 2PTZA 3CV7A 1R7OA 1JXKA 2IQDA 3FDKA 3W83A 2CWNA 3OBKA 3VUSA 4AXNA 5K4XA 2XH0A 4ERIA 1GVRA 4WOQA 4R85A 2PDCA 5BWFA 3FHAA 3VKAA 3M7WA 4F0SA 3WJXA 3KBJA 1WDSA 3N15A 3RB6A 4QJ4B 1HVQA 4WQ6A 1GKRA 4XIMA 4QG9A 4TVCA 1GOIA 2V9DA 4WEVX 1IXQA 2XG9A 1WOBA 4OVXA 3ZJ7A 1SO5A 4C90A 3OB8A 3ARZA 4YVPA 1FBAA 3GU9A 4IQEA 4F0HA 2JQXA 1TPUA 1ODZA 1XGEA 4EF8A 1RBAA 3IJ6A 3KCLA 2V30A 1L6WA 4NILA 3T0CA 3R43A 5IXEA 2CERA 2Z1KA 3HPAA 1HL9A 4IIBA 1GHRA 4R88A 5KITA 4DX3A 1ZTVA 3E3HA 4KWOA 1W3KA 2W7OA 2W27A 3W1PA 3M7SA 5K2ZA 3CLWA 5I78A 3NZRA 4S2BA 1WB0A 4GE8A 4W5UA 1J0HA 3OVQA 1PCWA 3TJ4A 2D69A 1A5MC 5A8MA 3UJSA 3GDRA 3B05A 2J66A 3CUGA 3NO5A 1GTHA 4HPGA 4AF0B 3F4NA 4W7UA 4J9RA 4DYKA 1GJPA 3SB0A 1RALA 4XZIA 2WZTA 2XN2A 3VU2A 1XL9A 1R3TA 1QPKA 4HSOA 4CNPA 3TNOA 1KKRA 2VDIA 2WCSA 4WSKA 2WSPA 2PCEA 3UERA 5D2TA 3F1QA 4H9MA 3MUXA 2FGLA 4MYXA 1FRBA 2PGFA 2MANA 4JTAA 5AVHA 2P3EA 3B8DA 5KG1A 2PBOA 3HU7A 3II1A 2V4QA 2BDQA 2REQB 1BTCA 4URIA 3SUVA 4S39A 3BMXA 2CHNA 2QJHA 2Z6IA 4YNGA 5D9NA 1K02A 4TQTA 4JQAA 4OE7A 2WWCA 1JZ5A 1FWJC 3H4BA 2WMKA 4S3FA 4WY0A 4X63A 3T2OA 5L1IA 3TU9A 3DN5A 4LV9A 3VABA 5FJUA 2EPHA 1CLKA 3BCJA 5I06A 2JKEA 2EGZA 2I9UA 2PDQA 3CB3A 3OZOA 4ZTXA 1QHOA 3PWAA 5IDZA 3G1HA 4HB7A 5AZ1A 3W4RA 3ZJ8A 3BW2A 2CLEA 1X8CA 1J0KA 1VFFA 3LCXA 3QLLA 1VJZA 1QJWA 4M1BA 4DHGA 4I7WA 1Y0EA 3L4TA 4AD3A 2FVKA 4CUCA 4MB5A 2QS8A 4WDUA 4C91A 5HQLA 3V0SA 1S9FA 5JBEA 4DN1A 4PMXA 4W89A 4JIIX 1O1HA 4D72A 2OLAA 4LRSA 1UKQA 4JAWA 2ASDA 3CQIA 1Q6FA 3M5VA 2PDFA 1K3UA 4KFNA 5HUOA 1G4SA 4JS3A 3KHGA 2VX5A 3IIVA 2AQ4A 4AX6A 2A3EA 1V6VA 5C2CA 5HAOA 1JJKA 4OBSA 3EBVA 1R2TA 3Q8PB 3T4WA 2EQDA 5IHSA 4GIYA 1CWYA 4CQDA 4J3VA 1QOXA 2B0MA 3DDMA 2Y88A 1ZSXA 1EBHA 1FH9A 3NCOA 2Y63A 2XSAA 1HP5A 1CNVA 3KTSA 5FD0A 5A5WA 3PZIA 1EPVA 2WHJA 2WMJA 4LUTB 2WZHA 3IGHX 1JUKA 3P93A 2D0FA 1VR6A 5EB8A 1Q6DA 1EOKA 1TZ9A 3VGHA 5J5DA 1XX1A 4Q22A 2OFJA 2I5IA 1ZNNA 3MC5A 4G8TA 3FEMA 3MW7A 4ZB2A 4IIGA 2QMJA 3R8RA 2NXGA 3WF2A 3O6CA 4IJCA 5D8ZA 2ZIDA 4LWWA 1ZZMA 3WQ8A 3N34A 1JNEA 3I6TA 4J9OA 3WDQA 1G5AA 2WVUA 3W2MA 3TAKA 3W7DA 3B8SA 3MP4A 5BWAA 1AW5A 3D3FA 1SZGA 1E73M 1TJ0A 5A6KA 2NSXA 3CHEA 1VH7A 2A3AA 2D22A 2KZHA 3S4TA 1P1XA 4C6IA 1K6AA 2DQWA 2INFA 3SRDA 6XIMA 1BSLA 1E6QM 4FA3A 4PMRA 4F66A 5HR6A 3MCMA 1W1TA 1A3WA 2XDFA 2YDRA 3VTRA 4GXWA 3XINA 1GQIA 2OYKA 4E4UA 1C92A 1JZ3A 3M0XA 1FWDC 3PHAA 2HDJA 3THDA 5ABHA 1XD1A 3O1NA 1N55A 2QCDB 3GDKA 1DJYA 2VEIA 2D1ZA 2V3DA 7REQB 2ACQA 4KERA 2BBFA 3AYVA 1JCTA 2XCAA 4RL3A 2DU2A 2Q01A 5IFPA 3KZPA 3BE7A 1X97A 3EOLA 4PTDA 1LG1A 1PXGA 3H55A 4YTTA 3ZSTA 2D2HA 2JEJA 3VD3A 3VGFA 1EHAA 4JKLA 5FACA 1DL3A 3U9IA 1MXGA 3E1F1 3PAJA 1Y5WA 1KD0A 3W75A 4D1IA 3VD7A 2XGIA 1E4MM 4YP3A 5CAKA 3N2OA 3MDUA 4M5PA 3KWSA 2QUTA 4ZBCA 3G3MA 5EBAA 1ONEA 4AFYA 1H61A 3OHAA 1WQ5A 3VD5A 2UY4A 5L9FA 1JI2A 4AD1A 4X9YA 4LAMA 5KINA 4M3PA 4D6HA 3HPSA 2WXDM 2IUZA 4HOWA 4PEKA 1ZBCA 3FDGA 1FWIC 1YADA 5JUMA 1F2JA 2VX7A 4ED3A 2VC9A 3LPGA 3W22A 1ECEA 5HNUA 4MWAB 3EDFA 3CQ0A 4HA3A 3PS7A 5GJPA 3WLQA 1Q6GA 2V9WA 4MGGA 5FF0A 4PUUA 3LD5A 1BQGA 3MYOA 3VVGA 2H90A 1E0TA 1YXDA 4LB3A 4C6FA 3MUAA 3BARA 2QXWA 2HS8A 4I5RA 2ZVIA 1KCLA 2E3ZA 1VEOA 4RW3A 1Z32X 3IRDA 1GEQA 5I02A 1BXBA 1W1YA 1VIWA 3GK0A 4F48A 1CXIA 4B3ZA 2X1RA 2Y85A 4FO4A 1U1JA 1J0YA 5HR7A 4ZQRA 1TPDA 3PW2A 4ZFCA 3W6YA 4UOJA 3OLIA 5H8MA 5G2WA 3VCCA 5AC5A 1DWAM 1XKYA 2HPIA 2WOQA 3PY2A 4O12A 3R4IA 4ECYA 2YL9A 1EDGA 1GQKA 1P6BA 1HKKA 1EJXC 1TWDA 3I3EA 5CSRA 3ZQ9A 1ADDA 5AVNA 1PYMA 1A5OC 4MFDA 4PL2A 1LF1A 4S3EA 5DQGA 3O9NA 2Z1SA 1OYBA 4FNPA 1KXQA 2YYTA 2F38A 4AIEA 3FAWA 1RK6A 2O9RA 5K4ZA 2FZMA 3ABZA 3C0LA 4PCTA 4RXGA 2OLSA 4N4PA 1UKOA 2HTMA 4DF1A 3N6QA 1PWMA 2R8HA 4A2RA 5KFUA 1WKYA 2PWDA 2FJUB 3ZJ6A 1A5CA 2A0NA 2BNJA 2CXEA 2ZWYA 4WKAA 1B4KA 1TTPA 4DZAA 4DZ5A 4JQ2A 1ZJAA 4EX4A 3UZXA 1HUVA 4ZMGA 4AZ5A 5DG7A 1J12A 2P0OA 1IR2A 1FA2A 2GPTA 4DPQA 3QC0A 5KFCA 4ECRA 1NDVA 3RF9A 4J3UA 3WL0A 1P0EA 4IXHA 4MB1A 2E1WA 1J6OA 1W5OA 2R6OA 3DYPA 3BPWA 4DI9A 4O18A 4GZJA 3UYIA 2XM2A 3ARPA 4LV4A 4OHQA 2VCBA 1DHPA 4B9YA 4DYEA 1VF8A 1W6TA 1E6RA 4BI7A 4HN8A 4DBUA 3DKLA 2AOSA 3DH7A 1FFRA 3M0MA 2GQ9A 4F0MA 3TCEA 4D6IA 3NL2A 2QW5A 3ARQA 2R1KA 4ERGA 4FF7A 3NPWA 4XISA 2CZEA 3M44A 3UQNA 1CIUA 2FMNA 5EYWA 3MPGA 2FZ9A 3WKZA 2VM8A 3N6HA 1EGVA 3WH7A 3STEA 3KVMA 3D3AA 2QV5A 3N3MA 1VFUA 2OZ3A 4JQ4A 1XP3A 1IT0A 4DBEA 4Y9AA 3QKEA 3GIJA 2PDXA 1POJA 4Q8WA 4LY8A 3UEQA 2GWNA 1H09A 3WK2A 2R8KA 2ASHA 2PTDA 2ZWZA 3KS5A 2IA6A 3M4HA 3TKFA 3LCHA 1J2WA 1LRNA 4J27A 1KFBA 3KRUA 3ID7A 3NAVA 4UR8A 2Y0FA 4IMGA 5CSYA 3W7KA 4L6HA 2OX4A 2WHMA 1UYQA 1V03A 3QVQA 1TJ2A 3UR8A 1XRFA 1K7EA 1JDFA 4I8YA 3L66A 1O95A 4DO5A 4HHLA 3FLUA 3PC0A 3R58A 3CIWA 3L5MA 1TO3A 3Q8SB 3T4CA 4W7WA 1UW9A 2VD8A 3T07A 3LCGA 1JYWA 4W86A 3UJ2A 3MANA 3Q37A 3VFLA 4GBUA 3WUBA 4AZCB 4X3ZA 2DIJA 4DYJA 4RX0A 2ZC1A 4AG0A 4B4HA 2GLKA 3S6TA 2NLIA 3A4WA 3CL7A 2AKMA 3VNDA 3ZWSA 2FGBA 4MB4A 2YB1A 2J25A 1GWJA 4MDPA 1FWFC 2YBTA 4QP0A 4A3HA 3AHXA 4Z17A 1W1B1 1O1ZA 2IKHA 5AC6A 2VWTA 2EF9A 4WJEA 1XUUA 1JI1A 4NAFA 3AMDA 4A8LA 1QHZA 3SSJA 4YTQA 4F2UA 4ECXA 1KWKA 3T7VA 4C6NA 5AHEA 3DUGA 3N13A 4FIQA 3N14A 2IQ0A 3W70A 5T91A 2Y5SA 3BLDA 3LB0A 3ICJA 3ABQA 2I17A 5CEWA 3N2MA 3TV8A 3P5ZA 5FF2A 2E09A 4LVFA 3WLJA 5BW6A 1GQJA 3AS1A 3WD1A 3AXMA 4GC6A 5AYIA 3DYOA 4GXMA 4GZEA 3AS3A 1KCZA 2GJXA 1QWKA 3BSMA 4M6UA 5FIPA 5FSDC 2G3JA 1YBQA 4C65A 2Y89A 1OJXA 3L7RA 3VGGA 3AHTA 2VEGA 1KBIA 3A64A 1P4CA 1EP1A 1TCDA 1JXJA 3FYPA 4EAYA 4J3ZA 3L68A 2DY3A 3PZTA 2XISA 4H00A 3SGGA 2X30A 2ISFA 3WZ0E 4KETA 3F03K 3USZA 3M43A 1K7FA 4XZMX 1FH7A 4Y96A 4WDXA 3V7PA 3P80A 5FL1A 3ZXWA 2Y61A 1DP0A 5KFDA 4K7VA 3LCLA 4LS2A 1KFEA 4KWWA 1NEYA 4GQBA 4LVAA 1RJPA 2R8IA 3KEHA 2OZ8A 2X16A 1NDYA 2QR6A 1XS2A 4R34A 3AWOA 5C0QA 1X7FA 1PCKA 5CZ0A 4UC5A 3GBDA 2INZA 4GHRA 1VFTA 1XXXA 3U57A 4JNZA 2E40A 2I5GA 5D04C 4DF2A 1ONXA 1FDJA 3CZEA 4R8UA 4GH3A 3GNNA 1N8IA 3O06A 4QITA 1XJBA 5AHNA 1L8NA 1BHGA 2V2CA 4O28A 4OGZA 4CD5A 4C7DA 4MADA 2E6AA 1EYEA 3ALFA 2J7HA 2QUNA 3W2NA 1ECQA 4AXKA 3E2SA 3BC9A 1SFSA 4S1FA 1PS9A 2AL2B 3M0HA 2J24A 2YDQA 4ZB5A 5A6SA 4PMVA 1QVBA 1SPQA 1N8FA 2HK1A 1OFPA 3JZEA 3CUIA 3SR7A 4ED0A 4IIDA 1ML1A 3S0CA 3UF9A 2I56A 3UGRA 2BR0A 1CT5A 2DT0A 2D24A 2O0TA 1PDYA 3WMCA 5E5CA 3EZ4A 2P10A 4U31A 4HTBA 4WY0B 3QN3A 4HKPA 3UCCA 1RLDA 5CCZA 3IIOA 2Q3RA 4IX0A 1NH6A 3AICA 3SCQA 4LOCA 4OQVA 4AISA 3IIPA 4MHBA 2AGKA 1SJCA 1WKEA 4O53A 1V3HA 5BU9A 1GKQA 4LY4A 4ECTA 3DFQA 1W17A 4IP7A 2MUCA 3RXZA 1OZQA 1E6ZA 2QAPA 3PPCA 2A21A 3WQVA 5DGAA 3K2GA 4PUMA 3GWQA 2Z1XA 4HPNA 4MUPA 3BLFA 3WBAA 1G69A 1NFBA 1TVLA 1ZLPA 2TPSA 2RJHA 3MZNA 3A47A 3H21A 4W5ZA 5U7SA 3ZT5A 2ZBTA 3QW4B 4HGXA 1HNYA 3ZLGA 4FIRA 1PTDA 3M0KA 4OWGA 3VIIA 4JX4A 2UV8G 4B2DA 1AQHA 1V77A 3NSMA 3ANYA 4YS1A 4LYQA 1GOXA 1VYPX 3GZ3A 1QI5A 5FCZA 2ZVRA 4RZRA 3WDRA 4NX0A 2A5HA 4PC8A 1KLYA 2FH8A 1IEQA 2PGRA 1ZPTA 1OIMA 1TWWA 3QKZA 3BANA 1EXPA 4QWCA 4AZHA 1BYBA 3SY8A 3CC1A 4O16A 2BVTA 4L4PA 2OQLA 3NQ2A 1AH4A 2OZTA 2IQTA 2CEQA 4ML4A 4ALDA 3L0GA 4FS2A 4QE4A 3VPLA 2TRSA 5KFZA 3L2LA 3WMLA 1DV7A 1UKPA 3NXLA 1RVGA 4K68A 4CN4A 4K37A 5KG7A 3TYEA 3RLHA 4HNCA 2E28A 2ZZ2A 4XZNX 4XV0A 1V3KA 3U8GA 1AJ2A 4GO9A 4UMCA 4KMQA 3RMJA 4ICCX 4R3UA 3GNPA 6PTDA 1JCMP 1MQRA 2WTFA 3W85A 4H7ZA 3FK4A 3M0LA 4F40A 3EDJA 1FXQA 3NYDA 1HL2A 3KW3A 1I75A 1RY0A 1VIZA 2GOKA 4TOQA 4WOZA 4LTSA 5GNZA 1PHQA 1S2CA 3DGRA 4Z42C 2CBVA 3TTSA 1BWVA 4CVUA 3KHLA 1SSGA 3VIPA 2J7CA 1CGXA 2ISVA 2ZZ4A 2EJ1A 2W9CB 3MWAA 2AGQA 2BHYA 3AIEA 3EWCA 3LSBA 5CC7A 3KRSA 2GVGA 2WPGA 1YDVA 5AYBA 4K1GA 1UOZA 1SR0A 3BAWA 1H41A 3B8TA 4MY1A 1GG0A 4ECQA 1O12A 4R9XA 3S2NA 2V3GA 3F2CA 1GJWA 5DANA 1XLFA 3RN6A 2ZZ3A 4O15A 3RIKA 4QRNA 2VYOA 5G2HA 4IT1A 2YCJA 4TVDA 4W4QA 1NOWA 2RDWA 3LZ5A 3N4FA 5F2IA 2OCZA 1W8SA 1UD4A 3F5JA 1OFBA 3RAQA 4GXPA 3QR0A 1T96A 4WHBA 3TROA 3N3TA 1PZ3A 3Q4DA 1OBAA 1VGAA 5KSWA 1KXHA 2VEKA 2QUVA 3KLLA 3RM8A 4PCNA 3U3HA 3K30A 1W56A 4DVOA 1OCBA 3L4ZA 4MDOA 1RR2A 3SSZA 2PF8A 3OHBA 4EK7A 2QCHA 3GVVA 4J28A 4HK5A 4X9SA 3WELA 1WX0A 1YPXA 2FQIA 5BXTA 1TPFA 3OBAA 3RB4A 3GH5A 4OOZA 4QWDA 1PZ1A 3CZLA 3WK3A 1C90A 3AIRA 2P0IA 3UA3A 3KVJA 2VD9A 1R5YA 1DWFM 2VGGA 1WBJA 3K8LA 5BROA 5IM51 2WZIA 5CJ5A 1JL8A 4GOAA 4WUIA 1W3JA 4UQ9A 4UTIA 1N7KA 4C6LA 4ZE5A 5DBUA 3SCTA 2YX0A 5AKQA 2V82A 3W02A 1WDWA 4JX5A 3R89A 2TMDA 4WKHA 4PBFA 5HATA 3Q2DA 2Q8LA 1XCWA 3IK4A 2PBGA 1F61A 4O8AA 4ADSA 2BP1A 4HMNA 3RR4A 1UC4A 5KFKA 4O3OA 2WVSA 1JZ6A 5DXYA 4IOTA 2NX3A 4RNNA 1D3GA 1HX0A 2HVMA 3PUOA 4OV9A 4OECA 3QR1A 3LENA 1SMDA 4LAZA 4GVHA 4ZXLA 4H3DA 3ARYA 2PDJA 4CD8A 1DBTA 3B9OA 3NQFA 5A1AA 3MUY1 3W1RA 3TYCA 1YE4A 1JCJA 1AUSL 3LU2A 4B3KA 2W5FA 1W1ZA 5KG4A 3Q94A 1QU4A 4AWEA 5CPOA 3R25A 4QLJA 3FA3A 4MF4A 3LZ3A 3ONBA 4JKKA 2X42A 3NQ6A 4Z0SA 1NIUA 1QDSA 2PC8A 4UCGA 3FYOA 4O52A 1UWIA 1CGYA 3LLFA 4A05A 4X2PA 2CU0A 1YXCA 3U2ZA 1TSIA 2UY3A 1XIBA 4PE8A 2EPKX 2QJNA 1VFMA 3ZM8A 3OSPA 3L4UA 4JTSA 4XBJA 3TC6A 3KRZA 1VJSA 3M0ZA 2GVEA 2FPYA 3KBMA 3GIQA 1W3TA 3G18A 4UTKA 3H24A 2YIHA 2QAFA 1LQ2A 1T7LA 3TMQA 3LHYA 2JBMA 4N6EA 3PUDA 4CVWA 1ZBWA 2VFDA 1N8WA 3TAOA 4M29A 4N7QA 2FDSA 1GKPA 5ABGA 4IISA 2PWVA 3WBXA 4EXQA 2XIMA 2QPUA 3UBPC 2VJXA 4KRUA 5LNSA 3DKJA 1QXLA 2DORA 4X61A 2GZXA 1X98A 1POKA 1QPNA 4F4ZA 2W63A 1TV7A 2YLLA 2ZYFA 5KFHA 4J7RA 4ADTA 3M9OB 4LF1A 4JQ3A 4ECUA 1OF6A 3F4CA 4ZSUA 1O5RA 4C6OA 2ZZ6A 3IJ8A 2FLNA 2V3EA 4JGDA 3QYSA 5I3FA 3W1LA 4NZ3A 4MTVA 3AHZA 3B8WA 4MJZA 2VR4A 4PYSA 1B3XA 3AMGA 4Q8EA 3PN8A 3QQWA 1J9YA 4XX6A 1B30A 5BNKA 4ZR8A 4IMEA 4C1LA 2AQOA 1YMYA 1E1EA 1IF2A 3C52A 2RDUA 2QEZA 5E0FA 3UU0A 2VTFA 2W62A 4L80A 3MSGA 4S3KA 3AZRA 3G22A 3XISA 2FLPA 3TJIA 4LNYA 1EP3A 3LHVA 2CLMA 4E38A 2X0SA