2PLMA

Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
404
structure length
404
Chain Sequence
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Structure-based activity prediction for an enzyme of unknown function
pubmed doi rcsb
source organism Thermotoga maritima
total genus 146
structure length 404
sequence length 404
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2plmA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2plmA02
4UBPC 4INFA 1FWEC 1NDZA 3ORWA 3WYZA 4IFKB 4C6FA 4KQNA 4XAZA 5FSEC 1EJTC 4BY3A 4BKNA 4DO7A 4R7WA 4IFOA 3MVIA 1KRBC 4C6CA 3AU6A 2P9BA 3EWDA 1R9XA 4DI8A 1XGEA 3A3XA 2UZ9A 4B90A 2ZC1A 2P50A 2Z28A 4GYFA 2FTWA 3ICJA 4H9XA 4DLFA 4IG2A 4KIRA 3QY7A 1RK5A 1V4YA 2Q01A 1XRFA 5HMFA 1A4LA 1POJA 3T81A 2YB1A 4CQDA 2HPIA 4J2MA 1ITUA 2D2GA 3GRIA 4HK7A 3MDWA 4PCNA 3QGAC 4B91A 1P6BA 4LH8A 2Q09A 4F0LA 3LU2A 4GXWA 3T8LA 1PTAA 4KEUA 3GU2A 4GZ7A 1EJSC 3E38A 4IF2A 3LGGA 1YNYA 4NG3A 1A5OC 1W1IE 3GIPA 2EG7A 4C6PA 3TN3A 3CJPA 3GTXA 1ADDA 4AQLA 4V1XA 1HZYA 2Z24A 2CZVA 1FWIC 4QS6A 1FKWA 3S2MA 3FDKA 4HA0A 4LANA 4C6NA 4DZHA 2UBPC 3OQEA 3K2GA 1V7AA 4AC7C 3UF9A 1KRCC 3OODA 2Z25A 1YRRA 3SO7A 2AQVA 1FWCC 5HMEA 4HK6A 4XD3A 1EJVC 1EZ2A 2EG6A 2ADAA 4IGNA 3IACA 3O7UA 3A4JA 3K5XA 2HPMA 4IFRA 3DC8A 1FWBC 1YBQB 2G3FA 3PAOA 4KEZA 2FTYA 3SFWA 4B92A 2WJFA 1EJWC 1RJRA 4CEUC 3IRSA 4CQBA 1EYWA 4C6QA 3S2NA 3GIQA 3PNZA 1YMYA 1R9YA 3BE7A 4ERIA 4GY7A 4DLMA 4UB9A 2D2HA 3QY8A 2VUNA 1S3TC 4ICMA 2F6KA 2ANUA 3GU9A 2VHLA 3MVTA 3A3WA 3PANA 4CNTA 4XAGA 1ONXA 2D2JA 4CQCA 5E5CA 4C5YA 3ISIX 2Z00A 4CNUA 4PBFA 2Z4GA 1FWGC 3HPAA 2R1KA 1FWHC 4LCQA 4XAFA 3S2JA 2KAUC 4H9VA 2Z29A 3NQBA 3E2VA 3OVGA 3TN5A 3QGKC 1BF6A 4LALA 3E0LA 3ITCA 2Z26A 3T1GA 2GZXA 4QTGA 1DPMA 1FWJC 2P53A 3F2BA 4C6BA 3JZEA 2Z27A 1I0BA 1GKRA 1XRTA 4RZBA 2VM8A 3RCMA 2DVXA 1NDWA 1UBPC 1WXYA 4TQTA 3WMLA 4C6KA 1J6PA 1J5SA 4GX9A 2PAJA 2VC7A 3O0FA 1RA5A 1JGMA 4C6OA 3DCPA 2QS8A 1UMLA 1FKXA 4PCPA 3HTWA 2GWNA 3IJ6A 4LFYA 2WJDA 1M68A 1EJXC 3D6NA 4QROA 5CH9A 4C6JA 4J35A 4EP8C 4DZIA 4H9UA 4QS5A 1V51A 2QT3A 4KETA 3UR5A 2R1PA 4IFKA 1WXZA 3NURA 1E9ZB 3HM7A 3URBA 4RDVA 2HBVA 4G7EB 3V7PA 3WZ0E 2O4QA 3OJGA 3EGJA 4JOMA 4GY0A 4GOAA 3IV8A 5LXXA 2W9MA 1RAKA 1P1MA 3PNUA 4RE0A 4WHBA 3GU1A 4GY1A 4PE8A 3OU8A 1R9ZA 2E1WA 4NI8A 4HK5A 1M65A 4BJHA 5FSDC 1VFLA 1V77A 4LEFA 1YIXA 1NFGA 4H00A 4XAYA 1UIOA 4IGMA 1POKA 1RJPA 2Z2BA 4IQJA 4ZSUA 3URQA 4C6IA 4RDWA 4H9MA 2FVMA 3UPMA 4B3ZA 4DI9A 3IGHX 4D8LA 3MKVA 2HNHA 3G77A 1UIPA 2AMXA 1A5LC 4C6MA 4IG2B 3GTFA 4XD4A 4ERAA 3RN6A 2QPXA 1K6WA 1EF2A 4C5ZA 1EJRC 4GX8A 3CAKA 1I0DA 4I6VA 3NEHA 4ZSTA 4HJWA 1RA0A 2IMRA 4H9ZA 2GOKA 4H9YA 4C6DA 2I9UA 1A4MA 3F4CA 2OODA 3R0DA 4RDZA 1GKQA 1QXLA 1XWYA 2EG8A 4C6LA 3E74A 3K4WA 1KRMA 5HMDA 3E0FA 4DNMA 3S2LA 1K1DA 1IE7C 3MDUA 4OFCA 1ITQA 2HBXA 4EPBC 2PGRA 3UR2A 2I5GA 2YXOA 4QSFA 3LSCA 4LAMA 1YBQA 2GSEA 1A5NC 3PBMA 3LSBA 4PBEA 4F0RA 3E3HA 1M7JA 2ICSA 2YB4A 3MPGA 4M51A 4CNSA 2Z2AA 4GBDA 4NP7A 2XIOA 4KEVA 4EPEC 1FWAC 2OQLA 4C60A 2BGNE 1J79A 4ERGA 3CS2A 4RDYA 1ZZMA 4KF1A 4P5UA 3MJMA 2O4MA 3FDGA 2FVKA 2WM1A 3LS9A 3LGDA 4XD5A 3C86A 3IARA 4MUPA 3IPWA 2FFIA 3KM8A 1KCXA 1PB0A 3OOQA 3F2CA 2R1MA 1PO9A 4LCRA 4YIWA 4EPDC 2OB3A 3AUOA 3GTIA 3TN4A 2RAGA 2AQOA 4I6KA 4LAKA 4R88A 2GWGA 3LNPA 1KRAC 1ONWA 1EJUC 4LCSA 3B0XA 3MSRA 3S4TA 2R1LA 3LY0A 5G4HC 3URNA 1E9YB 2DVUA 4XD6A 1FWFC 3F2DA 3EWCA 1O5RA 2QVNA 4EPKA 1O12A 2YZ5A 4E3TA 4KERA 3UBPC 4WGXA 3TNBA 1FWDC 2DVTA 2PLMA 3B40A 3TN6A 4L9XA 3QY6A 4CEXC 3DUGA 3AU2A 2OGJA 3URAA 1K70A 4Z42C 3LA4A 1V79A 4LAOA 4QRNA 4WVXA 2A3LA 2R1NA 2VR2A 3GTHA 1RK6A 4IH3A 3GGMA 3GG7A 3GUWA 1P6CA 4J5NA 4C65A 4R85A 3RYSA 5AKQA 3MTWA 3N2CA 4GC3A 1A5KC 2PUZA 1NDYA 1PSCA 1RJQA 3B0YA 3F4DA 1J6OA 5A6TC 4H01A 2VC5A 4DYKA 4F0SA 1QW7A 2Z7GA 3FEQA 4G7EA 2PGFA 4DIAA 4H9TA 4G2DA 2E25A 4KESA 4C6EA 2WJEA 1NDVA 3ID7A 4GK8A 1GKPA 4L6DA 3RHGA 1A5MC 2BB0A 4V1YA 2Y1HA 2HQAA 2OOFA
chains in the Genus database with same CATH superfamily
1AZ1A 4IIFA 1XYFA 5KFQA 3HG3A 4YHEA 1VKFA 4P7QA 4KQNA 4H8HA 2QNEA 3TDFA 3ZVIA 3VD3A 5A6AA 3WNOA 4Z2LA 1BG9A 1W8SA 5C70A 4NJHA 1JIBA 4R7WA 3PK7A 3HBLA 5KG1A 4RNFA 3O15A 3WH8A 1R9XA 1JPDX 4DN1A 2IKGA 3T0CA 3HPXA 4R3UA 1ESWA 1V4YA 2Q01A 5DF0A 3EPMA 3RRAA 3SUWA 5ECVA 1JFHA 4S2CA 2PURA 3KOFA 3QC3A 1HVQA 3AMCA 1T94A 4I7WA 1RALA 4PCNA 3GKAA 3UVAA 4LRSA 4D9PA 2VELA 4PTMA 4HA3A 3MCMA 1EDTA 3E2RA 4GZ7A 2WB5A 4FF7A 3AIVA 3P6LA 5A8QA 1NH6A 2MNRA 5HNNA 5K4ZA 1OGGA 5LA0A 1XBYA 3R2GA 2EG7A 4KWOA 3DFOA 4HHMA 1R3QA 3OLGA 3L4YA 3MU7A 4O8RA 1EIXA 1L6YA 8XIMA 4JYDA 4AVNA 2J6XA 2F38A 3OQEA 1B2YA 2HTMA 1TRDA 1PZ0A 3KHDA 1KRCC 3OODA 3QZ8A 3KHLA 3ARXA 4D6JA 4MADA 2B31A 2DSVA 1H0IA 4F50A 5I00A 1IWAA 1UZDA 3PAOA 2CETA 1TFVA 3G8EA 1GQLA 3IRSA 1ZAJA 1AJZA 5LHEA 3GSMA 5HWMA 5GNZA 3NTYA 4GY7A 2E6YA 1RYSA 4NXSA 1ADSA 1BXBA 3NQ2A 2WWDA 5C6MA 3TQKA 4FZIA 3WBEA 4PGLA 4S3AA 3U4AA 1Q8AA 4CQCA 1E0WA 1AK5A 1RCQA 2CLKA 1CZ1A 1Q6GA 1L2UA 5A94A 3DG7A 3H22A 3LERA 3SCTA 2BSLA 2Q3OA 2KAUC 3CB8A 3SUVA 1B3WA 3H6OA 1RH9A 3UW6A 4L6OA 1GW1A 2BQ3A 4HPJA 3FJLA 2E3ZA 4XBKA 3PS7A 4JTAA 2P53A 3DHDA 5BMXA 3LDVA 4JUZA 4JTQA 3Q8PB 4RZBA 3RCMA 2VM8A 3TQVA 1OFEA 3B8IA 3S46A 1WXYA 1SFTA 4PCTA 4Y2WA 3BMXA 4O14A 4PUUA 1GORA 1VPXA 1K7EA 2OTDA 1I1WA 3IJ6A 4PSPA 1Q45A 2WNNA 3L67A 3PB2A 5FIPA 2ZXQA 3ZSSA 2E6DA 1BLIA 4Y9OA 4H6KA 4EP8C 2R9RA 1ZALA 1CW2A 3KLKA 2DP3A 1QWGA 2V82A 3UP8A 3ZWTA 4L4OA 4IUGA 4W5UA 2X2YA 1W5NA 5CLTA 7XIMA 4H7VA 1HNYA 4HYWA 3RR4A 1NP2A 4MAZA 5ABFA 4HTYA 2WKLA 3PJWA 4U5IA 1WNOA 1XIMA 4AY8A 3V1PA 4XBSA 2W61A 4LAZA 3VU2A 1W1VA 1P0DA 4MY1A 2AGPA 1QU4A 4KGJA 3NGDA 1W37A 1M03A 3TXZA 1X7IA 1GVIA 2QYGA 1ISWA 3ITGA 3KXQA 3TP4A 5KFNA 2W9BB 1P1XA 1IXNA 3I6EA 3OHIA 4F4XA 3S8HA 2BVTA 3T0TA 4EE9A 4N0RA 3GTFA 3HV8A 2C1IA 1UR3M 2NXHA 2YCIX 1D3GA 4ZQCA 2J4GA 4GVHA 1P0NA 2ZA2A 2XVLA 1SW7A 4ZOBA 5LIWX 5CKSA 1ZAIA 3EKZA 2XH7A 5IFTA 1VCVA 4L61A 2GQAA 2VYOA 4C6LA 4BFAA 3MV11 1ODUA 2Z7KA 1K8YA 4OFCA 1N8IA 5KINA 1WBJA 4ACZA 3W29A 1ICSA 3UEQA 1VRXA 1TYGA 3BGAA 1MYRA 1RSCA 2GUYA 2C0AA 2OXNA 3S47A 1QNPA 4EXQA 4K3ZA 5CG7A 3UGRA 2V5DA 2OQLA 2ZX9A 3TA9A 3MW7A 1JUEA 2XU2A 1UR8A 1TTIA 1Z32X 1ZQ5A 2CPUA 4P8UA 1LOLA 4M8UA 1Q8JA 1ZU8A 1OK6A 4WSHA 3AISA 5M03A 3FLUA 4O0QA 3WD4A 3GVWA 4Z1CA 1TA3A 1W5MA 1MFVA 1W0MA 4MJMA 1M5WA 5KFAA 2FLLA 2OQYA 3EX6A 2XWDA 4LAKA 2EKCA 3FSTA 2C13A 1BF2A 3L7RA 4G5DA 3TYCA 1E9YB 1XQLA 4LNYA 1QCWA 2QVNA 4EPKA 2YZ5A 2E1DA 3LTSA 2NXIA 4PEEA 1Z8AA 2W92A 1OINA 3DXIA 3U3HA 3FNDA 2BXYA 1THFD 2OQHA 2ISDA 3RAQA 4F2BA 4D6HA 4PMOA 4Z42C 3QV6A 3UR8A 2A3LA 3GHTA 1JPMA 1RK6A 2DZBA 1K7XA 3AS2A 4UTIA 1UD8A 5AKQA 2KZHA 2NUWA 3LD5A 2VTFA 3B0YA 3E0WA 1DWGM 2BQRA 1H7OA 1P5BA 9XIMA 1J0YA 3T6CA 5KFRA 2WV8A 3RLUA 3QGVA 1SZEA 4O1CA 3FEQA 4PMJA 1TCDA 4ZE4A 2D3LA 1EEXA 1H60A 1H63A 1P6WA 3WQCA 3K46A 2WJEA 4GK8A 3NL5A 3VNYA 3PTDA 4AIBA 3QTGA 3Q65A 3U9IA 3VYLA 4IX0A 1QUMA 1MNZA 3LPFA 4GUJA 2C18A 2VUYA 2F6XA 1QK2A 1L9WA 1XX1A 2BZNA 3DZ1A 4GYJA 1NIUA 1D3HA 1RD6A 3VOHA 1MI3A 3EWDA 1DJZA 1QNVA 3IUDA 1XGEA 6PTDA 3NZ1A 5DO8A 3I6RA 3KL3A 2HV5A 4DLFA 4IG2A 3W26A 5EWEA 1ADOA 1BRLA 1K9DA 4AW7A 5HK4A 3KEHA 1TV7A 2PLCA 5A95A 3TNOA 2ZE3A 1ITCA 3CYVA 3W7EA 1HJSA 2PSNA 1PTAA 3IRDA 2CZDA 4TIMA 1MXSA 1FCQA 1TPB1 2J24A 3FVMA 5B7ZA 4RW3A 1B54A 3EPOA 1JAEA 1PTDA 2ZADA 1EX5A 3B06A 3GNOA 5D38A 3R89A 3IJDA 2WVUA 1J8VA 3M0IA 3IGSA 4GYPA 1GVRA 4K38A 4NI3A 2Y8VA 1JRBA 1UJPA 2DZTA 2J13A 3WD2A 4IQLA 4LUYA 2XN0A 5CJMA 3I7SA 3ME3A 2RDIA 1GYNA 1YRRA 3NOYA 5HMEA 3MCOA 3M6DA 4J27A 1IXOA 3W88A 1KR1A 2I57A 3KVKA 2QXWA 3TTEA 4ATDA 1UKPA 1KWGA 4X60A 2D24A 3IVUA 4S3CA 1UR4A 2EPNA 3UETA 3DHPA 3DYPA 4G1NA 2PODA 3TONA 3MVTA 1K3UA 4XAGA 1Q2RA 2DORA 4ZQNA 3BURA 5KFZA 4TXEA 3KOXA 5F1UA 4AD3A 3W37A 3UZZA 4PBFA 1Y5VA 2NXGA 1NEYA 3LCWA 4QE1A 3JR2A 3VNLA 1LBMA 4B9ZA 3Q45A 5K9XA 1X6LA 1V8EA 4W89A 5A6SA 2A7RA 4A4AA 6XIAA 1R8LA 1TPDA 1TIMA 2BVWA 5CC5A 3UCDA 1KXVA 4RW5A 3IIVA 3AWOA 3SCSA 3IEBA 2GGHA 1ICQA 1ZGDA 5C9RA 3B05A 3QSRA 2BGQA 3CUXA 2PDUA 1V08A 1S3HA 2EQDA 3OG3A 3RAOA 1VLIA 1RA5A 1W1B1 1WDQA 5CZJA 1M04A 3BAJA 4Y6GA 3WH9A 2VDIA 4LS1A 4AG0A 3XINA 3TYDA 3TWBA 4HN4A 4C6JA 2DT2A 4HOWA 1I2OA 3E0VA 3PZTA 1QPRA 3JW7A 3MKKA 3M9OB 4H19A 4X63A 1LRNA 1C9WA 2GUUA 3L23A 2OG9A 4J3UA 3B0VC 5C7VA 4G7EB 3WZ0E 5KFVA 2H8XA 2O4QA 1KA9F 3SI8A 4KWVA 3ONCA 2XZ9A 2NX1A 1MUCA 2PLJA 3UWYA 4WUIA 5I3KA 1JZ8A 2VI0A 4OGZA 3HA1A 1ZP3A 4MAVA 4N9CA 4YTRA 5DLCA 1W91A 4IGHA 3CWHA 2Z1BA 5BW6A 1UIOA 4IGMA 1KTNA 4JTFA 3BK0A 4ZSUA 4C6IA 1M3UA 2QUVA 4LS0A 2Y2WA 3QXBA 4F66A 4TQSA 1BTMA 3GBDA 4IPJA 3VOJA 2VR5A 3GNNA 4L4LA 4OOZA 5H6HA 1C8XA 5C8BB 1JDCA 2OWWA 3GFZA 3BDKA 2W7PA 1RA0A 3MMWA 4NRSA 2PDQA 1NOUA 2I56A 4UNIA 3WQPA 1J5TA 2YGYA 3K8MA 1DIKA 1HJUA 1DJXA 3DFNA 2AL2B 3SBFA 1LL7A 1P0BA 5HBFA 5DELA 1TRIA 3GVVA 4JL2A 4L9ZA 4WKHA 5JXQA 1KFCA 5JIPA 2PWEA 4QSFA 4J3VA 3QFEA 2G0WA 4QE5A 2UVWA 3W6YA 3QF0A 1FY6A 4F0RA 1W3TA 2QZRA 3LRKA 3RAXA 1NELA 1JPHA 4A35A 3RPDA 2PDKA 3GDMA 3DECA 4CNSA 4GBDA 4CD6A 4ENLA 1U1JA 4ECYA 4CD4A 5DCDA 5KSWA 4GVGA 2HVNA 4RDYA 5FD0A 4IPLA 2QKFA 3QLDA 3A5VA 2QCCA 4RZ4A 3VILA 4AIEA 5F7UA 3A22A 3KHRA 2GGGA 3COTA 1XRSA 4K6AA 4LYRA 4LCRA 1PVNA 2RDTA 3Q8RB 5C9UA 1BKSA 2WTFA 1Q6FA 4J28A 4M81A 4B2DD 2DZVA 2NQ9A 1MQQA 4KCVA 1EWEA 3EDDA 5AFDA 5DN1A 5G5IA 5LXEA 4ORIA 4HOZA 2DVUA 3DFHA 3WLLA 3WFLA 3QR3A 3PW0A 1TV4A 3ES8A 2DH2A 3CHDA 3WNMA 5KFDA 1UP3A 4I8YA 3B40A 3TN6A 3NA8A 1XLJA 4C7DA 1V6YA 3FHAA 4HB7A 3P60A 1FP8A 5CZ0A 3OGVA 2ZUSA 2WCSA 4LAOA 1QHZA 1EB3A 3UU0A 4AXNA 4IT1A 4HD5A 4S3JA 4XZMX 4J5NA 3RMEA 2XVPA 1HKIA 5K9CA 3G3MA 2WKGA 1F07A 4J9LA 3QPEA 2QDGA 2A5HA 4IRDA 1JXJA 1OZQA 1RPXA 2AOSA 1VYPX 5LA1A 4OUIA 1XBZA 3I4EA 3VIHA 2NT0A 5C55A 4M7TA 2IA6A 2X1RA 5CJ5A 3C2RA 1DIOA 4PFHA 2XG9A 4FP1A 2ZUNA 3RMJA 1KR0A 2XCPA 4MTVA 3VMPA 4DJED 5ABEA 3FEMA 3WQEA 4O12A 1E4IA 4XUGA 2RGLA 5G2IA 4R33A 2OT0A 2J27A 1ZCOA 3S9ZA 3W6MA 1K1QA 1VJSA 2AGTA 4J9NA 1OGSA 3SUUA 1M1BA 2QDDA 4GUFA 4Q4KA 4H83A 3WDPP 5JVLA 1PIFA 3ICJA 4Q7NA 4PCFA 3RM4A 4DXVA 3RIKA 4HNLA 4MB1A 5HNRA 1HL2A 1POJA 1PTGA 4O4WA 2CBUA 2WBGA 2YBVA 2YDRA 2D2GA 2PWDA 2VENA 2PTDA 4E4PA 3CO8A 4JFUA 1B5TA 4HNOA 3FGCB 1KFEA 4NSBA 1KO0A 1TJRA 1W1IE 3O6DA 2Q3RA 3LCGA 4BF9A 1K8XA 3QV7A 4XSLA 3TSBA 1FWSA 2O9TA 4JQ1A 2Z24A 1EP3A 3EX1A 2DT3A 5TQLA 1E4LA 1XPGA 3B9NA 4ASTA 1FVPA 5EMLA 3TLLA 3NZQA 2OO6A 5HOSA 4Y9MA 3BLPX 4JQAA 1MUWA 2D1ZA 3LLFA 3AZSA 4WEVX 5BOEA 5AHEA 2V63A 4HK6A 1GJWA 3TV8A 4L6HA 2V67A 3WJZA 4NZJA 2FZNA 2QW5A 3WDHA 3BLEA 4GGHA 4JL1A 4PL2A 2D73A 4NAFB 5JH1A 4JYEA 1DHKA 5DQGA 3IWPA 5EMMA 4GVFA 2RUSA 4DJFA 4EXAA 1R46A 1S2UA 3UR7A 4AZ6A 5KFEA 4F2UA 1JNEA 2OLAA 5E5CA 1E0XA 5DGBA 2P0OA 3M4HA 1UR1A 1A0CA 4S23A 5EMUA 1CYGA 2GUBA 5DGAA 4HYVA 2R1KA 2XCAA 5KFKA 1DQWA 1SO6A 3TR2A 3RJXA 2VX7A 2HS8A 1FXPA 2W79A 1VFTA 4OBSA 4JDBA 1EDGA 1Q2SA 3ARPA 3T1GA 4QTGA 3MT1A 5AZ1A 1PWLA 2WHMA 5REQA 5H1WA 3JZEA 4Z1DA 2VZSA 2X1IA 1EC7A 1QI3A 2VOMA 3SRDA 1UBPC 2I14A 4IQDA 2DH3A 1XG4A 3I68A 2Z6IA 3CMFA 1KBIA 4REQB 5DRCA 4O1FA 2DIKA 4CN6A 1T7LA 1PDYA 1QI4A 1XCXA 3KS5A 1C29A 4UMCA 2PDGA 3ZOAA 2QF7A 4GABA 1XLLA 3APGA 3NURA 2VDGA 3NGFA 3NJ3A 5GJMA 2BXZA 4JIPA 4DUVA 4QG8A 1JPIA 1BWLA 2W9MA 5D9MA 1GHSA 3F5KA 4POCA 4QAWA 1EOKA 4OUEA 1SMDA 3VC6A 3DYOA 2NV9A 4DUWA 4B5SA 4Q8NA 3WY1A 1GEHA 2XYLA 4CLMA 2FH8A 2Y5EA 4ZMGA 5EPDA 3VIFA 4ZB2A 4QISA 4IQJA 4PZVA 4Y7EA 4B3ZA 5AOUA 1T8QA 5LIKX 1MZRA 3IGHX 1TE6A 2INZA 1GOKA 5IDZA 1AJ2A 1S10A 1NVMA 3LHUA 3KZPA 4C5ZA 4GX8A 3NQDA 3VD4A 5A2BA 4QNEA 5KT5A 3ZR5A 5C2XA 4DM1A 1SSGA 4YVXA 2NQZA 2BXVA 2RDJA 3F4CA 1A4MA 1VH7A 3UZXA 1HKWA 4RDZA 3VXGA 1GKQA 1J12A 1LJYA 2EPKX 4RCXA 2QIWA 4JTEA 3N2XA 1TWZA 3N4AA 1EFZA 3G1DA 1AD4A 4ROPA 5J5DA 4GO9A 1VRDA 3P2VA 2RDUA 2QDHA 4D8AA 2C2EA 5C2GA 1UD3A 3TCSA 3O0KA 3G1AA 3M16A 1SFSA 3LXBA 4PSRA 1XYBA 1TPWA 2HXUA 5AHIA 1B9ZA 2B81A 2X30A 3HZ3A 3NL6A 4IMFA 2YB4A 3M44A 5JBFA 3S5SA 2G4FA 2V0TA 4AY7A 4RKAA 3ITLA 5B7YA 1H1YA 3VAVA 2G5WA 3P5YA 3FDGA 3PBGA 2J6VA 2NVCA 1PS9A 5JMUA 3GHRA 1IIGA 3IARA 4MUPA 3DBNA 3IPWA 3EBVA 4G56A 2ZRZA 5JU6A 1PB0A 3KP1A 1A50A 1IV8A 3ZIZA 2GDQA 2FLNA 1XGDA 5E0FA 3G3DA 4QWDA 4KFNA 1F6KA 4AXKA 4RNOA 5AC8A 4Y9NA 3MSRA 3N73A 1MW1A 4YYCA 3LY0A 3THUA 2YL8A 1ZBCA 5D09A 2OMAA 5KFYA 4EK7A 3DFYA 1JX4A 5BRBA 1R3TA 5HNUA 3R25A 3VO0A 1XLKA 3T7VA 3QR0A 1TTQA 2EO7A 4UFLA 3WJXA 1JCMP 4G9PA 3CV1A 1QI5A 1V79A 4PBGA 4FAMA 2IPWA 1KCKA 7TIMA 3F4NA 1QOXA 2VGGA 2WC4A 3BLOA 3GTHA 1QNQA 3WDQA 1Y8BA 5CZTA 4JTRA 4PYSA 2D20A 5KFMA 4Q6XA 1XLFA 5I3DA 2BTMA 4DO6A 3LMZA 4TTGA 1BQGA 2G4JA 1YPXA 2BX7A 5I0DA 3LLDA 2YXXA 3B8TA 5DMNA 4XG1A 3QHOA 3KBSA 4KESA 3EOUA 4NY2A 2ISVA 4OJYA 3MI3A 4ZFCA 2V3GA 4JIRA 4I8DA 3L68A 2HQAA 1UCWA 1ZS2A 3MWCA 3NAVA 3PVFA 3CUJA 1GHRA 3AI0A 2ZUVA 4HGXA 1XH1A 3IV3A 2CFFA 3MMDA 1QO2A 2Z2UA 1RD5A 1XH2A 2XIMA 2J7GA 3WLKX 5G1TA 4R34A 3T4WA 1GTHA 4MYAA 1VBUA 1GVQA 3F5LA 2X16A 3LTPA 3SY1A 4IOTA 3B8UA 4B5TA 2NT1A 2ZRVA 4UTFA 5DFAA 1XG3A 2WVSA 1Q6OA 4D6DA 3THQA 4OKDA 3H4XA 1AW1A 4CD7A 3T8QA 3GWQA 4Z2JA 3RM9A 4CQDA 3U57A 4YQWA 1JCLA 5G4EA 3RX2A 2FPVA 2J8TA 3WLRA 4ZTXA 5DX7A 4NZ3A 2PDBA 3LN3A 4FMVA 4OOUA 3TUUA 5EBAA 1RQEA 4A3UA 1M01A 2WHJA 3GD6A 2CCRA 4IIGA 1A49A 1XISA 3I4KA 3QOKA 3C2FA 1T3NA 4M1BA 3WMSA 2C3ZA 1RZMA 1FWIC 5I2UA 1JUBA 1JFXA 4HA0A 1LOSA 1UROA 2R8HA 4XKMA 4QWCA 1BXNA 4CCDA 4DELA 1UPMB 1CXFA 4O1BA 4DWSA 3B8SA 3PPHA 5DT7A 3IACA 2ZYFA 3W4RA 1TUFA 2GQ9A 4K8EA 1FWBC 1G0CA 3OB8A 5KFJA 1FFRA 2FHCA 1J2BA 4MNJA 4W7WA 3S2NA 2VFFA 4H8UA 1YMYA 4QSHA 4UTTC 2ZA3A 3FFSA 1VEPA 2D2HA 1O4UA 2F6KA 3WD0A 4NZFA 4S38A 1TVNA 3NIYA 4MLJA 4R5EA 3BICA 2QEZA 4AZCA 4QX4A 1CXLA 4AEOA 3AS0A 4YTSA 1JG9A 4JNYA 3N18A 3NO5A 1V6WA 1MXGA 4CU7A 1UOKA 1FWGC 3S2JA 3AHVA 4UR7A 2WNWA 2J6TA 3NQBA 4C1LA 2V69A 3GO2A 3NDZA 4LALA 1BSIA 3G2GA 2BOEX 2A3AA 4I7UA 4EAYA 4DL5A 4JD4A 1F2JA 2BMBA 1R3WA 6ALDA 1S2VA 1BTCA 2J62A 3RX4A 2PE4A 1DWHM 2BV9A 2OWXA 3G5EA 3N1AA 2CNCA 2NW0A 1YTKA 2OELA 2VJXA 5U4NA 3IS4A 2XZ7A 2VC7A 2WMIB 3CU2A 2W3ZA 3W81A 1UYQA 4DB7A 3V35A 3IVTA 1CEOA 2WJDA 4JFTA 1Y5WA 3H7UA 1OCBA 3I10A 2YSWA 4RZRA 1F9CA 3HJZA 3W7MA 5CH9A 1NOFA 3BCFA 4DF0A 4NAEA 3SQMA 3FSUA 1W6TA 4LEQA 2W0UA 1IM4A 2VX4A 4O52A 2NLIA 3UXIA 3QMRA 3CZ8A 1T6MA 3B9EA 4I9AA 2H9AB 4KWSA 4FEZA 3IV8A 1UR2A 3NZRA 4OVXA 1ENUA 1F3WA 3TLQA 3GH7A 2E67A 3N12A 4CQ8A 5DG9A 4QEEA 1GOOA 5M1TA 2ZVIA 5CQ1A 1K03A 2OFJA 1YIXA 1XLBA 2AAMA 1OD0A 3GK0A 4UTMA 3U2EA 1W3IA 3E2QA 1GYLA 4IP7A 3POHA 3MZNA 1L6FA 4JTJA 4L1XA 4X3ZA 4F4YA 4UQCA 3N4EA 3AROA 3GVQA 2RHGA 4D8LA 1W9VA 3QEZA 2FPTA 3VKAA 4HZ6A 4C6MA 5AECA 1TV2A 5IRPA 3AHYA 4W9TA 2PZ0A 5CPOA 4HYKA 4S3EA 2OOGA 2FGBA 5FL0A 2QGHA 1ZCCA 4ZSTA 5FEZA 4H9YA 2B7QA 4C6DA 3M0VA 2PWHA 2OODA 2F2HA 3VIKA 2NQLA 3K4WA 3INPA 4HSOA 1J0HA 3O6CA 2VFDA 3RLGA 4J1OA 3W70A 1H0GA 3ZT6A 1ZL1A 3GDLA 5D2TA 2XIIA 5FEWA 1SW3A 3SUTA 2ZTJA 3LSBA 1PZ3A 1US2A 4RLIA 3MP3A 4JTCA 4HHPA 3U2CA 4DEZA 4M51A 4OIFA 3BLKA 4RXGA 1LDCA 2WKJA 4J3XA 3U0HA 1J79A 4DJDC 3OBAA 3ARTA 2FVKA 3SJNA 2WM1A 4E4FA 5DCEA 3BQ1A 3SJ3A 5HR7A 1OFPA 3LMYA 2ACQA 4J2PA 5DLGA 4IJCA 3LOTA 4BZYA 3EDJA 4AAJA 1BHGA 1DJNA 3R43A 3SFKA 3PZPA 2GWGA 1F6PA 3B8WA 4YR0A 2R8GA 3E02A 5D32A 3UG8A 1NU5A 1GW9A 4GC7A 1AMKA 2EGZA 1UB3A 4ADUA 1J96A 5E1QA 2X8RA 2ACSA 2ZIDA 4GQRA 2GYIA 3GXPA 1FWDC 3PG9A 5DG8A 1TTPA 5CBIA 3M5ZA 2CBVA 5JUMA 3QY6A 2DPIA 5AYZA 3URAA 1GPWA 2TODA 1FH7A 3LHWA 3LA4A 3WF4A 3NQGA 4JEJA 3W3OA 3BMWA 3W1RA 3O07A 4O3NA 4LSBA 1AD1A 2DSKA 5H2ZA 4G6CA 3Q94A 3GVGA 1GVEA 3L2MA 1OFQA 4LVDA 3TZNA 4DYKA 3O16A 3QZ6A 4F0SA 2I7GA 2Z6JA 4LX4A 4JXCA 1G69A 3P8JA 4IM4A 3R8RA 3NVTA 3TC6A 3WL0A 3PR5B 4PTNA 2E25A 1KGXA 4M1RA 3WBWA 3WK3A 4AFYA 1LT7A 3ID7A 3KVLA 4L56A 1V3LA 4LJ3A 2OKTA 3RF9A 3QMSA 4UBPC 2EAWA 5AZ0A 4NASA 8TIMA 3CEUA 1CENA 3MB9A 3CMGA 3RUBL 4C6FA 1UMYA 3W2JA 4BY3A 1OYBA 2QJJA 4DO7A 3BQ2A 3W7QA 3WLTA 1S5TA 1RLDA 4F4WA 1VGAA 1I2QA 1HKMA 2PI6A 1KRBC 2C19A 4UIOA 5ABFB 5K4XA 4EVZA 4AY1A 1UQZA 2OLSA 3M1ZA 2UZ9A 1CLKA 1TWDA 3RG6A 3NZGA 4AC1X 3DFTA 3WH7A 1O60A 1MQPA 4GQ0A 2PB1A 4W5ZA 3SUSA 3A64A 3SIZA 1RCXB 3DG3A 3QOMA 1UPPA 3MJYA 4DPPA 3QGAC 2Q09A 4RX0A 2PBGA 3RO6A 3HQ1A 3GU2A 2V4RA 4Z2KA 4M6UA 1KFKA 4ECUA 3BANA 1E51A 3CXOA 4CVWA 7A3HA 1FQ0A 4R9OA 1E6NA 1CWYA 4LYQA 4JIEA 3KOWA 4V1XA 1TUXA 1I2PA 3STGA 1TELA 2CXEA 1YNPA 2JEJA 4C6NA 1KBJA 1XLGA 3R11A 4R8UA 3E9AA 3TMQA 1Z44A 1TJ0A 2JKPA 4ACZB 5CGQA 3ITYA 4MZYA 4IFRA 3GZAA 2GOUA 3GY1A 3FX4A 2NSXA 2I9EA 1Q6DA 2YL9A 1LF1A 1O94A 1RJRA 5EMJA 1HG3A 5KT3A 4DBUA 3EDEA 4O0ZA 2DW6A 2XHYA 4LC8A 2GK1A 4H41A 3C0LA 4IICA 1WKDA 2ZRXA 1TJPA 1U22A 3VMNA 3VOIA 3ARVA 4CNTA 1C7TA 1OCNA 4ZQMA 3W7DA 1E1EA 1XIHA 4Q32A 1VCFA 4WOQA 3RB3A 3RILA 1JNDA 4ZO9A 2INEA 1L8PA 2YA0A 3STEA 4Z2IA 4EIVA 4DHGA 1TA3B 2Z29A 3QYQA 4HHHA 1WA3A 4FNPA 2VZOA 3C5QA 1GCYA 3ITCA 4I7VA 1GVFA 4UFKA 1DE6A 3MY9A 3KLLA 4FR1A 1UD4A 4FNRA 3VKCA 2W8LA 3LHTA 2ASHA 3UNDA 5LGXA 3FW6A 1UKTA 1FCUA 1OM0A 4XO6A 2CZ5A 4DZ5A 1JGMA 4IR1A 1MFUA 3EB4A 1UMLA 2A0NA 2PRMA 3R58A 2YCEA 2NWSA 3SRHA 1GZJA 1J0ZA 1M68A 1V0MA 1VFHA 4UZUA 4HU4A 2C15A 1E6ZA 5K7JA 4MNMA 4M0XA 4UZSA 2E9LA 1DJGA 2GJXA 1UH4A 3L4VA 3AYSA 4RK8A 4IFKA 1LRQA 3CO4A 3SM0A 3MFHA 3NM3A 2HBVA 4UQ9A 1DQUA 3WF2A 1U83A 1EWDA 1S39A 2GSHA 4NZ4A 1FHDA 4LWWA 4LUJA 1QO5A 4WR3A 4DAIA 3GH4A 3KCJA 4JBRA 2XVGA 4M6VA 5ABTA 4GOAA 3LRLA 3BXWA 3WFAA 1FUYA 3CQHA 4GWEA 3FCPA 4MWAA 3GU1A 4JKKA 2Q6ZA 4W7VA 3BV4A 1OYAA 3UWZA 4PE8A 1WUFA 4ZXOA 2Y61A 5T14A 3UXLA 4HK5A 3ZVHA 1VHNA 3N9SA 3W7IA 1A53A 2CLOA 5D05A 3R8GA 3WDJA 3SRKA 3QVQA 2I16A 1XINA 2ZBTA 4WJ8A 2EPMX 4WOZA 2F8QA 4HU8A 5GJNA 1OFRA 3RR1A 1XM3A 4DO4A 3UPMA 4HA4A 2OZ8A 4IMCA 2CITA 2QUNA 5D4YA 3G77A 1BYAA 4K37A 4IG2B 2PTWA 3TW7A 1ZLPA 1RHCA 2VX6A 5I77A 2Z1WA 1BRLB 1LG1A 3PJUA 4FOKA 4LVFA 1GJUA 1HL9A 1I0DA 4I6VA 3VZZA 3A4WA 3QYSA 4Q4MA 5L6UA 1QK0A 2IMRA 3LCFA 2I9UA 1EPVA 2A2IA 4E0CA 2PDXA 1EF3A 1PCKA 4MGGA 2OEJA 2PDYA 1QPOA 1XSKA 4JAWA 4O18A 2CKRA 2XISA 1L2QA 2VQTA 5FL1A 3NL3A 5I6SA 4HJFA 4LW7A 4D6FA 4JV2A 3BC9A 1EHAA 2FHBA 3LV6A 4HN8A 4M5PA 1CTNA 2WC3A 3W9ZA 4W87A 3W25A 4MY8A 3AQUA 3UQNA 4YCPA 3ARSA 1YBQA 3GVRA 3RU8X 4WDUA 1SO5A 1H5VA 4PBEA 4HCLA 4QJ3B 1AW2A 1F05A 1QJWA 2FFCA 3VZXA 2V38A 4L1GA 3T0DA 1BGAA 3OVRA 5EDWA 5KFFA 1QPQA 1SJAA 4RUAA 1LQ0A 1OK4A 5GVJA 4U7CA 4GC4A 3L66A 4DBDA 1TJ1A 1TPVA 2XC9A 1E55A 1YTEA 3SCRA 3BARA 4XTDA 3GNXA 1QASA 3KWSA 2BVDA 1PZ2A 5T9BG 4J9QA 4B5XA 1V02E 3AUOA 3OYZA 3N2MA 5T8GA 4CGTA 4QLKA 5G1YA 3CPRA 4I6KA 2EHHA 2XDFA 3DI1A 5HUPA 2VD9A 1HGWA 3GIKA 3E2SA 2W5FA 2CWXA 1MMFA 1EQPA 1L8NA 4CCEA 2JIEA 1A5SA 3UBPC 3AWNA 1VBRA 1HJQA 2ACRA 3WIJA 5CAHA 1KWKA 4CEXC 3UY7A 2UY2A 3NPVA 4IP4A 4QM1A 4WVXA 1UWRA 2QPSA 3V6JA 2ZXDA 2WANA 3SN0A 2OJPA 1GNXA 1ME8A 4C65A 3G0XA 2MUCA 3VIGA 3MTWA 2XWEA 2WSQA 3S6DA 1A5KC 3R10A 2WMFA 1VYRA 1KTCA 4MNKA 3UCCA 3BQ0A 1V03A 5KG6A 2V8ZA 5KZDA 4RNNA 3ENLA 4H9TA 2W7OA 1W1ZA 1E0VA 2R94A 1DJWA 3NYDA 2NVDA 3BOLA 3S9IA 4WKAA 1H7XA 4GQQA 3M64A 4J9KA 4JTDA 2G3JA 1W9DM 3LCHA 4RUCA 4XAZA 1DXFA 3BGGA 1TE1A 1TWIA 2TPSA 3KE0A 5E9XA 2GPTA 3OZMA 1V3HA 3ZS4A 1JDEA 2A21A 2VP8A 2Y89A 3TSMA 2P1FA 2R8KA 4GUHA 2AGKA 2TSYA 3DDMA 3R8HA 2QJGA 3B3DA 3TCEA 2CESA 1YADA 1GOQA 1TV8A 1DKWA 1OC7A 1MRQA 1W9UA 3MDWA 4B91A 1SZRA 3VK5A 4CNPA 4L80A 1JDDA 1YEYA 4O10A 2WNQA 1XP3A 1D9EA 3HQPA 5DXXA 3SCOA 2XIJA 1JVNA 3M6YA 4Q6JA 2GGJA 3OZOA 1HL8A 4D1JA 1XI3A 1JCNA 3TYEA 4NG3A 5I03A 1VJZA 1OB0A 2GDVA 1MXDA 4ECQA 5E0KA 1ADDA 1H4PA 1MW0A 1RY0A 2ZXAA 5DMLA 2RFGA 1PHQA 2GFTA 2DJLA 3C4UA 3K2GA 2VQUA 4XTIA 5FF2A 4XBJA 3UWWA 3GNDA 4O28A 1EJVC 1G4SA 4HOXA 3MSGA 4P7RA 3AS3A 1BVWA 1J01A 4L9YA 1SZFA 1WE5A 3NEVA 1SU5A 3U2OA 1PKMA 4PA8A 1EYWA 1M6JA 1QW8A 3BLIA 3G0SA 3E5PA 2X7VA 4AD0A 1CLXA 2ATLA 4F4ZA 4UTKA 4Q4PA 3KRBA 4GYPC 4UUIA 1EGZA 1GEQA 3I3EA 3OP2A 3G6YA 5DMMA 1BQCA 3VNDA 1QPKA 1F6YA 1S2WA 2W9AA 4ED8A 4JQ3A 3CLMA 2OKOA 1DOSA 2J78A 3AIWA 4LCQA 2V5BA 4GHRA 3N6HA 1XDMA 1EGVA 4DO5A 3WEOA 5A6MA 5AYIA 2PMQA 5CC3A 4JKMA 3F2BA 1L6WA 1GKRA 3VC5A 3EX3A 3IVSA 3H4GA 4QLLA 4EF9A 4ML9A 1BKHA 2W27A 3MV01 3PZVA 1PYMA 1UH2A 4LFYA 5CPNA 3OPSA 3N6QA 2OGYA 5KTLA 1XLEA 1EUAA 1TPH1 3CASA 4KMQA 4S3BA 2J6SA 2XGQA 5DMYA 5L1JA 4J35A 4QS5A 3C2YA 4YHGA 2ZZ1A 4N4PA 4YYFA 3SSZA 1RXOB 3URBA 3CZLA 2OO0A 4A3QA 1TIWA 1FRBA 1ML1A 4WY0F 4P7LA 1T99A 4JN8A 3TQPA 4GY0A 2V3EA 4K7YA 4HCHA 3V6HA 1P1MA 5KG5A 1S5NA 4A6GA 1JULA 5CLWA 1JZ6A 1QVBA 1WOAA 2PCQA 1IEIA 1RY8A 2NWRA 1J2WA 2FQIA 1FWTA 4RE4A 1V77A 4LEFA 2V3DA 1JF6A 4OBTA 4C7FA 1CXEA 3N25A 2NQJA 1OC5A 2V2CA 3URQA 3UA3A 1W56A 4NJGA 3BO9A 3CV7A 1JF5A 4H7CA 3TYBA 5FJTA 2ASJA 1LBLA 3SB0A 3HURA 4K8GA 3B4YA 3REQA 5HWNA 1KQYA 3PSWA 2POTA 1FXQA 4LV4A 5K2ZA 3PULA 4GIRA 1DWFM 2JKAA 4RUBA 3PW2A 1JUKA 4R7JA 2P8BA 4O0KA 3JZUA 5DBUA 3HJEA 1TWWA 5I06A 3PBMA 3IJIA 5D9NA 3WF1A 5A8NA 3Q58A 3SAZA 3QW3A 3N13A 2WZMA 1JYXA 1XHGA 5LNUA 3QFWA 4V27A 5ECUA 5T9CE 1R5YA 5CJNA 1FFQA 3GAYA 3VGHA 2IW0A 2JEQA 4TMCA 4GIAA 1JCYA 3LBCA 4GRSA 2FDMA 4MYXA 3KM8A 3WL1A 2P0IA 2R1MA 3TE9A 3L21A 1E0UA 2NX9A 2ABAA 2AQWA 3TKFA 4CQ9A 4QCEA 2FYMA 3GG0A 3H23A 1LORA 4F79A 4UTTA 4FA3A 3WQFA 5G4HC 4CNOA 4U6PA 2DZWA 3EWCA 1O5RA 5I3IA 4G7FA 4ECVA 4CN1A 3M0KA 4W88A 5CC7A 2BOGX 4K2SA 2G3MA 4CCZA 4L9XA 2VEPA 1HKKA 1Q66A 3C3NA 2C0HA 3L4ZA 2WLZA 3I7RA 5CZSA 3ITTA 4LYPA 1GG1A 4MFEA 3GUWA 5REQB 1IZCA 1P6CA 3QTPA 1K7FA 1UZ1A 3DKJA 1I4NA 7PTDA 5GNXA 1A3WA 4H01A 4J3WA 3W71A 3PZIA 3DYMA 3VUPA 1XDJA 1V6XA 3DN5A 3T42A 5HQLA 1I6NA 3A4AA 5L1KA 1IT0A 3TEVA 3Q8SB 2Y88A 3MUCA 4A8IA 1NDVA 1DE5A 3S5YA 3RHGA 3PR2A 4TV5A 3H53A 3ORWA 4Q4OA 2R91A 2ZX6A 3PBYA 3CV2A 1VBGA 1OWQA 3TMLA 5EWFA 5KFTA 4BEQA 1Q6QA 4IFOA 3LCIA 5HNTA 2PU0A 4MOZA 3HGOA 1JCXA 2W6RA 4DI8A 4WY0A 1XIGA 4AWTA 3HU7A 3UFYA 3QQWA 3TYZA 3K30A 2ZC1A 2Z28A 4S3GA 4FXSA 4IPPA 3NPUA 2PDWA 2DT0A 3AOFA 1YTDA 1D7KA 2VKZG 2IQDA 1A4LA 2X42A 3WG6A 3OO2A 2QAPA 3M9YA 2F61A 1GQKA 4AZ5A 3GFXA 1VQTA 2VDHA 2FIQA 3S1VA 2VA2A 2DSUA 2OZ0A 4ES4A 3ES7A 2OSXA 3C0QA 1VC4A 3CL8A 2XFRA 1HP5A 2GQ8A 2ALRA 2ON3A 8RUCA 3SCQA 3UPWA 2JBMA 4M7SA 1HZYA 1MZHA 5PTDA 3P0WA 3QV8A 1JD7A 4RPQA 3ARZA 4HNUA 4AC7C 2J7BA 5FESA 3KBNA 3PZMA 4GO8A 2AQVA 3AMGA 4DJEC 3MSYA 4S3KA 2PZNA 4U4MA 4DXXA 3L0GA 4PC8A 2Z1VA 3A4JA 1W2VA 1E43A 4WRHA 1D8WA 4C7GA 1VIZA 3VOGA 3UYCA 1ELSA 2G3FA 1KC7A 4IL0A 1SO3A 3SFWA 5KT7A 2WJFA 2PWVA 4BI7A 5A6BD 5MKGA 3BE7A 4WSKA 2WBKA 3WEZA 1IZKA 1FX6A 4E6MA 1VS1A 2W62A 2J9ZA 1TR9A 4JTKA 2DV0A 1A5AA 2Q8ZA 1FTXA 3KAOA 1VEOA 2P88A 4JTTA 4G1KA 3MUIA 2HVMA 1IIHA 2Z00A 5FAJA 3ZJ6A 2X0HA 5TF0A 3W2NA 4MB3A 3TN5A 4KBXA 3QGKC 1SW0A 4HPNA 4PTDA 3H7VA 3W75A 4ED3A 1S5WA 5AVHA 4NT0A 4S39A 2YYUA 4MB5A 1UWTA 2OYLA 3MR3A 2Z27A 1HX0A 1RP9A 1A47A 2VFGA 3ZT7A 1GK8A 5LYRA 1X98A 4PUEA 3B8DA 3P5ZA 2WSPA 2VCAA 4DJFC 1W9PA 3AHZA 1FBAA 2QS8A 1Q85A 4QJ5B 1X97A 3L0NA 3OA5A 1EJXC 4F8XA 3M41A 4YWIA 4CCCA 4J3TA 1FWNA 4H9UA 1DJQA 1UASA 4KT2A 2BHYA 4L4MA 4JV0A 1UBSA 3QQ1A 3WLIA 2ACUA 5AHNA 1FCBA 1VB9A 4CVUA 4HIBA 1G67A 2VFHA 4Z2HA 4AD2A 3GIMA 1JQVA 4GJ1A 1W3LA 4JN6A 5F2GA 5JQ9A 1RAKA 3GG1A 5H91A 3UG4A 1E15A 5DQIA 4WXZA 3HPZA 1PV8A 1EL3A 1VF8A 4O8AA 1CGXA 4UQEA 5FJPA 1C90A 3WN6A 5C9WA 3A12A 4NJJA 2VXNA 3II1A 3T9PA 2IKHA 3MP4A 3G1VA 3NQAA 1ZPTA 2YL6A 3EPIA 1TPFA 1PX4A 3OZYA 1XYMA 4DI9A 1L6GA 5I07A 1J18A 2C2DA 2FZDA 1QFEA 2CLLA 3MKVA 3TH6A 2CHOA 1J11A 1A5LC 3WQOA 3KX6A 4XD4A 2QPXA 3NQ6A 4Y8EA 4MDPA 2VZUA 1H7PA 1BYCA 4ROQA 4H9ZA 3KFTA 2XVKA 3XISA 3EXTA 1BG4A 3QHNA 3MYOA 3VABA 1UR0A 3S1UA 4O3PA 2E5DA 3BZJA 1B3VA 4EBDA 2HBXA 5BXPA 2YL5A 2C2RA 2YDQA 3UR2A 2H8ZA 3KRSA 3PP7A 4U10A 4TVDA 1EH9A 3ZSTA 2V3FA 2DDXA 1S5MA 4E5TA 4D8ZA 4XISA 1DV7A 2XFFA 4B4FA 4PTXA 3UJRA 4R53A 1XR2A 2YPIA 3DBPA 3GH5A 1E5NA 3AICA 3Q37A 4X0VA 1BGGA 5A2CA 2CW6A 4ERGA 2VGIA 2VEGA 3MBFA 2A3HA 4FO4A 1SSDA 4DWSB 2CBIA 4H4IA 1KFJA 3LENA 3LGEA 5I5RA 3GHSA 2GLKA 3U7BA 5HR6A 4F0HA 3SY8A 3M47A 1GZGA 3LTYA 4ZBCA 4U31A 5KG2A 1Q4NX 5HMSA 4Q43A 3VNIA 2R1LA 3W7GA 2ZKMX 1XYLA 2A85A 1FA2A 5F2LA 4AZCB 1FWFC 2PDHA 2PRHA 1WP6A 4LUTA 2DT1A 3GDTA 2YOCA 1XGZA 4WSJA 5KT4A 2PLMA 1V5XA 4XVEA 2OT1A 1GOIA 5HATA 1EUNA 1TZ7A 3MZ2A 4I9JA 4OE7A 1Q6RA 1EP2A 2NUYA 4L65A 4CQAA 3SEPA 2Q02A 4E8DA 3GYCA 1KM3A 3NSXA 1XQKA 4IP5A 4EX4A 1EIBA 2H90A 1QOPA 5BRPA 3BQ6A 4CN4A 1E9LA 4N6FA 1F7BA 3C52A 3W7KA 1GOMA 3MMTA 1FP9A 2PGFA 2WZIA 2C91A 3O1NA 1TB3A 4UOQA 2RDWA 2CLEA 2PCEA 2XH2A 3C2OA 1G7VA 4Q8PA 3LPGA 5CPQA 5E93A 5KZ6A 2H3BA 4LOCA 1B4EA 5I7GA 1N8WA 3EMQA 1ZJAA 5FJIA 3BJYA 3R94A 1YYAA 4NAEB 1MEWA 1ME9A 2HDJA 4A3HA 3O3RA 4LV9A 3W82A 5KITA 2PC8A 4AHPA 5L1IA 1LWHA 2RJGA 4YTUA 1OFOA 4IRCA 3OLEA 3WBYA 2P50A 3RITA 4JKLA 3BCJA 1M7XA 3R0KA 3THCA 4F0KA 3T81A 1FH9A 1UR9A 1XD0A 3APTA 1UC5A 1OHLA 5HANA 1GQIA 3GFYA 3LPOA 4OT7A 3KRUA 2HWGA 1JZ2A 4JZ5A 1OIFA 3ZJ8A 3MO7A 3OVQA 3BW2A 3T5JA 3R7MA 1O5QA 2AMGA 1YPIA 4ICCX 3RB4A 4NRRA 4V15A 3VX0A 4B3LA 3W1MA 4I9MA 1DWJM 5KG7A 5ENLA 1CLVA 1IEQA 1FKWA 3PFRA 4LANA 2EEXA 4JIHA 3PW4A 3E49A 3MS8A 2C6QA 3T08A 3E1F1 2GQ3A 3UY8A 3IK4A 1AZ2A 1Q6LA 3WLHA 2XSXA 1F3XA 3LM7A 1EJWC 5DANA 4LTSA 5T26A 1R0MA 4PB4A 3MFIA 1XH0A 4UB9A 4H3DA 5CAKA 2VEIA 1IT7A 4BWLC 4ICMA 4HBKA 4AZGA 2ANUA 3KP0A 5JH2A 1AG1O 3U5YA 3G1XA 3KBJA 5IHRA 5EWGA 3HQNA 1R86A 3EWUA 3R5EA 4BS0A 3TOYA 4FHAA 3NXFA 1PKYA 4AX6A 3I3BA 4QAIA 3AXMA 1V0NA 2ZFAA 3OVGA 4DWSC 3GLCA 1C92A 1B57A 2Y7DA 2GZXA 1TCMA 2C14A 4ZO6A 4AIOA 2QCNA 3CUHA 2D23A 4D6EA 3TX9A 4J9RA 2QCMA 5KFPA 2G41A 3M5YA 2IQTA 3A5FA 1F4HA 2QDEA 4GPNA 1LQ2A 4ADTA 2WMKA 1GYMA 2ZDRA 4AISA 2EBNA 3VD9A 2JGYA 3MYPA 3R79A 1FKXA 2BWGA 4GYKA 4NUWA 4JY9A 4LBRA 2WM0A 2EKGA 4PUNA 2Y8KA 3F4VA 3IJQA 2V2DA 3MA8A 2DIEA 1CBGA 4QROA 1ZBWA 1QNOA 1MEHA 1C9DA 3H2FA 1TMQA 1V7YA 2OH2A 1W54A 2ZZ4A 3PB0A 5D2XA 3IAPA 2J74A 3O2LA 1AH4A 1ZY9A 3KTSA 3UCQA 3LI0A 1WBHA 3V7PA 1XCWA 3B97A 1AQFA 5CSYA 5KETA 3VFLA 4PODA 5D02A 1DL3A 2BY1A 1TTJA 4AX7A 3UG3A 2YCKX 4MB4A 2V9DA 2BODX 2GVGA 2E09A 1CDGA 4L1WA 1KM4A 1R9ZA 3IJ8A 1GJPA 3DIPA 3D5HA 2HE5A 4UOJA 2JEFA 4Q4SA 4HCDA 2DFAA 4ALDA 4AWEA 3N9KA 3BW3A 4W86A 3WQWA 3UXAA 2G97A 2WW5A 2NUXA 4EBCA 4N9DA 1AQ0A 1S1RA 3H70A 4HNTA 4UR9A 4AHQA 3RN6A 3G1SA 2D0HA 4PMZA 1DWAM 4PH6A 2HXTA 3EA1A 1X38A 5HUOA 2NQHA 3ZM8A 2P8CA 3R0DA 3E96A 1W2PA 4FSAA 3H8AA 2XN2A 4BHYA 4URIA 4DNMA 3GIJA 2OX4A 4FOJA 2Y85A 4BCEA 2E6FA 1W9BM 4QFUA 2PGRA 4RPPA 1YHTA 3PBVA 1QRQA 3WH5A 4LAMA 4B5WA 2OEMA 2BASA 2NV1A 3TJXA 4GACA 1RR2A 4UXDA 5A8OA 1FWRA 4WF7A 1R7OA 1HXJA 4K68A 2Z2AA 3GC5A 4F3HA 4R8UB 5BYWA 1U33A 1ZRQA 1P0KA 3IIOA 1JCTA 4NU7A 4W8BA 4NQ1A 3XIMA 5AC7A 2B7PA 4PL1A 2ZX5A 1IQ8A 4YTTA 1W3NA 2WO5A 1EC9A 4GQGA 3VM7A 4DL7A 2WPBA 3HFYA 3F2CA 2E77A 2OB3A 3IIXA 4ACYA 3T2OA 3KZSA 2DZSA 2GK1B 5BWFA 1QMLA 4KKXA 1R87A 2XINA 1ZP4A 1FDZA 4UTHA 1KRAC 5FJJA 2VRJA 5D33A 2PF8A 1X6UA 3A13A 4EOUA 5TAOA 3ITXA 4GI8A 3F2DA 4U3AA 1RVGA 1Y5XA 1XCFA 4WGXA 3VTRA 3WF0A 2DVTA 1DP0A 3M0MA 3W72A 4XZWA 3CC1A 1JYWA 1WDWA 1TZZA 4LU0A 1SJCA 1W5QA 3WK0A 3RK8A 3WDIA 1LYXA 4XK2A 1B90A 5EB8A 2VFEA 2WQDA 2JQXA 3UNTA 4AH7A 2IKJA 3BZGA 3NFUA 1E4MM 1VR6A 4KFOA 3W7RA 1RLCL 1S2TA 3KOZA 3SY5A 3NR0A 4JTSA 4ZVJA 3EYPA 5AB3A 2X1TA 1O1HA 3OA3A 4AVOA 4EF8A 1W3JA 2WZTA 3U7VA 4QITA 4GQBA 4PMYA 2GJXB 3ARRA 4FPSA 3SN1A 4IFKB 4FXRA 4DUXA 1GVYA 3TK7A 4UFIA 2WZEA 4LVAA 3WKZA 3K13A 3BLFA 3D3AA 3M0ZA 4MPQA 3W00A 4C6CA 3WUGA 1YDVA 3U6WA 3MHFA 4IWWA 5LNVA 3OHMB 4MWAB 4S1FA 4LAUA 2UY4A 3CUZA 1UZHA 3GW0A 4QJ1A 2ZRWA 4W8LA 3ZVHB 3DFSA 1XRFA 5EGRA 5D8WA 1QTWA 2IQ0A 1ITUA 5FF3A 4HK7A 2WLYA 4BEUA 4F0LA 1WZKA 1LP6A 5LHFA 4GCAA 4HP5A 5CPSA 2BBFA 2XFYA 4XO7A 3E38A 1XIJA 4MZ1A 3CZGA 5BROA 1E70M 4C6PA 1V6TA 3KL5A 5KFIA 3M0LA 1GOWA 5IOBA 3TXVA 1JZ3A 4QQUA 4ZTYA 4UTLA 4AQLA 1Q4WA 1US0A 3PW5A 2VCCA 3T4CA 3N9RA 2O9RA 1BSLA 1YXCA 2UBPC 4QWEA 4ZQOA 1XJBA 3G8RA 3UF9A 3TU9A 1SPQA 3LHVA 4JIQA 3CT7A 2PGEA 1OVDA 2X2GA 2ADAA 1OBAA 4IGNA 1AH0A 5LNWA 3P8IA 1VCGA 4I9TA 1YBQB 4GNJA 1OSEA 4EEYA 3TSDA 4DBSA 3DGBA 3W7PA 1VFOA 1WOBA 2G95A 1K9EA 3ECQA 5FF0A 5F1VA 4Z1AA 3CEPA 4DLMA 5XIAA 3ABZA 2YA2A 4M56A 1S3TC 3AZRA 1HJXA 1EO5A 2V68A 3MUY1 5D2WA 3GU9A 1FWWA 5G4WA 1U2YA 2VGFA 3CTLA 1ONXA 1VBHA 3FYPA 5LKYA 3W76A 4DAFA 2Y5SA 1M41A 3C0SA 4J9PA 1EC8A 5D8ZA 2JE8A 2J8FA 3QSTA 4J3ZA 3BH4A 3EEZA 4ECWA 1ZFJA 4N02A 1F74A 2E5CA 3GV7B 4K36A 2DW7A 1JJKA 1XIIA 1WDSA 3TR9A 1TX2A 2CU0A 1NM9A 4HT3A 1ISYA 5DY2A 4AF0A 3UXDA 3BAIA 3RRXA 4DRSA 1XLMA 3STPA 3DU0A 3I7QA 2ZTKA 4DVOA 4XSMA 4GZIA 3WMLA 3TJ4A 2H3DA 4GX9A 1WZAA 4AWSA 2ZZ2A 1F5ZA 3QKEA 2EJ1A 4HNCA 3SQSA 2YA1A 4GKTA 5J8LA 4NX5A 3D6NA 4O54A 1JZ5A 1ZJHA 2Q8LA 1R2TA 4F40A 2ZZ3A 4P8VA 3L2IA 3SRFA 2A3EA 1CIUA 4Q8FA 2O55A 4MNLA 3UR5A 2R1PA 1PX8A 3CNYA 2OU4A 4TX6A 4HU3A 1V6VA 1OT1A 4PUDA 1I9CB 4JEQA 8A3HA 3HGRA 1V3IA 2HRWA 3MP5A 5GPRA 3N4FA 1X8FA 3VOCA 3F7JA 3S42A 1TZ9A 1DVJA 3A3HA 3GTNA 1JQXA 4H2CA 3RU6A 4JTIA 1TKKA 4YMZA 4RV3A 3GXIA 2EPOA 5D9OA 5A6LA 2IPGA 3RCYA 3PJXA 2B7NA 5KZMA 1Q5MA 4H00A 4XAYA 4H04A 1H51A 3WLJA 3OBKA 1RJPA 2ISFA 5CXPA 1JXLA 3L4XA 3BG9A 4B2DA 1ECEA 1XKJA 2F6UA 3UT0A 4EAMA 3HO8A 4C1NA 1YKWA 1PL9A 2TAAA 1EZWA 1UHVA 3AC0A 3MC5A 3L4TA 4WJEA 4QWAA 5TBOA 3WNNA 4O57A 1QT1A 3THDA 3N2OA 1UKSA 5BCAA 4MWAC 4UMAA 4HNVA 1Y7VA 1QXLA 3S83A 1ONRA 1VYSX 3QMTA 2O7QA 2PDIA 4AVFA 1M9HA 1F76A 2DZUA 3WNLA 4ZO8A 1K1DA 4KWUA 1TV5A 3H54A 2G3NA 5T91A 1XIFA 1QBAA 2C1GA 1Q7MA 3ATYA 2J77A 4LB3A 4XIMA 1JAKA 3PBWA 4MPKA 2D22A 4JN7A 2XIOA 4KEVA 2W9CA 3TFXA 1FWAC 1DWIM 4Q4RA 1ZZMA 3H4DA 4QXIA 1MRAA 1D3CA 1NAL1 1PUDA 3GQCA 4DJEA 4IIHA 3ZO9A 2MANA 1A80A 1K1SA 3PPGA 4PULA 4MVAA 2XGPA 4JNMA 3GBEA 1NP0A 4GIYA 2POZA 4WJXA 4HMNA 2O92A 3URNA 3CLWA 4AYSA 2Y8UA 4AZBA 4DJDD 3ARYA 1CGWA 1R2SA 1ISVA 3D3FA 3LQGA 1XFBA 2DSZA 1NWUA 3BAKA 1J93A 5EMKA 3AU2A 2AKZA 4D1IA 4Z17A 3DFPA 3PJTA 4P61A 3H2NA 4WDTA 4XZIA 4E2DA 1E1CA 2DPJA 4R85A 4XB3A 1CGTA 1MW2A 3N2CA 3ABRA 3ALGA 4EWJA 4IJBA 4AB4A 1N8FA 3HG4A 5A2AA 3FV9A 4FALA 4WCJA 1TQJA 3PZNA 3NQ8A 3NO1A 3VGDA 5I78A 5GNYA 1MNSA 2GJPA 4Y8FA 4G2DA 3ZT5A 2VNCA 1RCOB 1E6QM 1OG6A 3AXKA 1TPEA 3U4FA 1K8CA 3KDNA 2X0SA 3E5BA 2PTZA 4L6DA 4V1YA 4C6QA 1AJ0A 3LXAA 2J7DA 3GG8A 4NNCA 3UG5A 3W24A 3SCPA 3QH2A 3NQMA 1L6SA 2A7PA 2IUZA 4UQAA 3RX3A 3VCRA 4IL2A 3B0UX 3PAJA 2FB2A 3HFTA 1HJVA 1R30A 4ZQRA 2XSAA 1IWPA 4MFDA 2VURA 1SR0A 3G0UA 3HIJA 4KIRA 2CLPA 2ZE0A 3OZPA 2XPKA 3UZJA 3IUHA 3L4UA 4US5D 1YLVA 1ALDA 1JL8A 3NQFA 2CERA 4IR9A 1FCVA 4Z0SA 1LUCA 3FAWA 4CNNA 4IMDA 4KEUA 2OSYA 3UJ2A 1EKOA 3W07A 4K8HA 1G4PA 3N34A 4FK9A 1ZHAA 3RCNA 2PTYA 2X0YA 2QJIA 1ITXA 1EXPA 3CJPA 4ZFMA 4Z2GA 1OT2A 1FOBA 1ONEA 1QNSA 3ATZA 4M80A 2PPGA 3WBAA 1H1ZA 4YTQA 2V5JA 2FTPA 3REQB 1T0OA 3P82A 5KEZA 3Q4DA 1LBFA 2X1UA 5KFUA 1V7AA 1H7WA 3OSPA 1X1OA 3WH6A 5CGTA 3YPIA 4EYIB 4FS2A 5M17A 1XUUA 4ED2A 3WELA 1V93A 3CUGA 2PA6A 3CYJA 1AUSL 4B92A 1IGWA 4CEUC 5FOOA 2QCFA 3LHYA 3PNZA 1H50A 3OHAA 1LT8A 2CLFA 1VAHA 2W4XA 2A3CA 2BOFX 3AYVA 1QHPA 2Z1XA 2FDSA 2VHLA 1N2VA 3GUGA 4AD1A 1IGSA 1LL4A 4NZCA 3OBEA 4PMNA 3CBWA 4TOQA 2V2HA 4C5YA 2GVEA 1RPKA 3AIUA 3PPCA 3W73A 5C54A 5CEWA 7CGTA 2JALA 1OIMA 4X61A 5FACA 4H9VA 3VCCA 2WYSA 2R14A 3UD6A 3PZQA 3VDCA 4D71A 1X6NA 1UWSA 1BF6A 4JTLA 4YVVA 1X1NA 1PBGA 3ERPA 1MWOA 4BR1A 4WD0A 5EYWA 5KG0A 4W84A 5DRIA 2FPYA 1I0BA 4MKNA 2DSWA 4YPJA 4JFVA 3P84A 1US3A 2QV5A 1V02A 1Z89A 4JCLA 1MDRA 4TQTA 4BQ4A 3L9CA 4C6KA 1J6PA 5D03A 1Q6EA 2PAJA 4UQDA 5M2FX 1IWBA 1KM6A 7ODCA 2ESCA 3NVDA 2GWNA 2O7SA 4OV9A 4QCFA 1KBBA 4ECZA 5AY7A 1H11A 4P8XA 2VVSA 3AAMA 2RGMA 2VC9A 1Q6CA 3IK2A 2Y63A 3CZKA 4DQWA 4M29A 2BLEA 4ED1A 4O3SA 1NSJA 4O3QA 2GL5A 3ZLGA 4XKYB 3A21A 4RZ5A 1E1FA 3A47A 3KOYA 3UWUA 3GXNA 2QMKA 4HZMA 2CHRA 2QJMA 3CK5A 5CSUA 1V3MA 5K3VA 1XFCA 1TVLA 5DT5A 1H7RA 4US6A 1BAGA 3W1XA 1QI0A 3AMLA 1KV8A 5M3WA 1NQ6A 5BRQA 4IZGA 2BVYA 4BJHA 4UFHA 4AEEA 3LLXA 2D69A 3P7YA 4WK9A 5LNRA 2R24A 4R27A 1IXPA 1E72M 5ABGA 1Q7QA 2ZQ0A 4RDWA 3S5OA 1Y0EA 4XX6A 4WY0B 1DJHA 3T05A 1T5AA 1GPFA 1BXCA 1ZBKA 2F2KA 6REQA 2XTKA 3V36A 4HMEA 1KGUA 3EPNA 4JTHA 3DERA 3QC0A 4RV8A 4QE4A 1WKFA 3NEHA 1A3HA 4HJWA 1E6XM 1GVOA 4MSSA 4O53A 4TVCA 4GFIA 2C28A 4PUWA 1NFBA 2ZZ7A 1J4EA 2FH6A 1R6WA 5AHLA 2J25A 2WSKA 3S2LA 3MDUA 2C1HA 2V5CA 3RO8A 3ABOA 2WMGA 2B4GA 3FHQA 1QI2A 3DAQA 2YLLA 3LZ3A 4D2JA 2FJKA 3RLHA 1IHIA 1OCQA 1TMLA 5LGZA 1C8YA 4DF1A 3GNPA 3POCA 3MPGA 2VO5A 3VI2A 2A79A 4NP7A 3EA2A 4J9OA 3BCDA 3W7LA 4AHOA 1G1YA 4XZBA 4B5VA 4O1DA 4CU6A 1PKNA 5EL1A 3VGFA 1H7NA 4H8NA 3GXFA 4M3PA 4BI6A 3EX4A 2ZOXA 5MKGB 2RAGA 2ZCGA 5EKYA 2AQOA 3H40A 1E6PA 1YNQA 4A3RA 4R88A 4ZB5A 4ZXLA 3DKLA 4CUCA 4IRKA 1PWMA 4BWLA 1K9TA 3V75A 1C7SA 1UD2A 4XZ9A 3U48A 3N3MA 3NQVA 2BR0A 4Q8WA 3GAKA 4IJRA 5D9PA 3ZFHA 1NF7A 1OX6A 4LYKA 4QRNA 1X96A 5I79A 3GGMA 3EWBX 3TTQA 3NQ7A 2PWGA 6TIMA 4NKCA 4H8VA 1NDYA 1PSCA 4UTWA 3EWXA 1LOQA 3FXGA 5I09A 4GJIA 3P93A 1LLOA 3QQ0A 1KNWA 1W1YA 1MVYA 3R6IA 3EDFA 4LPCA 2BY2A 1O68A 4MDOA 2QUTA 1Z3NA 1CECA 5M5DA 4DIAA 1CXHA 3PUOA 2CIPA 1UC4A 3FJ4A 4E2BA 3MR6A 1T96A 5CSRA 4P7NA 3T2PA 2XGIA 3DESA 2IMWP 3RJYA 4WLCA 2PLKA 4GUGA 1MW3A 2PC4A 1F3EA 3WYZA 3WSUA 2PS2A 1E4NA 5FSEC 1R3SA 5LIUX 1W32A 1LLWA 4PTVA 1IT8A 3H2MA 4WDXA 1NJJA 3IUIA 4BQ2A 4AUBA 3AU6A 1VFFA 1LZOA 5IXEA 3GM8A 3TJLA 2QJNA 4JTUA 4ECTA 3SCUA 2OZTA 1VD6A 1XV8A 2V4QA 4HSNA 5BNKA 3NGJA 2HROA 3NG3A 3N29A 3MHUA 5TNVA 2VRQA 2XIBA 3LQLA 2QJHA 3ZWSA 3L5AA 1ZNNA 2VCBA 3TJIA 4FBTA 1JZ7A 1O6IA 3AMKA 3ABXA 5EMYA 2W91A 1JDAA 2DZAA 1TG7A 1YNYA 4V2XA 3IGXA 4QDPA 1TSIA 3EWYA 1UKOA 5HJYA 5JUVA 1KLZA 3UESA 2VFIA 3OLDA 3CQIA 1W1A1 2ZUMA 5D2YA 5U7SA 3VVGA 4O1AA 2B7OA 5F2IA 3G1RA 5AYYA 4JYFA 3NOEA 1XYCA 1S97A 3SO7A 1RBOB 4JQ4A 3IJ7A 4AZ7A 1OC6A 1WZMA 3H7RA 4LUSA 1I75A 4XIAA 3CL7A 3EDKA 5JBDA 4YNGA 3VGBA 2E7FA 3HOJA 3PWGA 1HJWA 3GXTA 4DBWA 2Z0IA 1OX5A 1I45A 2J7FA 5KFOA 3VPLA 3GIQA 4J3SA 2TMDA 1NFPA 2OVLA 1B9BA 3BWWA 4HZ8A 2X7WA 1O1ZA 4YLWA 1KM2A 4WGHA 7REQA 1CB7B 1OADA 1V6UA 3M46A 3N15A 4ZZ9A 2E8ZA 3M5XA 4KCUA 5EFDA 2J79A 4FI4A 3THAA 4QNWA 5CGMA 2QCDA 1BFNA 6XIMA 2A1YA 5KFLA 3LG3A 2BFGA 2RDXA 1H41A 2O0TA 2Z26A 3N11A 1WAUA 1DPMA 3SI9A 3WNPA 3LUTA 4YL2A 4WIWA 2FZBA 3W22A 4LUTB 2XGZA 2E8YA 1E5JA 2YR1A 1U1UA 3IJ9A 2ISSA 4ZL1A 2VZTA 3O0FA 2C16A 3DOPA 2J75A 3VUSA 1CB2A 5A1AA 4LC6A 3LYEA 3T55A 3P67A 3W1AA 3NM1A 2QQ6A 1DYSA 5DQHA 2BGSA 3ANVA 1GONA 3U8GA 1P7TA 4IISA 2HS6A 3HM7A 2HISA 3WMBA 1VPQA 4PMRA 3TROA 3W2MA 3AALA 1B4KA 1C93A 3I65A 1LWJA 5BXRA 4PFMA 3WQGA 3CHCA 5B80A 5CZKA 4JTGA 4QW8A 3SCNA 4ZEPA 2L5HA 4L4PA 2NLYA 3USBA 4NL1A 4N42A 1DJIA 3FIGA 1IYXA 1R3YA 4YU1A 3QKZA 2V81A 3IGUA 2PD9A 1BWVA 3WUBA 3AMDA 4CU8A 3WLSA 1OYCA 1UIPA 3BSGA 3FJNA 2J88A 3E0IA 5FAGA 3HPFA 4PMQA 2AKMA 1H3GA 1H5YA 4Q8EA 1TMHA 3CGTA 1H2JA 4RL3A 2V6AA 3NO3A 4KS0A 3UZYA 3W53A 3NQCA 1EJ7L 3HMCA 3O6YX 9CGTA 1MSSA 3S0CA 1TO3A 4V28A 5KFCA 2BG5A 2NX3A 4HPXA 4FIQA 4EYHB 1CXIA 4O13A 3JUGA 3PC0A 4GA8A 3AIEA 1X1ZA 1TVPA 3EOLA 4MF4A 3W1QA 4QWBA 4F9JA 4NF7A 1J0JA 4GBUA 2GSEA 1OF6A 3VNKA 4QHRA 4XZLX 5E9AA 3LRMA 4FS1A 1A5UA 2FB3A 1M7JA 1XUZA 5DG7A 4M24A 5TIMA 2QAFA 4C60A 4CKQA 3FYOA 2ZC8A 2H6RA 3MWAA 4QG6A 3MJMA 5EA9A 2WNZA 3LS9A 3C86A 4FF5A 3N2TA 5F4WA 2ZUTA 5JIWA 3B9AA 2Y6ZA 2C22A 2FFIA 3RB6A 2ZZ6A 1VP5A 1KCXA 3TA6A 1WDDA 1PO9A 1DBTA 3EEGA 4DYEA 2ZWZA 2UVUA 3W02A 3TN4A 5J04A 3CAQA 3V0TA 4MKSA 3CUIA 3JU2A 1ZBVA 4LCSA 3S4TA 5KT2A 3C3UA 1CNVA 3O9NA 4WZHA 4O17A 5AHMA 3NXLA 3GC2A 2IS7A 4W7UA 5KT6A 1YXDA 3SZ8A 4E3TA 2QUUA 4KERA 2J8GA 3NL2A 1EP1A 3TNBA 2ZXBA 2QHAA 4OQVA 3NDOA 3VNJA 1HP4A 4EANA 4Q33A 4JQ2A 3P14A 4Q8UA 3M43A 2CC0A 3B9OA 2XGBA 5LA2A 4Z1YA 1WDRA 4F4RA 3D0CA 2PUZA 4ZE5A 1J6OA 4PR4A 2YCLA 1WUEA 3KHHA 4Y96A 5IDIA 2VC5A 2DEPA 3SSJA 3F03K 1PE1A 4KCWA 3M0JA 1PEZA 3RXZA 1SGJA 2Z7GA 3HB9A 4N7QA 1JCJA 4V33A 3DEQA 1NOWA 1VFUA 2FZ8A 3VNMA 4W85A 2A3BA 4C6EA 5TD4A 4A22A 4D6CA 1KXQA 1S2AA 1T8XA 2BB0A 2OOFA 4PRTA 2QCEA 3P74A 3MI6A 4Q4QA 2YW3A 3EX2A 4WQ6A 3T40A 1UZ4A 3EMZA 4AWUA 3L4WA 2CWNA 3VKKA 1GOXA 2PWFA 4EBEA 5A3HA 4TQRA 5LNSA 1CGUA 3L65A 3S5NA 1GQJA 3FYYA 4AZIA 5DCBA 3T78A 1ZUAX 3QHMA 3H21A 3IIZA 3A4XA 3BUVA 4HMDA 4DL6A 4DY1A 3AUJA 5BU9A 1AMYA 1UP2A 1EXBA 2D3NA 4H6EA 2UV8G 4E4UA 1Z6KA 4B3KA 3PUEA 3W28A 5C5YA 3KRZA 5CBJA 4RE3A 3OEXA 3IANA 4IUOA 2CZEA 3BAWA 3WF3A 2FJUB 4TU1A 4J9MA 1S0NA 4M6PA 4PCSA 1Z69A 3H2OA 1SUXA 4LB4A 1W31A 4GXPA 4K39A 1TPUA 3KHJA 3VKDA 1T41A 3AHXA 4PRWA 3UERA 4CD8A 2FMOA 2GVJA 2WWCA 3LX9A 3VDAA 1KKRA 3D46A 4JICA 1N7KA 4DYJA 3AXHA 5EBUA 2PEVA 1QHOA 1REQA 3WLPA 2XM1A 5GQBA 3FKKA 1RQHA 5HPCA 1FWCC 1SR9A 1UD6A 1YDOA 4IMGA 3H12A 3TZFA 2HK0A 1Z42A 3K4DA 3ZR6A 1R3RA 1HQTA 1M7OA 3GX9A 3MR5A 4Q7BA 3NCOA 3RPMA 5H8MA 4L64A 2ALDA 2XH4A 2JGQA 3UWQA 3EXSA 1AVAA 1R9YA 1LQAA 2NV2A 3WFZA 3A3WA 1P43A 2R8WA 3SURA 1WV2A 1JYNA 4B4HA 2PDCA 3PUGA 3GHUA 3W7HA 3WMCA 1ICPA 2Z4GA 1TWSA 4XAFA 2GVLA 2ALZA 3E2VA 3SDOA 4AYGA 1XF0A 3CQJA 5KMYA 4KWWA 4H7ZA 2GSJA 1KLYA 3WQ4A 5KFWA 4LNCA 4WDWA 1NDWA 3LI1A 4K1WA 3TFCA 2Y7GA 1S0OA 3OVPA 1A3XA 1J5SA 5HAOA 4YN5A 3F4WA 2QLYA 3WENA 3BJSA 1H49A 5IM51 1ECQA 4J9SA 5F9NA 2O9OA 1FH8A 1G94A 1Z7AA 5F4SA 4EACA 3G1FA 4DZIA 2CKSA 1I60A 3PFMA 4RNIA 1GZ1A 1QR7A 1WPCA 3PM6A 4ORMA 2YIHA 1ISXA 3PHAA 4UWMA 5LXXA 1JPKA 1OFBA 4DJFD 3VD5A 3TYUA 4WHBA 3VIIA 4OV4A 4GY1A 2BY0A 1VFSA 2O56A 3BOXA 4RNHA 3GS6A 4DM2A 4FNSA 4ZQPA 4NI8A 4IMAA 1PCWA 5FSDC 3WQ5A 3CHVA 1IR2A 3TQ0A 2VOTA 2FLIA 1KQZA 2ATMA 5HJLA 1DJYA 3M07A 1PPIA 3NZPA 2Z2BA 3BGJA 2ZUUA 3OIHA 1K4HA 3MHGA 2OEKA 3TYAA 3WJWA 4BQ5A 1R3VA 1UG6A 2HNHA 1EPXA 3G24A 4MG4A 2F9RA 2WK2A 1SJDA 4O15A 3NYZA 4AD5A 4DL4A 3RGTA 2R6OA 1M7PA 2C8NA 1PIGA 1EDQA 4PN2A 4J4KA 4NYUA 4OBRA 4H2HA 3S1XA 1ZSXA 1CGYA 4QLJA 1VPYA 2C71A 4EWND 4FLOA 5CPMA 3K4AA 4E3VA 3AXXA 2PU1A 3G1YA 3VDHA 5IBXA 3TTOA 1ZB5A 1OJXA 4HKPA 3SCWA 2HK1A 2FLPA 4LVGA 3MMUA 1LTDA 3W1UA 5DY3A 4ED0A 4OZOA 5D37A 5AC4A 4DX3A 4W4QA 4ZOAA 3CS2A 5H8PA 4JDYA 2DJXA 3DH7A 3H24A 3T0AA 4NZ1A 1G01A 4AZHA 1BVNP 4YR3A 4JHMA 1GWJA 1PZ1A 2WC7A 3NDYA 3R4IA 4YIWA 4EPDC 2AAAA 5KZEA 3S6OA 3BJTA 1PIIA 2WOQA 1EX1A 1OFAA 2WJZA 4XZHA 1G7UA 1XL9A 1O7AA 4H1ZA 3W2KA 1S2CA 2ZX8A 3GXDA 4NJIA 1U30A 1OG0A 1IEXA 2AGQA 1NWRA 4P8WA 2OGJA 1SZNA 1W3KA 2VMFA 2QULA 4NNAA 2VD8A 4AF0B 4AIUA 3WNKA 1JRCA 4FLSA 2E0PA 3RYSA 4ZR8A 5KFSA 4U5KA 1RJQA 2PF0A 3M0HA 4NZ5A 3TQ1A 1KM5A 4JX4A 3LCLA 4PTWA 3ANYA 2E40A 2REQA 3EKLA 1TV3A 1YW1A 3CPUA 1HFBA 1IEVA 2ONEA 3FN9A 2W63A 4NJKA 4AU0A 3AIRA 1HKJA 3PG8A 1KCZA 2OZ3A 2A6NA 1LROA 3LBMA 5E0CA 1FHVA 3C2VA 3Q67A 2GGIA 1X39A 1YDYA 4Z0JA 1SZGA 2EPHA 2J7EA 4HHLA 1HKVA 2BY3A 3CWOX 1CI1A 1OX4A 2WVVB 1WO2A 1KFLA 3KBWA 3MVIA 1XLIA 2IXVA 5MF5A 3W7CA 1YPFA 3LHZA 2OR2A 2XN1A 3A3XA 2V30A 1JIHA 2QPUA 1OQFA 2EJAA 4H9XA 1EA9C 3AXIA 4Q45A 3CIVA 2ATSA 3N14A 1UH3A 2YB1A 1W1TA 1DQXA 1W1PA 2X41A 4Q7IA 3C8FA 4M19A 4FNQA 4Q22A 3A23A 5LIXX 5CBBA 3T44A 5FCZA 4C1NB 1F73A 3ZQ9A 1O5KA 1I2RA 3NPXA 3GYEA 2XVNA 5HPOA 3TW9A 1XIBA 5C5JA 3FKRA 4LBUA 2Z1KA 2YFNA 3W0KA 3DC0A 4JFSA 1B3ZA 4Q44A 4IHCA 4LBSA 1B30A 5G1MA 5HQEA 1G4EA 1XW8A 2Y62A 4QW9A 1PAMA 3GB6A 1A5BA 2VRKA 1KM1A 2I5IA 2W8KA 4JHOA 1W17A 3MANA 3UJFA 4O16A 4RR4A 5FI8A 2RKXA 1A0DA 4LGXA 1BYBA 2ZWYA 3V5FA 4XD3A 3CIWA 1KXTA 4M6QA 4I3GA 2HPMA 1DIEA 4DL3A 3DC8A 1AA1B 4FX8A 4GFSA 1W9XA 5IHSA 4S2BA 2V5KA 4MM1A 4CQBA 3UJSA 4ERIA 3GQYA 1C8VA 5KFHA 2W9CB 4O50A 5LIYX 2A7NA 3LBOA 5EFFA 3W1PA 1QATA 4GH3A 3BTNA 2KX9A 3PANA 3OGSA 3EMCA 3B03A 2D2JA 3RM8A 1GUVA 2BNJA 1ME7A 1G6CA 1Q7ZA 2XFWA 1SFJA 2VL4A 4A8RA 3KUMA 5K9DA 3O63A 4HQVA 4QEHA 1HO4A 4DPQA 3STCA 4LVBA 1TPC1 4E8GA 3AFBA 3MQTA 1FWJC 2WPGA 3G18A 1LWIA 1HTIA 3WD3A 1YE6A 3SGUA 3VIOA 3IN5A 3NQEA 1OGBA 1K9FA 2YX0A 4Q3MA 1VJIA 2INFA 4NYYA 1SFLA 4GE8A 4UQBA 4NILA 2FGZA 4MMWA 3PTQA 3PZ9A 3KVJA 5L9FA 4HA1A 2TRSA 1B3OA 2QUMA 3EXRA 2CXGA 1HIZA 4B16A 1E1CB 4DXKA 5E09A 3CHFA 4DWSD 4JFWA 3EOEA 4GZJA 1V51A 1V0LA 2EF9A 4RDVA 5FEXA 4ZENA 3WQVA 2JF7A 3T09A 1KB3A 2X09A 3CUFA 1F8MA 5F9LA 3GV5B 3ZYZA 3AJ7A 4JOMA 4A05A 1O95A 4RE0A 2DUZA 3EB3A 4LF1A 1AL7A 4TR9A 3H26A 2C79A 4N4QA 1AL8A 1OEPA 2DU2A 2AQ4A 1VFLA 1EBHA 1JI1A 1E6SM 7ENLA 1POKA 3VNZA 1GT8A 2R82A 3W1NA 2G37A 1CCWB 3QZ7A 1KFWA 4ECXA 3V5OA 5CG0A 2GJNA 4HSHA 1JXKA 1PJ9A 4Q8OA 4J7RA 3GR7A 4PMVA 3MI2A 5DXYA 5C9XA 1UWUA 3P80A 3W87A 1EJRC 2WAGA 3B8VA 2OWCA 4FX7A 4XKYA 2W67A 2GOKA 3RFAA 3WUFA 1C91A 1LUCB 2HEJA 3N04A 3FA5A 1NTHA 3TAOA 3KTXA 3BMVA 1IE7C 2JFEX 3DGRA 4PB3A 4MUZA 3HG2A 2E9MA 2PDLA 9RUBA 4DWDA 3ZLHA 4ZO7A 1OZMA 4WX2A 2DY3A 1GG0A 4KRZA 5FJOA 3W6LA 1XIEA 3E3HA 3QZAA 3QBUA 2I5QA 2Y24A 3FA3A 3MUXA 4LUIA 5CCZA 1CT5A 2BQUA 2CLMA 2E68A 2JIWA 4KFPA 1XSIA 2O4MA 5L1LA 3SQLA 4I5RA 3BLDA 1XC6A 2PDMA 1KBLA 2VWTA 3FDSA 2JKEA 3OTRA 3HGJA 1E40A 3FVDA 1XPYA 3G6MA 4GUIA 2WCGA 4YXGA 1PXGA 4N9EA 4YP3A 2YDAA 3GTIA 5A8MA 5BXSA 1LM1A 4GG9A 2ISWA 5HQMA 1EJUC 4UNLA 3B0XA 1XICA 1G4TA 3O8AA 1D2KA 1DHPA 1WKYA 3V6KA 3CH9A 2CHNA 5IFPA 1O12A 2JK2A 4ATWA 2WSRA 1N55A 3UZ5A 1U5VA 4KCTA 1R7AA 3W27A 2UWFA 3H2AA 3VGGA 5C7HA 4Q8QA 2Y0FA 3FOKA 1E6RA 3DX5A 3DUGA 4KW2A 1K70A 3PWAA 2CYGA 5A8PA 2R1NA 2ZICA 3BAYA 2P3ZA 3NNTA 1J9YA