2PLMA

Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
404
structure length
404
Chain Sequence
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure-based activity prediction for an enzyme of unknown function
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
total genus 146
structure length 404
sequence length 404
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2plmA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2plmA02
2IMRA 2R1KA 1KCXA 4C6NA 1YBQA 2Q09A 4C5YA 4GY7A 4BY3A 4GY1A 2AQOA 2I9UA 3OJGA 1V77A 2P50A 4AQLA 4KESA 2R1PA 4JOMA 3GU2A 4GC3A 2ICSA 3KM8A 3RN6A 3EWDA 5HMDA 1POKA 2O4QA 3CS2A 4WGXA 4OFCA 5G4HC 4HK5A 3PBMA 4H9ZA 4LAKA 4F0RA 4LEFA 2Z4GA 1JGMA 1XWYA 1R9ZA 4L9XA 3EWCA 4LCSA 4EPEC 2EG8A 5AKQA 4H9MA 4AC7C 4NP7A 3G77A 4EPBC 2GOKA 1GKRA 2E1WA 1J6OA 2VHLA 4PBFA 4B3ZA 4DO7A 4C6QA 1O12A 2RAGA 4V1YA 4IFOA 1K6WA 4IGMA 1EJUC 4C60A 3A3XA 3S2LA 1YNYA 1E9ZB 1A5LC 4CQBA 1M65A 2BB0A 3MSRA 4KETA 4KEUA 4CNSA 3AUOA 2VR2A 1P1MA 1EJVC 1NDVA 1R9XA 3E0LA 2QS8A 2WJFA 3DC8A 3UBPC 3F4CA 4EPKA 4EPDC 4C6PA 1V4YA 2WJEA 4LH8A 3OOQA 1PO9A 4IQJA 2HPMA 1RJQA 4H00A 4QRNA 4F0SA 4DZIA 4H9TA 4CEUC 4F0LA 4XAYA 3MTWA 2Z28A 3OU8A 3NEHA 4GXWA 2OGJA 3MDWA 1ITQA 2P9BA 3ITCA 4KERA 2YB1A 2DVUA 4INFA 1V79A 3F2CA 1QXLA 3IACA 2FFIA 2Z24A 1FWCC 1ONXA 4IH3A 4IFKB 4IG2B 1FWGC 3EGJA 3E3HA 4DLFA 4GX9A 3K5XA 3MPGA 4XAFA 1NFGA 1ONWA 5HMEA 3UR5A 4CNUA 4RDZA 4IGNA 1KRAC 1P6CA 4C6MA 3URAA 4R7WA 4RDWA 2CZVA 4GYFA 1YBQB 3ORWA 3LNPA 4ZSUA 4GY0A 3ID7A 4C6DA 2R1LA 1ZZMA 1YRRA 4LAOA 5FSDC 4LAMA 3A3WA 3OQEA 4LALA 2BGNE 2HPIA 4DI9A 4R88A 4C6BA 4KF1A 3F4DA 3LY0A 4KEZA 3MKVA 4R85A 1V7AA 2ANUA 1NDWA 4CNTA 3HTWA 1FWJC 5FSEC 2OODA 1XRFA 3A4JA 2PLMA 3GG7A 3TN4A 4C6KA 4NI8A 1A5KC 4LCQA 1EJWC 2ADAA 1IE7C 4C5ZA 4LANA 1POJA 3GTHA 4RDVA 3T1GA 3RHGA 5CH9A 2OB3A 4L6DA 4C6EA 1EJRC 2VM8A 1RJRA 4G2DA 3O7UA 3F2DA 2VC7A 3TN5A 1ITUA 3SFWA 3GGMA 2PAJA 2HBXA 1UIOA 2PUZA 4DYKA 2Z27A 1EJXC 3GIQA 4MUPA 4DNMA 3UR2A 4C6JA 2FTYA 1RK6A 2KAUC 2HQAA 4IF2A 4ERGA 1J5SA 4QTGA 1A5OC 3LS9A 3BE7A 4C6FA 2Z7GA 4H9XA 4H9YA 2UZ9A 4PCNA 3QGKC 2A3LA 3IJ6A 4PCPA 4GBDA 2PGFA 2R1NA 1EZ2A 3IRSA 4ERAA 3V7PA 1W1IE 4DI8A 3URBA 4NG3A 1UBPC 3QGAC 4XAGA 2OQLA 2Z26A 3AU2A 3OVGA 1A4MA 4BJHA 1PB0A 1RJPA 1EYWA 4PBEA 1ADDA 4G7EA 3B40A 4GK8A 3S4TA 3LSBA 2VUNA 1RA5A 3URQA 1DPMA 3R0DA 1M68A 3GTXA 1GKQA 4C6LA 4H01A 1FWEC 2P53A 3E74A 3IGHX 5E5CA 4KEVA 4DIAA 2D2JA 2YB4A 4YIWA 2EG6A 1HZYA 4HK7A 3UPMA 1XRTA 4I6KA 3GIPA 4BKNA 4B90A 1FWAC 4C6OA 3O0FA 4LCRA 1V51A 2AQVA 1I0BA 1A5MC 1UIPA 4V1XA 1E9YB 4Z42C 4DZHA 3K4WA 4H9UA 4XD4A 2Z29A 3WZ0E 1UMLA 2ZC1A 3MJMA 1PSCA 3GU1A 3GUWA 1K1DA 2I5GA 3ICJA 3FEQA 1P6BA 1EJSC 4XD5A 2YZ5A 3MVIA 2OOFA 3WYZA 4IFRA 1KRBC 2HBVA 3CAKA 4WVXA 1A5NC 3DCPA 1FWBC 1PTAA 2QVNA 4J2MA 4C65A 2Q01A 3NURA 4RZBA 1VFLA 3GTFA 3IV8A 3F2BA 2AMXA 4HJWA 3SO7A 1NDZA 2W9MA 2GWNA 3ISIX 2YXOA 3GTIA 3E0FA 1GKPA 3S2JA 4I6VA 1FKWA 4B92A 1FKXA 4UBPC 3C86A 4WHBA 4HA0A 3QY8A 4RDYA 3MDUA 3N2CA 3E38A 2UBPC 1RA0A 2F6KA 1FWIC 4QROA 4RE0A 2GZXA 4ERIA 3LA4A 2EG7A 3PAOA 1M7JA 4KIRA 2DVXA 1WXZA 2Z2AA 3K2GA 1YIXA 4KQNA 3URNA 4H9VA 2DVTA 3TNBA 2GWGA 2FTWA 3TN6A 5LXXA 3GRIA 4QS5A 1EF2A 4CQDA 3IPWA 3LU2A 4C6CA 2WM1A 3T81A 2XIOA 2QT3A 2Z00A 3LGDA 3WMLA 1S3TC 4G7EB 4LFYA 4E3TA 2GSEA 2HNHA 1K70A 2Y1HA 3S2MA 4DLMA 3HM7A 1KRMA 3JZEA 1J6PA 3IARA 3E2VA 2FVMA 2D2HA 4GZ7A 3UF9A 4CEXC 3D6NA 3LSCA 4CQCA 1QW7A 1WXYA 4ZSTA 3FDKA 1I0DA 3PANA 3CJPA 2G3FA 3NQBA 4GOAA 3AU6A 2FVKA 4TQTA 4J5NA 5HMFA 1RAKA 3B0YA 4QSFA 4C6IA 3PNZA 4PE8A 2VC5A 3GU9A 1FWHC 3B0XA 1KRCC 2R1MA 3QY7A 4P5UA 1FWDC 2Z25A 2Z2BA 1YMYA 4B91A 3FDGA 2QPXA 2O4MA 1EJTC 3QY6A 4XD3A 4M51A 3TN3A 4HK6A 2D2GA 4ICMA 3T8LA 4XD6A 4XAZA 4UB9A 3DUGA 4J35A 4QS6A 4EP8C 3S2NA 1R9YA 3HPAA 1XGEA 4D8LA 5A6TC 4IFKA 2E25A 4IG2A 3PNUA 1NDYA 1FWFC 2WJDA 3LGGA 2PGRA 3MVTA 3RYSA 1RK5A 3RCMA 4GX8A 3OODA 1A4LA 1J79A 1O5RA 1BF6A
chains in the Genus database with same CATH superfamily
6PTDA 2WTFA 1CLXA 2DPIA 2ZTKA 1GQIA 1AH4A 1O7AA 1EDQA 3WH7A 1VAHA 3HQPA 3WY1A 3GXFA 1K03A 3B04A 4MPKA 4GUGA 4YR0A 1VF8A 3AIRA 2DZWA 3HV9A 2OT0A 3E96A 1OK6A 1ZPTA 2RKXA 3AS0A 4DAFA 2QCMA 4S3GA 4AVNA 3CUXA 4HNTA 5C2CA 1ZS2A 2D69A 3G77A 2WNQA 1TG7A 3W7JA 4GQRA 3MO4A 1O4UA 4HMDA 2PURA 4L61A 2HRWA 1S1RA 5HNTA 1UH3A 4IMGA 3MQTA 4C7DA 1KGXA 3NM1A 3NQEA 3EAUA 1FHUA 1J9YA 3B06A 4LS0A 1FTXA 4IPPA 4PUKA 3W75A 3QF0A 2MNRA 2E68A 4HSNA 3GC5A 4CU6A 3TH6A 2CBIA 4US5D 4EPKA 2WC4A 1CXFA 8TIMA 2VJXA 3T0DA 4X60A 3MSGA 4Z2IA 3S83A 1E6NA 4XKYA 4Z08A 3TKFA 3M0MA 4H9TA 1KKOA 3IJ7A 1CW2A 3W82A 5MF5A 2W9BA 2ZX8A 3WEMA 4JUZA 3G1DA 4W5ZA 3VI2A 3N2OA 3QQWA 5F9LA 3EWYA 4FNRA 3IACA 4XISA 3MHUA 1I45A 1WOBA 4IG2B 2YDAA 3UJFA 4DLFA 1VCGA 3REQA 1OGGA 4YCOA 1BEUA 5GJPA 5A6BA 4NQ1A 2GUUA 1B9BA 2W0UA 4QLKA 3M9NB 3TFXA 3GXIA 4LQ1A 1F4HA 2G3IA 2FHCA 3C4UA 3O2LA 3TTQA 2ZA1A 3DXIA 4LV9A 5HULA 1V7YA 3LCGA 5KG0A 3IV3A 3SADA 4C90A 1TX2A 4R9OA 1TWWA 4HMEA 1OEPA 3RB4A 3PR5B 3CUJA 3SCNA 1NDWA 1FWJC 3I65A 2OODA 3TN4A 2PLMA 1FH9A 1SGJA 1R7OA 3VIFA 3ZVHA 2V67A 4PBGA 3KVLA 3GTNA 2J7CA 2DIJA 4FX6M 5I03A 5DBUA 4YWIA 4DL7A 1UA3A 4YJ5A 1KC7A 4WDXA 4ZODA 3W1LA 4AVOA 3T78A 3NUKA 3W1RA 3LRLA 4GCAA 3GVWA 4RJEA 1WX0A 2EKGA 3UESA 1KLZA 1MXGA 4G2DA 3FJNA 1CGWA 3NNTA 4JNZA 3M5YA 1P7TB 1VBHA 1I1XA 3M43A 4JTHA 3GIQA 3H8AA 3Q37A 1H4PA 3L21A 2QIWA 3RBDA 3QFEA 3APGA 4DNHA 3MCNA 2BASA 1FHVA 4DRSA 3GD6A 4ORIA 3GR7A 2X1UA 3P80A 8A3HA 1GW1A 1W1IE 3MWCA 1GPFA 4XAGA 5KG2A 3Q67A 3O6CA 2Z26A 1V6UA 4ED8A 1A5AA 1S2WA 1EYWA 5EWFA 1L8NA 4ZCWA 4GO9A 2EKCA 5CG7A 1IXOA 3BK0A 4FR1A 3HQOA 3IIZA 4KS0A 4UNKA 4DL3A 4DIAA 1VJSA 3IJQA 4JYEA 3MW7A 1F7BA 3PBVA 1HJWA 3ANYA 5GJMA 3NA8A 2C1HA 1B4EA 3GIPA 2HE5A 3BXWA 3QMTA 1A3XA 2QJIA 1PKMA 5G5IA 4BF7A 4WY0A 4QGCA 1NSJA 4V1XA 1BFNA 4WXYA 3P2VA 2XSBA 4I5UA 1E4LA 1FDYA 2FJUB 2PDJA 1E70M 3KTXA 3R6IA 4CNNA 4S39A 3CM4A 1E56A 3V36A 4OVXA 2IUZA 4ECRA 3GVGA 1A5NC 2IKJA 4EK7A 3W76A 2YSWA 1PTAA 4J9PA 3UNDA 1WOAA 1UD3A 4YHGA 4OTKA 3F2BA 1V0LA 1JIHA 2YX0A 2Y7DA 1NDZA 5BOFA 1QI2A 2CCRA 2YXOA 4QQUA 3B8WA 3S2JA 3NM3A 3DI0A 3OBAA 3EZ4A 4FEZA 4BCEA 3DHDA 3HGJA 2YCEA 3SY5A 4HMCA 2J24A 1HIZA 1XLAA 4BF9A 1WCGA 1XG4A 2VENA 2O9OA 1W3KA 1GOKA 2Z6JA 4YXGA 2P10A 5DRIA 3SDOA 2RUSA 2GZXA 4RL3A 2ZUSA 1IT7A 4HOXA 1A0EA 1GHRA 3W2KA 1VBJA 1PDZA 3K2GA 5A8OA 4DUXA 3ZJ6A 2WKGA 3T40A 5CSSA 2W8LA 3UEQA 2JGYA 4LNCA 3S6DA 4LNYA 6ENLA 4AX6A 4U2ZA 1M7OA 2Z00A 3WD4A 3WJWA 3I7SA 1EZWA 4B5SA 4UXDA 5AHLA 4UMBA 1EC7A 2NLYA 3ARXA 3N29A 3MUIA 2R94A 4AY7A 3MP5A 4GZ7A 4NZ1A 4MB4A 1O60A 1B0IA 1YPXA 2Y7EA 4DL4A 2BLEA 3ES7A 1TQXA 3BGGA 1B90A 4LUTA 1TWZA 5KFPA 5T8GA 3VKCA 4PEEA 5GNYA 3WLIA 1S2VA 3GH5A 2R1MA 3QY7A 1DJZA 1TR1A 3B05A 4B9YA 2ZCGA 3SIZA 3VABA 6XIMA 2NV2A 1AK5A 1OYBA 1SMDA 4ICMA 2XC9A 3LDVA 4QW9A 2UY3A 1L6GA 1CCWB 4F2TA 1THFD 4JFSA 3M9YA 4X9SA 2OO0A 2YLAA 3E6EA 1Q6OA 4O3OA 5AC6A 1U83A 1UUMA 4ZQOA 1XKJA 5C9WA 4QWDA 3UGRA 4BY3A 1LORA 4KKXA 4GY1A 3UXLA 3WQ4A 4JKMA 1Y5VA 7TIMA 5CSRA 3M47A 3LGEA 3C3NA 4UTTC 1JZ7A 3BQ1A 3RX4A 3EOOA 3P5YA 4JQ2A 3H7VA 4J9RA 3KHLA 5EFFA 2QDGA 2BY0A 5AYIA 3TLLA 3GZAA 4I5RA 4HK5A 4H9ZA 4LAKA 2A3BA 1KM2A 4PMUA 3GXPA 4MDPA 3V1HA 2D2OA 1J6OA 1NOFA 4B3ZA 1E6ZA 1OX5A 2GQAA 4I7WA 4L6OA 1EJUC 1JZ8A 4CQBA 3AHXA 2Y5SA 1JXLA 3CQ0A 4X2RA 4N9EA 4ZOCA 2A7PA 1UQYA 3CLWA 2C22A 4O15A 3KBMA 4RNHA 5HQEA 4R8UA 4HD5A 4XTIA 4OBRA 1S5NA 4M5PA 4LV4A 4GFSA 2IQDA 4MGGA 3MBFA 3WDRA 3Q8PB 3GDKA 3W7MA 1OFPA 2ACUA 1WE5A 2I5IA 3M41A 2YB1A 3DG7A 3OTRA 3C0SA 1NP0A 2DSWA 5FESA 3AYRA 4GGBA 3AWOA 5I3IA 4HHHA 3QTGA 3FNDA 1GZ1A 3II1A 1V0KA 1XCWA 5AYXA 5FD0A 1SSDA 3GV5B 3W02A 2VO5A 4IIDA 2J25A 1PIGA 1NF7A 4C6MA 2CZ5A 3ORWA 2G3MA 2ATLA 4B16A 5DLGA 3FGCA 1ZBWA 2Y63A 4QE5A 2YYTA 1GOMA 3J7HA 3GR4A 2V9WA 2PDWA 3KCLA 3NPUA 1E3ZA 5DMNA 1B2YA 3NCOA 4G9PA 2ANUA 2WPGA 1AQHA 4EXBA 2G95A 5A8PA 1WDPA 2VFFA 3BVJA 2VQTA 1Q85A 4BQ3A 1ZBCA 1XBXA 4C6KA 3GIYA 3C0LA 3LZ3A 1GVYA 3CZKA 1Q2RA 2FMNA 3RU8X 3KUMA 4L6DA 1JDFA 3PFMA 2XIQA 4ZO6A 3AISA 1R2TA 4BWLC 4UTMA 2BV9A 3O7UA 4NJIA 5KZ6A 1BXNA 1D2KA 2A85A 4IX0A 4C7FA 3INPA 1RHCA 2Z27A 5TBOA 4AIEA 1G67A 3THCA 5EFDA 3DBPA 2VEIA 1S38A 2OT1A 1YHTA 2F38A 4J40A 4Z2JA 2G4FA 2VOTA 3GHRA 4C6FA 4O53A 1T5AA 1OX4B 1RBLA 4CQ9A 2QV4A 4TQRA 3GY1A 3BPWA 3ARUA 4H6QA 4MZ8A 2C18A 4Y6GA 1OX4A 4ZB0A 3K4DA 3QSTA 2NW0A 3URBA 2VZSA 3VGBA 3AU2A 3N4AA 1VB9A 3T5LA 3EB3A 2A3CA 4PBEA 1JL8A 1XLBA 4MZYA 4JPGA 1H61A 2A0NA 3D5HA 1BD0A 4H7CA 2OYKA 3U2EA 1Q4WA 1IIGA 5KMYA 4B5TA 3TFCA 1M68A 3GTXA 5FACA 2WZTA 3O16A 3HN3A 3CL8A 3NYZA 3CTLA 4JN6A 2POTA 1H7NA 4NKCA 5BMXA 4JTFA 3SSZA 3PJWA 3HURA 5CLTA 2BX7A 4F0HA 3ITLA 1WPCA 4BKNA 1EEXA 1W1VA 3HIJA 1I2OA 4UWMA 3BJFA 4ZMGA 2C71A 4FLRA 3W28A 3V35A 2PTXA 3BV7A 1KGUA 1UMLA 1AQFA 3PTKA 1SU5A 3KBWA 1FFQA 3UJ2A 1PJ9A 2VC9A 3FJ6A 4GZIA 4IFRA 1KRBC 1K8XA 5E70A 2DIEA 2ZQ0A 4W9TA 1JPHA 3ABQA 4KRZA 4UTFA 4LUSA 2OPJA 4GD0A 4AY8A 3NFUA 1S0OA 2W3ZA 5AHEA 1EWDA 4HIBA 4J9SA 1B54A 4MLJA 2P8BA 4D72A 4GI9A 1XIGA 2WSYA 2PI6A 4RDYA 1S39A 2BXZA 1QATA 1JCNA 4GVGA 2I16A 3WH8A 1HVQA 1E71M 4DWSB 5JQ9A 4LS1A 2G3NA 2JE8A 3VZZA 4Q8NA 5D9MA 1W0MA 4LY8A 4Q8PA 4H19A 4DWSA 4IPJA 2ZE3A 1H1NA 2AAAA 3PY2A 1GQLA 3EX4A 2P3EA 5LXXA 4C1LA 2I56A 3QKZA 2YDSA 1RLCL 2ZRWA 4F4RA 1WA3A 1UOZA 3HOJA 4W5UA 1JXKA 1K70A 2Y1HA 4N4QA 4CCCA 4H8UA 4JTIA 3LBOA 6A3HA 1WXYA 4PUNA 3CJPA 2RFGA 3G22A 3S9IA 4O12A 5I3KA 2PWUA 3NG3A 1ZAHA 2YDQA 2QZRA 3H4WA 1V6VA 2CESA 1EX5A 1LQ0A 3SECA 1BYAA 3BWWA 2O9TA 4RLIA 5RUBA 2WZMA 2PB1A 1RALA 2QLYA 5D4YA 3TR2A 2EXOA 3FDGA 3GNPA 2ZVRA 4QJ4B 3BICA 3CEUA 3C3UA 4XX6A 3QPYA 3OZYA 1VFFA 4KCUA 5C5YA 1R8LA 3S2NA 3W23A 1XBYA 2XGBA 4JNYA 3UCDA 4NX5A 1A5BA 1UC5A 2VGGA 3WF3A 2ZC8A 4RPQA 1Q65A 2IMRA 1VC4A 1L2QA 1ME8A 3GFYA 2Q09A 3RLHA 4GZEA 1FCBA 5EPDA 2I9UA 3OJGA 3VD7A 2BXVA 4BA0A 2J74A 3L0KA 2X09A 4GC3A 4S2BA 2HVOA 3LLXA 2WHLA 3NGJA 3VIHA 1QI3A 4ZB2A 3NJ3A 1R3VA 4WGXA 4IIBA 4W7UA 5HJYA 4FLOA 3PSWA 1QNVA 1A53A 5CAHA 2E09A 1C9WA 1QHOA 1R9ZA 1F61A 2BBFA 3IUHA 5B7ZA 5AKQA 4MJ4A 3BOFA 1QFEA 1JULA 1JPKA 5KFIA 2W27A 1SO3A 4AZCB 4IFOA 3SCWA 1YNYA 2C0AA 1GUVA 1LZOA 3QV8A 3TVAA 4A05A 2O9PA 1W31A 3E0LA 1TVLA 2QS8A 3ZLFA 3HG5A 2GOUA 4KCTA 9RUBA 4Q8TA 2I57A 4IJBA 1V4YA 3WUEA 4IRCA 4UZUA 5C2GA 1V02E 2WJEA 5LIUX 1R3TA 3OOQA 3BZJA 1PTDA 1RJQA 2UY5A 2DZUA 3LHTA 1R6WA 2WANA 3WDQA 2YCLA 4FP1A 5DLCA 2CLHA 3L4XA 1D3GA 2WV8A 1PS9A 1XRVA 3PWAA 1V79A 3QV9A 4L9ZA 5HANA 2DU2A 3DBNA 4HVXA 3AHYA 5A6KA 2ZYFA 1PTGA 3LG3A 4DJEA 4H3DA 4NRSA 2KX9A 4U10A 1RCQA 4IR1A 4K8EA 3H7RA 4QWEA 1R30A 5A94A 1GYNA 3LNPA 1DTUA 2YW4A 3S9YA 3EPOA 4LAMA 5EKYA 3WKZA 3VK5A 4M0XA 4F0KA 3GVVA 1VIWA 3RR4A 4DWSD 3N3MA 3F4DA 2VP8A 3M0VA 5JIPA 5K9DA 1VHCA 2CWXA 3MI3A 4ZE4A 2WVVB 4ZO9A 3TW9A 3T2PA 1MUCA 4E2VA 1ENUA 2DPJA 1DL3A 4IXHA 4YMZA 3STPA 2VOMA 4K37A 2FLPA 3NXLA 4FPSA 1LOQA 1DKWA 3W27A 2NVCA 1R3WA 3YPIA 4B15A 2CLOA 3QPEA 1AFSA 2B4GA 3UW6A 1DP0A 9XIAA 5I6SA 4PN2A 4DBSA 5E0FA 3W1UA 2V6AA 5HJLA 3K8KA 5CBJA 1XLGA 3CO8A 1XBVA 3QFWA 3CQIA 2J13A 1F76A 4AZ5A 4IMCA 1TE1A 1CYGA 3UGVA 3MWAA 1XLKA 1E1CB 3N11A 1E1FA 1HGYA 4XUGA 1QHZA 2DQXA 1J11A 2C8NA 2VR4A 2A3LA 1X6NA 3APYA 3HJEA 1GTEA 5H2ZA 2ASLA 3BAWA 5EU9A 3P3BA 4JV0A 2NLIA 3FS2A 5I0DA 1R2RA 3E2SA 2I17A 5HWNA 4JL2A 4GYJA 4AH7A 3T07A 4GISA 5ABTA 4WJXA 2E6YA 1HKKA 4JICA 4K38A 1QUMA 2V0TA 3LMYA 4RV3A 4TMBA 1SJBA 3M0HA 3F5KA 4OOUA 2WMHA 5DANA 1RA5A 2WSKA 3PJUA 2HXUA 2OLAA 4WQ6A 4QEEA 1GKQA 2HWGA 4ALDA 1K02A 4ICCX 3E5PA 1GOWA 2O92A 2HE8A 3W7GA 5D2YA 3GNNA 3A6OA 4OU1A 5A6MA 1N8IA 1PPIA 3O1NA 4JEJA 2ZKMX 1VBGA 1C92A 3UY7A 4W88A 5C7HA 3VDAA 1UIPA 1XLJA 1DHPA 2A6NA 4G56A 3RPTA 3UG4A 1IV8A 1PVNA 4EXAA 3MJMA 2VL4A 5BU9A 4M80A 1CWYA 3C2OA 1JYWA 1GYMA 4PB3A 4AU0A 1X98A 3Q94A 2BZNA 3DAQA 1EPXA 4F4ZA 3PZIA 4CVUA 1Q66A 6XIAA 1BQCA 4RXGA 2QUTA 4DEZA 3GNRA 3SO7A 2PLCA 2CLEA 4FNQA 2P3ZA 3EX2A 1EOMA 2A6LA 3AHTA 5J8LA 3PW0A 2JF7A 2Y7FA 5I7GA 4LBSA 1EBHA 4IP7A 2A5HA 1TTPA 4QDMA 2FZNA 1XDJA 1GW9A 3A21A 1JDCA 3E38A 3GNOA 2ZWYA 4I9MA 2NXHA 1RA0A 1M6JA 2F6KA 2PLJA 1UMYA 5D02A 1F8MA 4PRWA 2CLLA 2EHHA 1LL4A 1VFHA 5AHFA 4O13A 3BANA 4IHCA 1IIHA 4ZEPA 4UNLA 3U9IA 3TNBA 3TN6A 2XCPA 2LLEA 2FHFA 1YXYA 3PBYA 3R0KA 1H1YA 1BYDA 1WBJA 4UTIA 4OV4A 1G1YA 3WMLA 1VJIA 3MKCA 4S3CA 1G4TA 2QCHA 5G2HA 1KM3A 4LFYA 5IRPA 1KRMA 4O1FA 2PP1A 2RJGA 2DP3A 3NPVA 3S8HA 3PPHA 3CNYA 2PDGA 1T40A 3D6NA 3T0BA 1IZKA 1G4PA 4NVTA 1W17A 3HO8A 4QAIA 4PMXA 3AU6A 3LV5A 1D3HA 3GDMA 4IISA 1HT6A 1QCWA 4TQTA 3DH7A 3C0QA 3RDKA 2DT2A 4CN6A 3KRBA 1F6KA 1PHQA 1DV7A 1X1NA 3CAQA 4MVAA 4JTQA 1TV3A 1M03A 4FXFA 3W70A 1Z89A 3VM5A 2CHOA 3PF3A 3NQDA 1QRQA 3KAOA 2NUWA 2D3NA 5C55A 1WKYA 4EP8C 4O1AA 3N17A 2JKEA 1F9CA 1WDWA 4IQEA 3IK2A 1TPVA 3G3DA 1QNPA 1Q8JA 1R2SA 1HJSA 5F4XA 3LGGA 4ECYA 3D3FA 2ZRUA 2FYMA 1W9VA 2E7FA 1DEDA 4GQQA 4ADTA 2GK1A 3IVSA 2WHMA 3SI8A 3BC9A 1AJ2A 2VDHA 3OGSA 2DEPA 3FOKA 2AQOA 1JIBA 3CPRA 1QTWA 1GNXA 4ADSA 1BXBA 2ZZ4A 4KWSA 8CGTA 3GIIA 4OECA 3OBEA 3RM9A 4HSOA 3NSXA 1GEQA 3ZQ9A 2D0HA 2PDPA 2ZUUA 3AO0A 1H7PA 5C9RA 1KM6A 2Z4GA 1EQCA 3KRUA 5XIAA 3R25A 3AWNA 5D2TA 4H9MA 4AC7C 4ZFCA 2ESCA 2E1WA 3AIVA 4DO7A 1TJ2A 4C6QA 4LGXA 1RBAA 1YDVA 2Y5JA 2X30A 4IGMA 4S2CA 1JQVA 1TIMA 3MY9A 1R3RA 1HKJA 3N6JA 3LCXA 4L4LA 2PODA 1CBGA 1KCLA 5HK4A 3L4ZA 2GL5A 4AD1A 4D6HA 4D1IA 4JKKA 3QMRA 3UBPC 3W25A 1WAUA 3W7CA 2PDUA 3PFRA 3GHUA 2B81A 4LH8A 3JRKA 3GX9A 2FB2A 4BQ2A 1QK0A 2QPUA 4MAVA 4N02A 4EANA 4CEUC 3PUEA 4F0LA 5D8WA 4MKVA 3DFNA 4J2PA 2A4AA 5E0KA 1UC4A 3WIJA 2R8KA 3KWXA 4JX5A 3VNIA 1GOQA 3GH7A 3B9EA 2GDVA 2XM2A 2Q8LA 4IH3A 3KXQA 4PSPA 4GE8A 5H8MA 3MPGA 2INZA 4PTWA 1G94A 4O17A 2CKSA 4RDWA 2CZVA 3CV6A 5M5DA 2CHRA 1LUCA 1TB3A 1IQ8A 3KZSA 4GY0A 3ID7A 3USZA 2VDGA 4J9MA 1YTKA 2ZUNA 4JTTA 1WDQA 3B3DA 3H2OA 2BTMA 1AH0A 4R88A 4FLSA 5BYWA 4GQBA 4IMDA 1SQ7A 2D23A 4QWBA 2PDLA 3PK7A 4CNTA 4WX2A 4MUZA 1RPXA 4GG9A 3ZM8A 1JCMP 5EA9A 1DVJA 1C8XA 3IS4A 3SRKA 1G7VA 3OBKA 2QULA 2J62A 3LPFA 5CSYA 1JRBA 3G8EA 1TMQA 5CH9A 1DE6A 4NIRA 4IGSA 2NZLA 3NQGA 1UYQA 1MDRA 1AW1A 3G6LA 1CLVA 3AC0A 3P6LA 1ISZA 4JNMA 4ENLA 4LAZA 5BRPA 3SIMA 2VMFA 4AEOA 1TTJA 4E38A 3V0UA 1KO0A 1JF5A 3VIMA 1EFZA 1ZBKA 1JFHA 4O8AA 3TTYA 3WQGA 1XLHA 3H40A 3S1VA 1JDAA 2AGTA 8RUCA 1JUEA 1OC6A 1KR0A 2GDUA 5KITA 3N15A 1IEWA 2BGSA 3TIMA 1HKVA 3V1PA 1IEVA 4FF5A 2X1TA 4BQ5A 2AMGA 1L9WA 1ZGDA 1BYBA 1XISA 1H62A 3OVGA 1A3HA 2INEA 4FX8A 2V5JA 3NQ6A 1RJPA 2E77A 2OELA 3NZ1A 2FKPA 4W4QA 4Z2KA 2EPLX 2E9BA 3AQUA 4A2SA 1XBZA 2XFFA 3UR8A 2V4QA 2OH2A 3ABOA 4OT7A 4Q8OA 3VOHA 4O0QA 2X05A 1AW2A 1O5QA 3NSMA 2EQDA 3M46A 3BW4A 4GH3A 1U22A 3UCCA 5A6JA 4U33A 5C9UA 3UG3A 2CITA 1ALDA 4UTUA 4GLEA 1IXNA 5C6MA 2IKIA 3GU1A 5AVNA 1VJZA 1YQ2A 2I5GA 1BVNP 4ED1A 2HK1A 5HWMA 5HQMA 2FPTA 1PZ2A 1ZY9A 1FX6A 1CGXA 2WQPA 1LLZA 5DG8A 4GYPC 2J8FA 2PWVA 3HQNA 1N55A 1B3OA 3LHYA 3VUPA 4RZBA 3OHIA 4D6GA 1UKSA 3ELFA 4PUEA 1MNSA 1GKPA 1H11A 1D8CA 5M17A 2CHNA 1TX0A 3VYLA 4ECWA 3M64A 1WYIA 3NZPA 3QY8A 4HZ8A 4B5VA 3U7BA 3QLDA 2H3BA 4G1KA 5F9NA 3SJNA 1OT1A 3N2CA 4NYYA 3VXGA 3TC3A 2BY3A 3AZSA 2G0WA 4TXEA 2G8ZA 1JZ5A 1M04A 2XWDA 3BLOA 4NILA 3WSUA 2DVTA 3THAA 3ONBA 2HISA 1GK8A 4QS5A 2FZ9A 1H7WA 1GTHA 3BQ0A 2BVDA 1LQ2A 3CUHA 3KL5A 1VBUA 2JK2A 1K7XA 1P0EA 3CQJA 3P8JA 3AS2A 1AJZA 5U7SA 1QI4A 3N2MA 1XYAA 4PTNA 3TE9A 1B3XA 3WCZA 4ZSTA 1H7RA 4C91A 1UP2A 2PRHA 4DJDA 3RJXA 3PAJA 4UR8A 4J9LA 3GUGA 3MUZ1 3P0WA 2C2DA 2XIBA 1CB2A 3L2LA 3W00A 3R89A 3AIEA 2VEGA 2VC5A 1LG2A 1JR1A 2BHYA 1KRCC 5FEWA 3SY1A 4H83A 2FMOA 1UH2A 3M0IA 5I06A 4X63A 1AJ0A 4M51A 3OA5A 4PCFA 4FNSA 1OY0A 4Y8FA 1E4NA 4CLMA 3QBUA 2VTFA 3SUSA 1BYCA 2OZ8A 1CGVA 1FP8A 4W7VA 1JEZA 6REQB 1WKDA 3W87A 3KS5A 4HNCA 5KFMA 3KCJA 1W1B1 1NAL1 3F5LA 5U4NA 2W8KA 4DXXA 1EKOA 3AALA 3LMZA 1D8WA 1YADA 3DERA 4XQ6A 4AC1X 3GXNA 3T0AA 1E0UA 3VIGA 2ZDSA 3EWDA 4D6DA 3CS2A 3PZOA 1L6SA 3PBMA 1TTQA 2XCAA 1RY8A 4P61A 3GXMA 5IDIA 4LCSA 4NNBA 4MLRA 2BQ3A 3PZPA 2FPVA 2F6UA 4HYVA 3F03K 3GH4A 4D6CA 2W91A 4PBFA 5HNNA 2JALA 1LRNA 1WKEA 4JTCA 3RPDA 4W84A 1SO4A 4RV8A 3AXIA 3DU0A 4GIEA 3M07A 2FTPA 1U30A 2XH0A 3F5JA 3PBWA 2PU1A 3GHSA 2C2EA 4S23A 4C1KA 2GQ3A 4MADA 1I2PA 1ZRQA 3VOIA 5JBDA 5LGZA 2FVLA 4FS9A 4Q6JA 4YR2A 4DBEA 1KXHA 3ZJKA 1KBIA 1KKRA 2WC7A 2X0SA 5DG7A 5KSWA 5EYWA 3TAOA 1IF2A 4IQJA 1UD4A 4HSHA 4EWJA 4JFTA 1FH7A 1XG3A 5IHRA 1H3GA 4HA4A 4EYIB 4MB3A 2UVRA 4D8AA 3RR1A 3KBNA 3QTPA 2X40A 5T91A 3EPGA 1WZLA 4X0VA 1EQPA 2BG5A 3A5FA 5BRBA 5HWJA 2J27A 4AD4A 1QXLA 2H90A 4GIAA 2OEKA 3SUUA 3WJSA 3ARWA 4QJ5B 2NT1A 3B4YA 4RCXA 3EGJA 2DZPA 4GX9A 1QPRA 3KFTA 3ABSA 1FWWA 3QYSA 2INFA 4LVFA 2ZWZA 3T5HA 3CIVA 2E6AA 2RDTA 3OA3A 3B8VA 3TW6A 2DY3A 4Q43A 2HPIA 1B5TA 1K4HA 3B8SA 5EMMA 4GI6A 4XK2A 2PSNA 1H60A 1UROA 2QW5A 1R85A 1XQKA 4CD5A 2VX4A 3C56A 4I5XA 3DKLA 3N04A 3TYAA 4KWVA 5TNVA 3S2CA 1DJQA 2CZEA 4R34A 3BUVA 3GWQA 3LXAA 4E4UA 7REQA 5I02A 3BAXA 3EOLA 1JYXA 1JF6A 5LIKX 4FIQA 4LBUA 1EP2A 2QEZA 3BCFA 4HU4A 1AQMA 5K2ZA 5JIWA 1NY1A 3ARVA 3VMPA 3W7QA 1CECA 3N2BA 3PTDA 4P2VA 3LM3A 5BWAA 1XD0A 3SM0A 4MUPA 1XLEA 2R6OA 3H12A 1XIBA 5B7YA 1RK6A 3O6AA 3MJYA 2RH9A 4KWWA 3L4WA 2OWCA 2C14A 5CJNA 2D3LA 4O19A 4WEVX 2HXTA 4Y9OA 3R1ZA 3M0XA 1HW6A 2FFCA 2WVTA 1MW3A 3S6TA 3WNLA 1UR9A 3MR3A 4I9JA 4AFYA 3CXOA 4H41A 1CGUA 1T7LA 4UQBA 3LI1A 2V82A 1IT0A 3WELA 1A80A 2MANA 4U28A 3WMSA 5E9AA 4WZHA 3V5OA 3LHVA 1OHLA 4RZRA 3NQ7A 3K13A 3CUZA 3U4FA 4F48A 2D2JA 1OM0A 5FEXA 4HP5A 1AD4A 3QGVA 3L2IA 4BFAA 4A3UA 3ANUA 2JKPA 3UPBA 4J9QA 3MUAA 4O1DA 3A4AA 3NO5A 1V51A 1I0BA 4DM1A 1NWUA 1S0MA 4OQVA 1VR6A 7PTDA 4IJCA 3PJXA 4A8RA 2YA2A 1OD0A 3WZ0E 2A2IA 1PSCA 3GUWA 3JVAA 4LVGA 4H7ZA 4FHAA 2DZXA 5CZTA 3VDHA 3SGUA 1S46A 3WQVA 2BSLA 3L12A 1EP1A 3VMNA 3DGRA 4C65A 3LHWA 5SWUA 1XDMA 2AMXA 2F9RA 2VGFA 2VQUA 5HATA 1SW7A 5XINA 4K7VA 1V02A 2PDYA 2YJQA 4CD4A 5HPCA 2I14A 2NQ5A 4WHBA 5DY2A 1UJQA 3EXRA 1Z32X 3DFOA 5F4WA 2PDIA 3FK4A 4IIHA 5LYRA 1B3ZA 4B5XA 4H6KA 2G3JA 1MRAA 2FGBA 4QHRA 1UR8A 4ERIA 4O10A 5EMYA 2C3ZA 2Y0FA 1M7JA 1Q3NA 2Z2AA 1J2BA 3W7HA 4HZMA 3CV7A 3C8NA 1QNQA 3LPPA 2PDFA 2E40A 2A1YA 3KWSA 4YS1A 1PWLA 4NF7A 3ABZA 4AYGA 2BS9A 1A47A 1S5MA 4V2XA 1U5HA 4IRDA 4JYFA 3CYJA 4DF0A 3FA4A 4XWUA 1OZMA 2DORA 1I6NA 4L1GA 4QXIA 3FCPA 5F2MA 3N9RA 5A8GA 3LSCA 1QW7A 4GGHA 1I8JA 2YL5A 3LPOA 3E49A 2FVKA 3MSDA 3MZNA 4J5NA 3DYPA 4QQ3A 2GUBA 2E6DA 4MDOA 1OCNA 4H8NA 2BY1A 1XJBA 3FAXA 3BGJA 1BWKA 3M0ZA 3TOPA 3VKAA 1JNEA 3EDFA 3TTEA 4O3SA 3I3EA 4Q7IA 2XU2A 2AQ4A 1MVYA 2FIQA 3S1GA 4LVBA 2XVGA 1V03A 4EIVA 5DGBA 2XIIA 1OCQA 1K8ZA 3NQCA 1RQHA 2QAPA 3PS7A 1VCVA 4GX8A 3PPFA 3SY8A 3CZJA 3VKJA 3IJLA 2ZX6A 2CIPA 1VD6A 2D1ZA 2ICSA 1U33A 5HMDA 1K1QA 1ZP4A 3MS8A 7ENLA 2ZRZA 3PZGA 5C9XA 1O6IA 3A4WA 3FX4A 1VGAA 3WH6A 3E02A 4QBXA 3PR4A 2DZTA 3BMWA 2D73A 3PJTA 3BG5A 3EWZA 4E4PA 5DMLA 2VHLA 2OG9A 3KOXA 3FSUA 3AIUA 5AHIA 2ZZ5A 3W72A 5G4WA 4ACZA 4GUFA 5MKGB 4NU7A 4DUWA 1JX4A 3TC6A 2NUYA 1BPLB 2ZXBA 2OGYA 4HHPA 3WDIA 1ECEA 1V0NA 1OJXA 4S3EA 2Y62A 1JYVA 4REQB 4W93A 4UQCA 3RG6A 5HPOA 2V4RA 3GXTA 2P76A 3W26A 1T8QA 3SW6A 1VFUA 3WK3A 5CC6A 1CT5A 3GV7B 3MUY1 2VX7A 5FJOA 5DT5A 1BHGA 3H2EA 3HZ3A 1QAPA 3GV8B 1FCQA 4F0SA 2HEJA 3PZQA 4DJEC 2ABBA 1S97A 3EOEA 3GC4A 3MTWA 3OU8A 5C71A 1I9CB 4GXWA 1FCVA 1BF2A 2ZZ7A 1UZDA 3SURA 3F2CA 1W2VA 2EAWA 2C91A 4MG4A 5G2IA 2VRJA 3RAXA 1SFLA 4M24A 1XD1A 2Z24A 1SJCA 4GYKA 1MRQA 5KTLA 4IFKB 4U5KA 4WD0A 1O94A 2QAFA 4PMQA 1XIEA 3VNMA 1LP6A 1R38A 3GYEA 4F66A 5HMEA 3UR5A 2BXYA 4DY1A 4AZGA 4MYXA 4JIQA 2VYOA 1VYPX 1TRIA 3DI1A 4NSBA 4M6VA 1XLDA 1GG1A 4LVDA 4XVDA 2BGNE 4YVPA 4UTHA 4QP0A 3I68A 2FZBA 5AOUA 4PUWA 4RNJA 1H1ZA 5EMLA 1W3HA 1OC7A 4RE2A 5FSEC 1RH9A 2ZBTA 1JFXA 4RW3A 4ZQCA 3OHBA 4XG1A 1LCOA 1FQ0A 1TSIA 1JD9A 5L1JA 1H51A 2XZ7A 2TRSA 4C6EA 4CCDA 4AHPA 2D0FA 5DFAA 3MC5A 3QPZA 3K4AA 5IM51 4AIBA 2AL1A 4XSMA 1C7TA 2XH7A 5BXPA 1KM0A 5J04A 5EWGA 4DWDA 3UJEA 1V3IA 3A47A 4I7UA 1NH6A 5AYZA 5EWEA 1VLWA 1JDEA 5KT3A 3W7DA 2UZ9A 3IAQA 3K1DA 1E1EA 5M3WA 3B8TA 3TYBA 2NT0A 1E4IA 5E09A 3JW7A 5CJMA 4GC4A 4JTDA 3D0CA 2QJNA 5DMMA 1X8CA 3LSBA 3KCOA 3URQA 1D9EA 4KFNA 5D9NA 4AWEA 5JBEA 5L1LA 1FVPA 4O1EA 5E5CA 3NEVA 3T2QA 4UOZA 4YIWA 1XXXA 3QZ6A 1BWVA 3C52A 5KFTA 1MSSA 3B9DA 3WMCA 4UOJA 1VRDA 3T44A 3WFLA 5M1TA 2PGEA 1DJNA 1ISVA 4GIRA 1OFDA 2QJHA 3HV8A 3ICJA 4L56A 4FLQA 5I79A 1NTHA 3PC0A 4GNVA 1Q45A 4S3JA 2QMKA 3WF1A 1SPQA 3W85A 4FS2A 1ZENA 3AAMA 3VZYA 4ZOAA 3DFPA 2RJHA 2R14A 5E1QA 5DY3A 3GG1A 2ASJA 3DIPA 3GTFA 4O4VA 2HJPA 1LWHA 1A3WA 1T6MA 3BLKA 5KEZA 3GVQA 4TV6A 1OYCA 2R24A 1V6XA 3S3GA 4B92A 4Y96A 4PC8A 2ZRXA 1BG4A 5IFTA 3UJSA 2VFIA 3KVKA 4DO5A 1ZAJA 3SCPA 2QCNA 1P6WA 3VOJA 3WUFA 3BO9A 1ME9A 3AUJA 3HGRA 4YTSA 5LZLA 4W87A 1LRTA 1MEWA 2J9XA 5A6SA 1R87A 2BODX 4DJFA 4NXKA 2ZX7A 2GWGA 3KHHA 3MFHA 4CQDA 2NX9A 4I8YA 1B1YA 1X6LA 1L6WA 2D20A 4MAZA 4OKDA 3LK6A 3A5VA 4A35A 1W91A 2XDFA 2EGZA 3PSVA 2NV1A 5IFPA 3LYEA 2C6QA 2VEMA 4O54A 3THDA 3PZUA 3LERA 4IPIA 2YDRA 4ATLA 3KE0A 3M9MB 1V3JA 4RE3A 3GZ3A 3NL3A 5BU6A 4RNMA 2EPHA 4F2UA 4GOAA 5CPOA 2W5FA 3L5AA 1X97A 2Y2WA 1X8FA 1W6TA 1KGWA 3PNZA 5LA2A 3VD5A 3VKBA 4JY8A 3VAVA 2R82A 1OABA 1QT1A 3RX3A 1JZ6A 3NTYA 2UVWA 2GYIA 2X41A 3TN3A 2CYGA 3V0TA 4XAZA 2NQJA 2WXDM 4QS6A 3HPAA 2NQZA 3CV1A 4D8LA 2P1FA 3U3HA 1ZJHA 1P5BA 1VPYA 3SCTA 1NWTA 2PGRA 3MVTA 1E6SM 2WOQA 3T6CA 4ZB5A 1BF6A 3IWPA 3GAYA 2FPYA 2PDHA 5D03A 3TC7A 1QNOA 4JDYA 3T05A 1TPEA 3V6KA 4O14A 4KESA 2OLHA 1Z42A 1WUFA 2DSKA 3KHRA 1ZNNA 5HDRA 2DUXA 4LF1A 2IKHA 2ZVIA 4Q32A 3G0XA 2GSJA 1YXCA 2V8ZA 2G5WA 1BTCA 3VA8A 4E2DA 1EXPA 1VENA 4NYUA 3XINA 2OEJA 4EPBC 4AWUA 3VFCA 3UWVA 3FHQA 5E9XA 4WJ8A 2PBOA 3ZR4A 3N4EA 2VR2A 1TWIA 5K9XA 2NXIA 4G5DA 1RY0A 1K9EA 3AMGA 5KG7A 2VRKA 2WJFA 5H8UA 3F4CA 3M1ZA 4E2BA 1S3HA 1REQB 1R7AA 3OVQA 4Y9NA 4LSBA 3K30A 4A29A 2R9RA 5A95A 1VFOA 2VD8A 1EGMA 4HYKA 3AI0A 3W1XA 2E1DA 2XGZA 3GC2A 5H91A 4XAYA 3MMUA 4CCEA 3E0WA 3R8HA 3IUIA 1BRLA 2P9BA 3MMTA 3G8RA 1MEIA 5JH2A 2WK2A 3W71A 2DZVA 3S47A 2PDQA 3G6XA 4Q8VA 4F9DA 2VR5A 4Q8UA 5ECVA 5G4EA 2H9AA 4XAFA 1UKQA 3N3TA 5D2WA 1EA0A 5DRCA 1B3YA 4US5A 3HB9A 3TROA 1YBQB 4M1RA 4ONVA 3RITA 3WEZA 3KW3A 4KMQA 1QASA 1YRRA 3SUTA 3VTRA 1SW0A 3PB2A 1XFBA 3HQ1A 3TOYA 1I2QA 3R2GA 3EMQA 3HPFA 1A49A 1KQYA 4M7SA 4GKTA 2YFNA 3STFA 3EA2A 1XIDA 2QNEA 3COTA 4G8TA 2FZ8A 3A4JA 3GG7A 2ACQA 3EKZA 9CGTA 4JCMA 4D6JA 3TNOA 3EB4A 3TWAA 3WQCA 2Z7KA 3M0JA 5FJUA 4ZTYA 2JKAA 1TPDA 4JTEA 4LRTA 1HUVA 1J0ZA 5D04C 4IR9A 4GMEA 1Q6CA 3U7VA 5EBUA 1EJRC 2DW6A 4LX4A 4OUEA 3RJYA 1U1HA 3W83A 4Q4MA 3TN5A 4QFUA 1V3MA 4N42A 5KETA 4NXSA 3UY8A 2PUZA 3G6YA 4FK9A 3V6HA 1AL7A 3A22A 2FTYA 4C6JA 1T0OA 2J9YA 3H24A 3VKKA 2WMIA 2HNEA 3W7RA 3LS9A 1NM9A 1OFBA 3GW3A 3VIIA 3VGHA 2DT3A 3PR2A 4JBRA 4O11A 2CW6A 5KFAA 5BW6A 4ERAA 3V7PA 3WQDA 2V3EA 4DUOA 4LUJA 3WQ8A 2J75A 3V5CA 2CXEA 5HJXA 2AKZA 1KFCA 4BJHA 1JZ3A 2YOCA 2X2GA 2VZVA 4HT3A 4B3KA 4DO4A 1JGIA 3G1YA 3H23A 2OCZA 2DT0A 3RB0A 2O9RA 3IGHX 4UFMA 5CPMA 2CFFA 4HCHA 1UPPA 1MQPA 1HXJA 3OLIA 4R7OA 1B9ZA 1XP3A 1HJXA 4Q8MA 4RU9A 4UQEA 2AQVA 2NWSA 3EDJA 4ILSA 2ZDRA 1W37A 3UPWA 1UWTA 3W29A 4Z0JA 2FDMA 3NL6A 1PKLA 1YDYA 3TLQA 4G3IA 2OOFA 4EAYA 1W9BM 3CZGA 4KWOA 2DJXA 3QC0A 1J4EA 3CZLA 3WUBA 4P7NA 2CZDA 2GPTA 3AS3A 4HA3A 4P8VA 1TZZA 2ZADA 2WCAA 3TTSA 3WF0A 2ZTJA 2P8CA 1E73M 4MMWA 5I23A 4ML9A 3T2OA 2GVYA 4YWSA 4YL2A 3QR3A 1KBLA 1QK2A 3CHDA 4J3UA 1EGVA 3BURA 4TVDA 4S3FA 3UU0A 3HU7A 3SN0A 3WBXA 2VURA 1K6AA 1EYEA 3C0JA 2Y85A 2IXUA 3DG6A 4K1GA 4O3QA 1HX0A 1Y8BA 4P7LA 5KZEA 2DZAA 1J0IA 4KIRA 2DVXA 1TJRA 4MFEA 3L5LA 3VE9A 3VDCA 2H8XA 3IGSA 4NZFA 4DJDC 1PE1A 1QO2A 3EB2A 2J6TA 1VPXA 2RGMA 4KRUA 3N25A 4U3CA 3RO8A 1RQEA 3VM7A 4NAEB 3L23A 4J3XA 2XUCA 1UUOA 3JZEA 5L6UA 3ENLA 4DVOA 2PDXA 2FVMA 1QVBA 1C8YA 3KTCA 1NU5A 2CXGA 8XIMA 3NQ2A 3SRFA 2C19A 2E3ZA 3KX6A 2ZRYA 3QR1A 4WRHA 1JZ2A 5AC8A 2YXGA 1GQJA 4GUIA 4JIPA 3HG4A 1TJ1A 1AG1O 1YMYA 1Q5MA 1YPFA 1M53A 2NSOA 2QCGA 3U8GA 4XD3A 2FJKA 5KFOA 3WLMA 4XD6A 4POCA 4UB9A 3B9OA 1HN1A 3R94A 4DQWA 4IG2A 5DXXA 3S1XA 4OHQA 3WL0A 3BMVA 2QGYA 2Z1XA 3LM7A 1D7KA 3RCMA 3ARTA 3OODA 3LXCA 3WF4A 3I6EA 3U2CA 1QI0A 2VKZG 2ATMA 3DG3A 3BCDA 1ZBVA 3TJXA 5IOBA 3DOPA 1PBGA 5TIMA 1VLIA 2P50A 2AQWA 2WYSA 1J96A 5BOEA 4OE7A 4QDWA 1X7FA 3H21A 5E6ZA 1Z3NA 4ROQA 4RE4A 3RN6A 2Y88A 1E51A 4H8HA 2YA0A 1Q6GA 5CXPA 1K9TA 5TQLA 3TTOA 3T4WA 2PD9A 4ORMA 3O15A 1IYXA 1N8FA 1IZJA 1XL9A 4YU1A 3T0CA 1F8IA 1WDRA 3N2XA 4GFIA 1ADSA 3V75A 3L66A 4Y9AA 1OFOA 4QNWA 3TA6A 1K6WA 4C60A 3VGEA 1QOXA 2YCKX 3BMXA 2YA1A 2PBGA 1LBMA 2ABAA 2IS7A 5DCDA 3TMLA 1RCOB 2VFHA 4UUIA 1P7TA 3WUGA 4D2JA 1EJVC 1R9XA 2IA6A 2YBUA 2TODA 2C15A 1S2UA 1U5JA 2VZOA 1YXDA 3P81A 4C6PA 4MKSA 1XDLA 3OIHA 4PUDA 5DX7A 3V5FA 1DWFM 3W7EA 3O63A 3G1HA 4F9JA 4HNNA 2O7QA 3OHMB 4FAMA 2WW5A 2F8QA 1BKSA 1TPH1 4G6CA 4F4WA 4Q8QA 3AYTA 3ITCA 4EEYA 1EPVA 5FF0A 3K1GA 3ZT6A 4ECSA 3EMCA 2EJAA 1CZ1A 4DEFA 1FWGC 1UHVA 5CPLA 4IGNA 3WNMA 1JZ4A 3FDSA 3TW7A 4L5ZA 3QW3A 3DHPA 4HOWA 3C6CA 4DELA 1JCTA 1ZZMA 4DL5A 1LWJA 3PZNA 3TU9A 3RBEA 3GB6A 3QSRA 4UC5A 1DBTA 1LG1A 1CLKA 2V5CA 4J9OA 4JTUA 1XLMA 4TTUA 3KTSA 1TMLA 3BL3A 1W9UA 4R85A 4FNPA 3K8LA 1ZLPA 1FXPA 3DHFA 2B7NA 4M1BA 4IWWA 1EIXA 1P0BA 2AU0A 2X7WA 1P43A 1HJVA 3G1XA 4HZ6A 2PLKA 5KFEA 3T1GA 4R27A 4GUHA 3QOMA 4ZBCA 3RHGA 4PMYA 3SI9A 3MI2A 2PRMA 3W1PA 1OINA 3WMBA 5A8NA 1OWQA 4LYPA 1KLYA 1OB0A 2J7HA 3VD9A 1YTEA 3LRMA 2VC7A 2J4GA 1M41A 3SGGA 1KQZA 3ECQA 4PRTA 3CIWA 1PZ0A 4L4MA 3AHZA 3CAVA 1EBGA 1WB0A 3AIBA 3WLNA 1LJYA 2Y8UA 3ZIZA 3HPXA 3QHNA 3HG2A 5HAOA 3MZ2A 3JU2A 3R11A 4H9YA 1QDSA 4CNOA 3HGSA 3EOUA 4OGZA 2D22A 3NO1A 1MW1A 1MYRA 1AA1B 2IW0A 3C2YA 2FLIA 1YE6A 4EBDA 1BSIA 3BLPX 2J7EA 3BSHA 2GVGA 3L4VA 1IWPA 1MQRA 1XUZA 3OVPA 4B2DD 2ZXDA 5FJJA 2VUNA 2HDJA 4Q44A 3W2MA 2WHKA 5LGXA 4C6LA 3B8DA 3NZRA 2HZGA 3EOSA 5LNVA 3ARQA 1ZFJA 4JR5A 3QQ0A 4UTWC 1SR9A 1YX1A 1KM1A 2CLMA 3U48A 3G18A 4ZR8A 1JNDA 4B90A 5KG1A 5KFHA 1PAMA 1QHPA 3B8UA 4Z42C 4OBTA 5JBFA 1MI3A 1UKTA 2FLLA 6ALDA 1JCXA 3L2MA 2ZC1A 2Z1VA 3TP4A 3VIOA 2DQWA 3SN1A 4PFHA 1TJPA 3FAWA 1US0A 1FY6A 4GVIA 1B3WA 2ZIDA 2DDXA 5FF3A 2OMAA 4Y7EA 3GVRA 1RD5A 3PTMA 1XF0A 1WZAA 5DELA 3QC3A 4M56A 3OW1A 2NSXA 4HYRA 3NQ8A 1O1HA 4V15A 4MM1A 1JUKA 1UPMB 3UCQA 1XYLA 2WLZA 1TMHA 1S10A 2CNCA 4GRSA 1XIJA 4I7VA 4NUWA 3ITXA 1U1JA 1XGZA 3I7RA 3UWEA 3STCA 1FWIC 2WSRA 1HKWA 1J0KA 2GJNA 3PAOA 2ZRVA 1PYMA 4H2HA 2QUUA 3NGFA 4UR7A 1G9HA 3H4BA 4ECVA 2GJLA 3URNA 4TQSA 4M8UA 3SFKA 3GRIA 8XIAA 1TA3B 2QPSA 2PDMA 3BCJA 4IQDA 4G7EB 2XH2A 3LQGA 4S3KA 2V5BA 2GGEA 3DFYA 1NF0A 3RMJA 2WWCA 3S2MA 3NPWA 5EL1A 1A50A 2BGQA 3FYOA 1SJAA 1ISWA 2BVWA 4CQCA 3PANA 1NOUA 1EO5A 4JAWA 3ZXWA 1ADOA 3F4VA 4R53A 2BOFX 2VA2A 4CVWA 4ECZA 1I1WA 3ZSSA 3MP3A 1CI1A 1E43A 3UZ5A 3CHEA 5I00A 1XICA 2CLFA 3MV11 4Z1AA 4GXPA 2HCVA 1JRCA 3H2FA 4A6GA 1VCFA 3BOLA 3WDPP 1Q6FA 4J35A 2J7FA 5ABFB 3RCNA 4HNUA 4UFJA 2E25A 1IHIA 4MWAB 3RYSA 3W6YA 3GIMA 2QDHA 4U31A 3AIWA 2Z1KA 4FOKA 1O5RA 5KFGA 4K68A 4XBJA 3NYDA 4C1NB 4F4YA 2Y89A 3EEZA 2Q3RA 2V68A 3O8AA 2I9EA 2J8GA 4QG9A 3VUSA 5D2XA 7A3HA 3BG9A 4JX6A 4NJGA 4F0RA 2B7PA 1NFPA 4WK9A 1JGMA 1L6FA 1C9DA 2CWNA 4L9XA 3P84A 4O3RA 2AKMA 2WMGA 1UZ1A 5HA7A 1ISXA 4O8RA 1N56A 1TZ7A 4AB4A 5AN7A 3UG5A 1OIFA 2J66A 3H26A 1NVMA 3TWBA 5FF4A 3GDRA 3RX2A 2ATSA 5I3JA 3S2LA 2UY2A 4DL2A 4A3QA 4CQAA 3RRXA 5LA0A 2V5DA 4UZSA 1P1MA 4P8XA 2YIHA 2ZZ2A 2W61A 4AMAA 3VNJA 5DGAA 4N9CA 5FKYA 5GPRA 4KFPA 2OYMA 1E0XA 4GVHA 4Q3MA 2ALDA 4EBEA 3BJSA 2OZTA 3LHUA 6TAAA 3W37A 4IL2A 3W7NA 5H8PA 4YR3A 3BV4A 4WDWA 3KLLA 3L9CA 3B97A 3EWUA 1GOOA 1XCXA 3WLJA 5KFDA 4GNKB 4ECQA 1J0JA 1OF6A 4JTJA 2ZE0A 4S3AA 4A8IA 3BAJA 4LPCA 4Q4SA 3GR8A 3PZ9A 3DX5A 5FJIA 4GC7A 4GYFA 4ES4A 5KG5A 1PIFA 3NQMA 4MWAC 2RDXA 1V3LA 2JIEA 5D38A 3R13A 4HN8A 1EX1A 3IK4A 1JJKA 4LALA 1T96A 1SZRA 3BZGA 4N2YA 2NV9A 2JQXA 4DM2A 4F8XA 4X2PA 3ZWTA 3VDBA 1BGGA 3WD1A 1UH4A 1V7AA 2WCSA 3OPSA 1XRFA 5FJPA 1XS2A 3MCOA 1QI5A 4Q33A 1PWMA 1Y7VA 1GPWA 4QE1A 1IEXA 1W8GA 1J2WA 3NOYA 5KT7A 7TAAA 1NQKA 1ZALA 4GJJA 4IMFA 3GKAA 4FIRA 4TVCA 2VA3A 5L1KA 3G1VA 3HPSA 5GNXA 3PB0A 4FR6A 2YKKA 4TU1A 1J10A 1ITUA 4AXNA 3OGVA 3CB3A 3WBAA 3SCOA 3WLRA 2HBXA 3IAPA 5DEZA 1P4CA 4MJZA 3WD0A 2QCDB 3UVIA 3C61A 3SUWA 4IF2A 1VFTA 4H6EA 1YKWA 3BE7A 3T42A 2NQLA 4RKAA 2VNCA 5HQLA 3TQ0A 3QGKC 3UD6A 4KW2A 3IUDA 3VOGA 1VYRA 1AW5A 1JXJA 1SJDA 2XVLA 1UBPC 4DXVA 3TXZA 2ZUWA 4H8VA 3ZOAA 1JCYA 1EO7A 1R5YA 4K36A 4ECUA 2YL9A 1W9DM 5LXEA 4MWAD 3VNLA 1WDDA 4EWND 1E0TA 3NXFA 5D9PA 1ZP3A 1ELSA 3OZOA 1B57A 3M4HA 1FWAC 1QW9A 1MEHA 2QF7A 1W5MA 2ALZA 3IIVA 4CD7A 3E1F1 4HU0A 4K39A 4XD4A 1FP9A 1CPUA 1K3UA 2BNJA 2E0PA 1DWGM 2WBKA 2W9CB 3EBVA 3WYZA 1BQGA 1ICSA 4OIFA 4UTLA 2PWGA 4WVXA 2IBKA 3ZR5A 3MMDA 2W9CA 4O16A 3VD3A 2Q6ZA 1X39A 4B5NA 3QH2A 2Y70A 4NZCA 2GJPA 2EPMX 2FDSA 3HBLA 4TX8A 4KH2A 4HJWA 3IGUA 2CC0A 5TD4A 5DCBA 4JHMA 1QR7A 3GTIA 5FIPA 2Z6IA 3V4BA 4AEEA 1WXJA 3W84A 1DOSA 3M7WA 4NNAA 2XIMA 4WXZA 1C8VA 3VX1A 4RNIA 4LTSA 1PX4A 3N6HA 4DJFC 1EL3A 1KTCA 4AF0B 2CETA 5A3HA 2IPWA 3B0PA 5D09A 1J18A 4LXFA 4AF0A 4B4FA 4D6FA 3CGTA 2Y6ZA 3WNOA 4QROA 1E15A 1V93A 2XYLA 1WXZA 4DHGA 1UZ4A 3NQVA 2R8GA 3S5OA 3UZZA 1CXEA 4LYQA 5CZJA 5AC7A 2ZX9A 4AZCA 4ICNA 5AY7A 4F50A 2WM1A 2XVKA 5IBXC 1UJPA 1S3TC 3LCLA 4L7ZA 3WQFA 2V3FA 4E2OA 3O05A 4E3TA 1XSJA 2C7FA 3HM7A 1GG0A 2Y5EA 4V27A 4KWUA 3W86A 1LL7A 1VEOA 3FDKA 4EYHB 2IKGA 3VC5A 4AY1A 5BXSA 5DO8A 4LF2A 3KRSA 1F3TA 4QNEA 1TPUA 3B0XA 4P5UA 3RAOA 4JTLA 1Q8AA 4B91A 2JEGA 1TZ9A 3PPGA 1WBHA 3UXAA 3EDEA 7XIMA 4GJ1A 5HUOA 4NL1A 2TAAA 4NNCA 3OYXA 2QJMA 5CG0A 4IUGA 1YPIA 3PP7A 2OSYA 2V81A 2HS8A 1KCXA 1AZ1A 3S1UA 2QGHA 4FXSA 3PUOA 3EMZA 2XH4A 3RLVA 3PBGA 1QW8A 1J8VA 1UWSA 1W3NA 3CHFA 3SR7A 2YCIX 5REQB 2PWEA 4J1OA 4G1NA 3WFAA 3GG8A 3PBUA 2WVVA 4OWGA 5DF0A 5AZ1A 2D24A 5G4HC 2QXWA 3CZ8A 5FL1A 4PUJA 4W8LA 2VI0A 2P88A 2GJXB 5F2IA 4JIIX 2C1IA 4CCZA 2J6UA 1AMYA 1T3NA 1XPYA 2PTYA 3WH9A 1Q7ZA 3L4YA 2RAGA 2UVUA 3MBDA 1FDZA 2X2YA 2ODOA 5T9CE 4YCPA 2PZNA 3H70A 3GO2A 3LQLA 5A8MA 3VCCA 4DBUA 1WQ5A 4HZ7A 3THQA 1DWJM 1O66A 1UG6A 1KNWA 4A3HA 2GUYA 3WQEA 4A4AA 4W89A 2NX1A 2NQHA 1B4KA 1VS1A 2BWGA 2XGIA 3C2EA 2F84A 1E1CA 3KHDA 1XFCA 2VFEA 4MJMA 3ATZA 2HPMA 3GE7A 1BKHA 3FA5A 2YW3A 2OWWA 4H00A 1KB3A 2FH6A 1VRXA 1X6UA 3OIXA 3E0IA 3ONCA 3H55A 2VX5A 1ITQA 5KG4A 1SZGA 2ZXAA 3UZWA 1TO3A 5CPTA 5KFVA 3U0HA 4YYCA 2Z2UA 1I2RA 4PR4A 1RR2A 3DENA 3KVMA 2QR6A 1XGDA 2EBNA 1Z9AA 3SUVA 2DSUA 1ONWA 3URAA 3WD2A 3AXXA 4J3WA 4I8DA 5A2AA 1M1BA 3BAKA 1C7SA 4GWEA 3ABXA 1G7UA 1VEMA 4IT1A 3OQEA 1E6XM 2W4XA 1KM4A 4C6BA 5A6LA 2R8HA 1OFAA 5ABEA 4GJIA 2CEQA 1WV2A 3NZQA 1A5SA 2PC4A 4WOZA 1O68A 3LXBA 2E9LA 2HK0A 5D30A 3TSDA 1GVFA 1TUXA 5CEWA 4L4PA 3I3BA 4CD6A 1YYAA 3H4XA 4JS3A 3G0SA 3MUCA 2A7RA 4X61A 2ZOXA 1XIHA 1CGTA 4TX6A 2ONEA 1Z48A 1LWIA 3AZRA 4QDPA 2IPJA 2H6RA 1UWRA 2A79A 2OSXA 4AZHA 3TYDA 4A21A 4J7RA 3P67A 1EUNA 5IXEA 2HQAA 1Q7QA 1J5SA 4YVVA 1ZCCA 2J6XA 1GHSA 1CDGA 4PUUA 2PTZA 4AWSA 3ZWSA 5FJRA 4XKYB 2J77A 3SZ8A 4UTKA 1XYZA 5TF0A 2VD9A 5L9FA 2VGBA 3MR6A 3M6YA 3POHA 4F3HA 1H2JA 4AIUA 2W9BB 3GG0A 5I3GA 1SVDA 2XZ9A 4Q22A 1PZ1A 4HPHA 1PB0A 4DYJA 5LNRA 4NZ3A 3TJ4A 1OGSA 2QIIA 1X96A 1TV5A 1XI3A 1VH7A 3LV6A 1EWEA 2DGAA 3REQB 3ZVIA 3CQHA 3ITGA 2EG6A 2AGQA 4HK7A 2E6FA 4PEKA 3F1QA 4I6KA 1GONA 4JIRA 5AECA 4QWAA 1QPKA 1OIMA 3K4WA 2YBTA 4PYSA 1Q7MA 4CU7A 3UXKA 1KA9F 2C28A 2H8ZA 1EJSC 4DF1A 2YZ5A 2EF9A 2X0HA 5E93A 4D9PA 1B3VA 1RYRA 3W0KA 3ZVHB 3AMKA 2VGIA 3N6QA 4ECTA 1Y65A 2QVNA 5ABHA 2VCCA 3MHGA 1DQUA 1OQFA 2IPFA 1HF6A 2XSAA 3QHMA 4FX7A 3ISIX 3NOEA 1E40A 2C0HA 5EBAA 2QCFA 1LROA 3BJYA 5LSMA 1W3IA 4UBPC 3TCEA 1Z44A 1TE6A 1S1PA 3WLOA 5EMUA 4DXKA 3N73A 1G0CA 1UWAA 1W1ZA 4BZYA 3WD3A 3RRAA 3ARYA 5L1IA 4QM1A 3LNMA 2EG7A 3QYQA 3VU2A 1TCMA 5KFRA 3AYVA 3P82A 4QAWA 1PX3A 1BWLA 3AMDA 2OOGA 4AVFA 5DCEA 1AUSL 4HKPA 1HP4A 1K7FA 1EF2A 5KFFA 1CEOA 3WNKA 3T81A 2OWXA 3M9OB 4AWTA 1JI1A 1NWSA 2O7SA 4LBRA 3UT0A 3MP4A 4I9AA 4H2CA 1DJGA 3WQWA 3I6TA 1GORA 3W1MA 4FXJA 2YFOA 3TX9A 3GDLA 1CIUA 5KFUA 2G3FA 4H1ZA 1EHAA 1Q6LA 1P1XA 1TRDA 4V28A 3RF9A 4WY0B 1OG0A 3ITYA 3CU2A 5C2XA 1TV7A 3OB8A 1K7EA 5ABGA 4CUCA 2ASDA 3FJLA 4AX7A 1KV5A 3W7KA 2ZA2A 2RHGA 4GZJA 1A5CA 3T8LA 4IMAA 2CERA 2Y8KA 3MR2A 1XGEA 4Y9PA 2ZX5A 3W07A 4E6MA 5A6TC 3GNDA 1HG3A 1J93A 2ZUMA 4IIEA 1LT7A 1H7XA 3PNUA 5AC4A 1NDYA 1FWFC 2WJDA 2WKLA 1TPWA 4A8LA 2VCAA 4J3TA 1XHGA 4EOUA 1K1SA 1R47A 4GY7A 1MWOA 4CNPA 4CD8A 1PX8A 2JIWA 5K3VA 3A13A 3EEGA 3IJDA 4A2RA 1UR0A 2IXVA 4FXRA 4FS1A 5E0CA 3T55A 4UCGA 5D32A 2DFAA 1PYFA 4A22A 1XKYA 2RDUA 1O5KA 2OTDA 4GYPA 4OFCA 2DSZA 4N4PA 3ZJ8A 3H2NA 3KOYA 4HTYA 3W7PA 1OYAA 3M0YA 3PZTA 4HCDA 1H41A 3WEOA 3B9AA 4DPQA 3DKJA 4JD4A 4V1YA 2VFGA 3RUBL 2B7QA 1GZGA 1M65A 3MSRA 4KETA 4MB1A 2PS2A 2ZICA 5AYBA 4JXCA 4O18A 2WVUA 4EVZA 1US2A 4CNSA 3T08A 4UQDA 5A6BD 2YL8A 4MJ2A 5BROA 1QBBA 4R5EA 2PWFA 3FV9A 2L5HA 4JQ3A 1F3WA 4MSSA 4KCWA 3TUUA 4LUTB 1PO9A 3CH9A 1WAWA 1D3CA 3D46A 3USBA 4KCVA 4RX0A 2DH3A 4UFLA 1XYCA 3HPZA 3R0UA 3W2LA 3TQPA 3NQFA 2W9AA 2CZFA 1XH0A 1ZHAA 5TAOA 3NZGA 3WL1A 4YTRA 2QF8A 1QWGA 1Q6RA 5DQPA 4RZ6A 4K2SA 1CB7B 5CC7A 3KZPA 4NJHA 4MFDA 3N19B 4WSJA 2E5BA 3MR5A 4YPJA 2R8IA 1OFRA 3K5XA 5FL0A 1KWKA 1C29A 4WKAA 3CH0A 4WY0F 1KRAC 5L9XA 1F5ZA 2JF6A 2EPOA 1ZJAA 4ZGYA 1FHLA 4XZMX 4QITA 3VE7A 1E55A 4DI9A 3VMOA 1TJ0A 5B80A 1MW0A 4ACYA 2OFJA 2PDCA 4KGLA 1RP8A 3M44A 1L0PA 1EUAA 1EOKA 3HTWA 4IZGA 3U57A 1VQTA 4HPJA 4DZAA 4JFUA 1KCKA 3JUGA 3BW2A 3SCQA 4ATDA 1V3KA 3Q8QB 2NWRA 4GUJA 4I3GA 3GTHA 4L80A 1XSKA 2VFDA 4FBUA 3FW6A 3PUDA 5KZDA 3S5YA 4Z1CA 5BXRA 4X0NA 4HBKA 2PAJA 2YPIA 1XH1A 4XBKA 3UG8A 1UWQA 3WX7A 1UIOA 1DYSA 2G37A 4HHMA 3PM6A 4RNOA 1XINA 4R8UB 4ED2A 3G3MA 1HNYA 1CGYA 1PCKA 4KBXA 3W24A 1C8QA 5DQHA 4L1XA 1XYBA 2R1NA 3DEQA 1EZ2A 3P93A 4PULA 1JPMA 4KIEA 2V69A 3P61A 3M0LA 3SEPA 4K6AA 1GEHA 3ZT7A 4D71A 1SM9A 1QJWA 4M6UA 2PDKA 4S3DA 5T9BG 4ED3A 1DPMA 3UZJA 3FY1A 1V3HA 2PC8A 1SZFA 1VEPA 4MNMA 4WGHA 3VNZA 4AW7A 4OUIA 1QBAA 2FHBA 3WQ5A 4AISA 3AIQA 1GVRA 4DO6A 1G4EA 2WCGA 4RK8A 1EDTA 3VKDA 1TPB1 3TQ1A 5C70A 1A5MC 3FGCB 3I7QA 4NLGA 1GOXA 4HN4A 3CK5A 4IICA 3KOFA 1OG6A 1R86A 3TXVA 3VX0A 6TIMA 3DFTA 1HL8A 4QW8A 3BLIA 2WMJA 1JPDX 1V8EA 4L64A 2FZMA 3PVFA 1VFLA 4P8UA 6REQA 5CAKA 2ALRA 2OJPA 1DE5A 4AMCA 4IX2A 4YTQA 4U6PA 1KR1A 4D6EA 4JDBA 2GJRA 4O3NA 4UMCA 1K8CA 5LNSA 2PCQA 5CPQA 5FF7A 4ZQRA 1K9FA 1KFJA 1FWSA 1DIDA 4FBTA 3LTSA 5LKYA 2X42A 1LQAA 3H7UA 1SUXA 2VEPA 3TQVA 2VC6A 5JUMA 3QW4B 3W1NA 5BXTA 5D9OA 4NJJA 1HJUA 4GNJA 2AAMA 2JEPA 1PKNA 3BG3A 1YNPA 2Z1SA 3LLDA 3WENA 1XR2A 2BHUA 2W6RA 1QPQA 4AZ6A 4H9VA 3QZ8A 3FEMA 1WZKA 2R8JA 1Q4NX 4JHZA 4LEQA 1ME7A 1H49A 2XIOA 1ZU8A 2O56A 1RUSA 1XLLA 3EKLA 3TYEA 3L4UA 2DW7A 2VWSA 2KZHA 2DZSA 4NT0A 4U3AA 4GC6A 3RB3A 3GIKA 4RNNA 1V0MA 2I1OA 4BQ4A 1HGWA 3IVTA 4KFOA 1RAKA 1R46A 3NGDA 3ME3A 1W5OA 2EJ1A 1FWDC 4YTTA 1FCUA 5A8QA 1E3XA 4GI8A 4O4WA 4RNFA 1NWRA 3R58A 4W8AA 3N1AA 5K7JA 1MDLA 3UFYA 3WK2A 1CXKA 2WAGA 1JI2A 2V30A 4TMCA 4J9KA 1PCWA 1CXIA 4JTRA 4QCFA 4FB7A 1P0KA 2CLKA 2OKTA 4PTXA 3RMEA 4M81A 2PMQA 3QN3A 3VPLA 3W2JA 3ALFA 3MFIA 4NZ5A 4LUSB 1JAEA 4C6NA 3S5ZA 4C5YA 1PL9A 1EIBA 3H53A 5I77A 1E0VA 2E5DA 3G1AA 1V77A 4G7FA 3GK0A 4AQLA 3UWUA 3RFAA 1UR3M 3M7SA 1FDJA 5A6AA 1IXPA 2XN1A 3P60A 1XUUA 1W1A1 4EPEC 4JV2A 3R12A 1E5NA 2V2CA 4N9DA 3AXHA 3Q58A 4HYWA 3SQMA 3PW2A 3FYYA 2ON3A 3A4XA 3AICA 4HNVA 3A3XA 5AYYA 3WDJA 3OYZA 3PZVA 1A5LC 2BQRA 4LB4A 3QVQA 3DZ1A 5I24A 4O52A 4Q6XA 5D05A 1SZNA 3H2MA 4Q7NA 3XIMA 5GNZA 2BVTA 3DC8A 1J0HA 3CT7A 3I10A 3ABRA 3T5JA 2D0GA 1W5PA 3KBJA 5LNWA 4YP3A 5AHMA 2TPSA 4HPNA 4J3VA 3AZTA 3G0UA 3W2UA 5CGTA 5I78A 4QRNA 1AMKA 5CPSA 3M6DA 4TR9A 3O0KA 4HPXA 3MDWA 5IDZA 3GBDA 2GVJA 1VPQA 3IN5A 4YHEA 2DVUA 5I3DA 4AEFA 2C2RA 4J4KA 2J7BA 1DTNA 4TO8A 4WKHA 1FWCC 1DJWA 3E5BA 1ONXA 3IJ9A 1J5TA 1ONRA 2GGIA 3HFYA 2Z1WA 4JCLA 4HU8A 4UOQA 1LF1A 4C6DA 5H6HA 3CAWA 3VNYA 3WQ6A 5C9ZA 3CASA 3L7RA 3NR0A 4IRKA 4E0CA 1TPC1 2V5KA 4TTGA 2A7NA 5A5WA 3LY0A 1TYGA 3QRHA 3UWWA 3TSBA 1M5WA 1GJUA 2Y7GA 5KFSA 3KL3A 2TYSA 4HTBA 1ZETA 3T5KA 2P0IA 1GVOA 2WPBA 1A5KC 5GJNA 3GHTA 3GILA 4MY8A 1IE7C 1POJA 5FF2A 4DWSC 2B7OA 2ZZ6A 2IPGA 3ZJ7A 1SO5A 5HR7A 2XSXA 3Q8SB 4QJ3B 1TV2A 3SFWA 3GM8A 4UFKA 3MA8A 5EGRA 1P48A 3CT2A 3BAYA 3EDKA 4R33A 3AXKA 2E9MA 3KOWA 2XWEA 4RZ5A 5BCAA 4ED7A 2PWDA 2SFPA 1MFUA 4B5WA 4UIOA 3NDYA 4R3UA 2HVNA 5DLFA 1RXOB 4PCNA 1DJXA 1JAKA 4FALA 3A12A 3PPCA 1FRBA 5I5RA 4PCPA 3CUFA 2WB5A 4WOQA 3WLSA 4AD0A 2W62A 3SQLA 5CBIA 3BOXA 4HB7A 1HQTA 2OQLA 2VVNA 2YCLB 1DHKA 3LCWA 1A4MA 2QDEA 2DUZA 3NWRA 4N0RA 4DN1A 2CBJA 4J9NA 3B40A 3S4TA 4EX4A 2E28A 3R0DA 4ZVJA 1FWEC 1EJ7L 2ZZ3A 3E74A 1KFKA 3CL6A 4Z0SA 4GH1A 1F07A 1F2JA 3H4GA 3H6OA 3W53A 1PHWA 2UV8G 1TWDA 3KHGA 3IANA 3UYCA 3WLQA 1NELA 3O0FA 4ED0A 3QJAA 1IM4A 1LYXA 2IQTA 2E8YA 2QCLA 4DUVA 4CKQA 1ITXA 2Q8XA 3EWBX 3TMQA 4F4XA 3DFHA 3VD4A 3CZEA 2WBGA 4GBUA 4PMDA 5KINA 2ISSA 4MIMA 4HNOA 1P0NA 2JEQA 4WUIA 1VIZA 3DCPA 3B9NA 3WBYA 4J2MA 3JR2A 3NURA 2PE4A 2JEFA 4GKLA 1TV8A 4M82A 4NI3A 2HSAA 4ZA0A 3W9ZA 2MUCA 1NP2A 1N48A 1AD1A 3G24A 2HMCA 2QMJA 1FKXA 5EMJA 2NXGA 1W2PA 1H7OA 5KFNA 5BWFA 5CKSA 2DJLA 4CN4A 4JYDA 1DIKA 3ARZA 1E6PA 3MV01 1ZB5A 2BQUA 4PTDA 3DN5A 3BLEA 4JFVA 1EB3A 2JBMA 2QJJA 2GFTA 2RDIA 3LUTA 1UUQA 4XUYA 5CBBA 4Q7BA 3W3OA 4KRTA 2JEIA 2PWHA 3W7OA 2A3EA 1LDCA 4I90A 2VEFA 4HJFA 4DYEA 2FTWA 4WDTA 4O3PA 3CLMA 4ROPA 5C0QA 1E0WA 2OO6A 1T99A 2AGOA 2BOGX 5MKGA 5DQGA 2GSEA 2J6VA 2E5CA 2VELA 4REQA 5I3HA 1E9IA 3CMFA 1WO2A 2D2HA 4P8WA 4YTUA 5LA1A 3DHUA 3LOTA 1OF8A 2BVYA 1YDOA 4ZO7A 2HROA 1UA7A 1EA9C 5HMSA 4HPGA 4CQ8A 4JKLA 4ZL1A 4PE8A 5F4SA 2XPKA 4PMVA 1KCZA 1Q63A 1BLIA 2NX3A 1TCDA 3G1SA 1QPOA 3WBEA 1W9PA 1EJTC 3W88A 1LLWA 4JX4A 4LC8A 3L65A 3BLLA 5KFZA 1UD8A 3CB8A 2J7GA 2CLPA 1C90A 4QJ1A 5KZMA 5DT7A 1DWHM 4IFKA 3I3DA 4EAMA 1Y5WA 1F3EA 4O28A 3UERA 3WN6A 4Z2GA 2G50A 2JEJA 1KWGA 3FVMA 3RM4A 2OQYA 3OLDA 2XVNA 1UWIA 3MANA 4WLCA 2QUMA 5C54A 5I2UA 4JOMA 2WNZA 3VCNA 3VOCA 2O4QA 1GOIA 3K46A 3CEPA 4IPLA 3LRKA 2BHZA 4XZLX 2XN0A 3RB6A 4QG8A 1XIMA 3PW5A 3FJ4A 1W1PA 2QUVA 5D33A 3FXYA 2GOKA 4TIMA 1KXQA 4PH6A 1O1ZA 3NDOA 1ICQA 1DORA 3PVXA 5I07A 3LZ5A 1W9XA 3DGBA 1RBOB 3NL5A 4ECLA 1HFBA 4AAJA 4DJED 3GYCA 4IIFA 2V63A 4MWAE 3CV2A 3D47A 1Z69A 1TTIA 5D2VA 2HTMA 4GIYA 4U5IA 3O9NA 1XCFA 4XZBA 3BDKA 2F2KA 3U5UA 1VFMA 3SRHA 1OT2A 5JMUA 1S5VA 4ATWA 1OGBA 1UOKA 1ZQ5A 2G96A 5FEZA 4IOTA 1K8YA 4MHBA 4Z1YA 2XISA 3F4WA 1RLDA 1JUBA 3KL0A 3NEHA 1G69A 2DV0A 4R7JA 4H6RA 3RIKA 1LRQA 3VIKA 4DBWA 2J88A 1EP3A 1LM1A 2XGPA 2YCJA 3L5MA 1H5YA 2OXNA 2FFIA 3G1RA 1WKFA 1OFEA 4W85A 5HUPA 1GVSA 1W3JA 3KP0A 2Q8ZA 1IGSA 3LCFA 4XV0A 4QLLA 1VBRA 4NX0A 1P6CA 4R7WA 3LENA 3S42A 2GK1B 1RVKA 1RZMA 2R1LA 3CYVA 5JUVA 3IJIA 4YQWA 4XO6A 4XIMA 2NVDA 4GABA 4RUCA 1SYTA 2DUAA 1CX9A 1FA2A 4ZZ9A 3WQOA 1J01A 1KBBA 1XX1A 1BGAA 3MMWA 2WZHA 4KEZA 1XYMA 3A9IA 2GGGA 3LD5A 1FUYA 2XHYA 1KM5A 3SRDA 4JZ5A 3OG2A 1UWUA 1TQJA 1MMFA 3O6YX 3SCSA 3CUIA 3UYIA 4AUBA 4LANA 3GAKA 2X7VA 5JU6A 4RDVA 2OB3A 3TZNA 3W38A 6CGTA 4GQ0A 2VM8A 4OOZA 5CC5A 1EXBA 2VWTA 1KXTA 4JTGA 3CWHA 5HR6A 3QXBA 4E5TA 3ARRA 1OCBA 3R43A 2BR0A 1TKKA 2GQ8A 3TCSA 1XLFA 2KAUC 1RSCA 3KEHA 3WNNA 1A5OC 2C79A 2E4TA 4WF7A 3EX6A 4PMNA 2XN2A 3QEZA 2NQ9A 4OJYA 4AD2A 3IRSA 1MO0A 1OFQA 1L2UA 5KG6A 3N34A 3KBSA 3KDOA 4A3RA 3O06A 1ZTVA 1US3A 4BI7A 4JL1A 1W5QA 2GGJA 2XM1A 2GVEA 3PN8A 4K8HA 4XZIA 1PV8A 4RZ4A 4GK8A 4PCTA 4PMRA 3RCYA 2WKJA 3T8QA 3PG9A 2XVPA 2W7OA 4W8BA 3U6WA 1G4SA 1KBKA 3O6DA 4MF4A 3OVRA 1S2TA 3VFLA 1JPIA 3H2AA 5KT5A 5KT6A 2YZRA 1XV8A 2WMKA 4LWWA 4K7YA 1ICPA 3UPMA 1LUCB 1TREA 3UWYA 3TEVA 3VO0A 4LS2A 4Y90A 4ZE5A 5LHEA 1SFJA 5KT2A 4PCSA 5F1VA 4DZHA 2J8TA 1V6TA 4H9UA 4I9TA 5I09A 3T09A 1OK4A 2VXNA 3OEXA 4P7OA 1UB3A 1K1DA 1BAGA 4HA1A 2X16A 3EWXA 3P5ZA 2HBVA 3CAKA 4OBSA 4LOCA 4F40A 3TK7A 1VFSA 1D7FA 2W92A 4Y8EA 3W1TA 4HGXA 3WLHA 3DDMA 4L9YA 1NFBA 1N8WA 4Y9MA 3KHJA 3LHZA 5A2CA 3A24A 2GWNA 4XZHA 4I6VA 1QWKA 3P0XA 1GVQA 4OZOA 1TV4A 2EPNA 1GJPA 7ODCA 3GIJA 3CPGA 4O57A 3BLFA 2OU4A 3T0TA 4EE9A 1EC8A 3N13A 1I75A 3TJLA 3LPGA 1SFSA 3ES8A 4MNKA 4PUMA 3IPWA 3WNPA 2FH8A 1UQZA 2QT3A 1QNSA 1T8XA 5CZ0A 2VDIA 4MKNA 1Q6DA 3HFTA 3OZPA 2VRQA 1G5AA 4PTVA 2J9ZA 1XRSA 4FZIA 3GDBA 5EDWA 3E2VA 4M7TA 3PHAA 1REQA 3C2RA 3Q4DA 3CWOX 3TYCA 3EDDA 4QWCA 4AD5A 2A21A 3DFQA 3MCMA 1EGZA 1ML1A 3C8FA 3S5SA 4DZ5A 1E6QM 5HNUA 4MB5A 2OKOA 3A64A 4XKMA 2X0YA 3B0VC 5IHSA 2NVAA 1H0IA 1X7IA 1RYSA 1E6RA 1Z41A 2Z2BA 2PCEA 2FLNA 3AHVA 3ZR6A 3R4IA 3ALGA 4HU3A 2NUXA 1U5VA 4PTMA 4FOJA 1CTNA 2POZA 1A0DA 2Q3OA 2ISVA 5LHFA 1PEZA 1ZJBA 1UW9A 2OR2A 5A2BA 2CPUA 2V2DA 2QCCA 1K77A 1TR9A 5AFDA 1KFBA 1VHNA 1K4GA 5KG3A 4KT2A 5CZSA 2R1KA 3SCRA 5CZKA 2E67A 4QISA 1YBQA 2G4JA 1UASA 2W67A 4UFIA 1QU4A 1O5XA 2O55A 1MXDA 3G2GA 3P62A 1VYSX 3KRZA 1O95A 2PF0A 3C2FA 3TYZA 3EX1A 1J0YA 5BZAA 3U2OA 5LIWX 1L6YA 1ZSXA 3NAVA 1TWSA 1T94A 3WJYA 4P7QA 3QLLA 4BF5A 2WHJA 4WJEA 1PXGA 4PA8A 1GT8A 1T41A 1FWRA 4YLWA 4LY4A 3EWCA 3KBVA 1HO1A 1K9DA 4ZTXA 3IEBA 3M16A 4TV5A 2PEVA 4K1WA 1MZHA 4B5UA 1DIEA