2PLMA

Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
404
structure length
404
Chain Sequence
b'MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure-based activity prediction for an enzyme of unknown function
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
total genus 146
structure length 404
sequence length 404
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2plmA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2plmA02
2EG7A 4KEVA 4IGMA 5HMDA 3PAOA 2QPXA 4IQJA 3B0YA 3SFWA 4EPEC 4MUPA 4DNMA 1FWHC 1KCXA 1V7AA 2YZ5A 4LCRA 4UBPC 3G77A 4IFOA 2FFIA 4HA0A 4ERAA 4GYFA 4LALA 3LGDA 4C65A 4NI8A 2OOFA 1I0BA 3IGHX 1FWBC 1FKXA 4LFYA 5HMEA 3RHGA 4XAFA 2ADAA 1RK5A 4CNTA 3B40A 2DVTA 3O7UA 2A3LA 3HTWA 4KEUA 2VHLA 2I9UA 4F0LA 5E5CA 1RK6A 2RAGA 2YXOA 4RDVA 4KF1A 2R1KA 3JZEA 2AMXA 2XIOA 4F0SA 1FWGC 3A3WA 1UMLA 2HQAA 3BE7A 4XD4A 3DCPA 4XD3A 3K5XA 1J5SA 1PB0A 4QTGA 3GTFA 3IRSA 4WHBA 3GTHA 2OQLA 4DI8A 2P50A 2DVXA 2WM1A 2R1LA 3RN6A 3LSCA 3FDKA 2CZVA 4LEFA 1UBPC 1P6CA 4DO7A 2W9MA 1XWYA 2BGNE 3TN6A 4Z42C 2VC7A 3EGJA 3T8LA 2WJEA 1XGEA 3IACA 3LSBA 4C6NA 3QY7A 1GKQA 4PBFA 2PUZA 4LCQA 1P1MA 3FEQA 4B91A 4XAGA 3OU8A 1EJXC 2HBXA 2Z7GA 1RJQA 2FVKA 4IFKB 1NDWA 4C6MA 4L9XA 2PLMA 1R9XA 4V1XA 2HPIA 3PNZA 4PE8A 2E25A 3EWDA 3UF9A 1NDVA 4KERA 1POJA 4I6VA 3MVIA 4KETA 1FWCC 3B0XA 2VUNA 4C6LA 4HK7A 1A4MA 4HK6A 4QRNA 3K4WA 3WMLA 4DZHA 1ONWA 3GU1A 3DUGA 3R0DA 3KM8A 2FTWA 4OFCA 4IG2A 3DC8A 2QS8A 1QXLA 2Q01A 3F4CA 1M68A 4PBEA 2BB0A 2AQVA 4B92A 1K6WA 4EP8C 1PTAA 4XD5A 3GIQA 3ITCA 4H9VA 2G3FA 4CQCA 3URNA 2GOKA 1J79A 4DIAA 3OODA 2UBPC 3IV8A 4IGNA 3T1GA 1V51A 2R1PA 1S3TC 1NFGA 4WGXA 4XAZA 3AU6A 1V79A 3S2NA 1RA5A 4CEXC 1R9ZA 4DLFA 1V77A 3E38A 3GU9A 3E3HA 2Z29A 4CNUA 4G7EB 4YIWA 3O0FA 1EJRC 3CJPA 5G4HC 1YBQA 1I0DA 4BY3A 4GC3A 4BKNA 3ORWA 4H9ZA 3LU2A 4GOAA 2HBVA 4RE0A 1WXYA 3NURA 1ITQA 3IPWA 3GIPA 4C60A 4IG2B 1EJWC 2EG8A 4PCPA 4LANA 2WJFA 4BJHA 2Q09A 2ZC1A 3MKVA 4GY7A 2D2JA 1A5NC 4AC7C 1EJUC 2UZ9A 4HK5A 4WVXA 3WZ0E 1FWFC 4C5YA 4E3TA 4DI9A 4INFA 5HMFA 3UR5A 1PSCA 4C6OA 2E1WA 2ICSA 4IH3A 4RZBA 4NP7A 2ANUA 1YNYA 4KESA 4AQLA 3AU2A 2Z4GA 1RA0A 3NEHA 4C6JA 4H9UA 2EG6A 3MDUA 3MTWA 4H9YA 1J6OA 3TN3A 1EYWA 3GUWA 1KRMA 3ICJA 2VC5A 4GK8A 1V4YA 2OB3A 4EPKA 5AKQA 1FWAC 1DPMA 4H9XA 3F2BA 1FWDC 3LY0A 1YRRA 2P53A 3S2JA 2QVNA 4QS6A 3URBA 1ADDA 3QY6A 4H9MA 1A5KC 4R85A 4LAMA 4XD6A 3UBPC 4J5NA 4M51A 3GTXA 2DVUA 4B90A 4LH8A 3A3XA 2P9BA 3T81A 4XAYA 2R1NA 1E9ZB 1BF6A 5FSEC 2WJDA 4PCNA 3LS9A 2Z28A 3CAKA 4B3ZA 4IF2A 3OJGA 4J35A 4LAKA 2YB4A 3E0LA 1J6PA 1XRTA 2GWGA 4R7WA 4ZSTA 1YIXA 1WXZA 1GKPA 3TN5A 3S4TA 3HPAA 3A4JA 1R9YA 3RCMA 4ERIA 2O4QA 3F2CA 4J2MA 3UPMA 3CS2A 4QSFA 4JOMA 2IMRA 1EZ2A 2GZXA 1EJTC 3UR2A 1O12A 1KRBC 3RYSA 1FKWA 4L6DA 2Z00A 1EF2A 2VR2A 1FWIC 2Z24A 3C86A 3IARA 4DYKA 2GWNA 3F4DA 3IJ6A 4ZSUA 1A5OC 1UIOA 3QGKC 2PGFA 4C6DA 3AUOA 4I6KA 4EPDC 1A5MC 3E0FA 4G2DA 3MJMA 1EJVC 4KEZA 4C6KA 3SO7A 4C6EA 3TN4A 4GZ7A 3ISIX 3K2GA 2Y1HA 3GGMA 2GSEA 2OGJA 3FDGA 4C6IA 1RJPA 3MPGA 1A4LA 4V1YA 1JGMA 2Z27A 4LCSA 3F2DA 4H01A 4C6FA 1RAKA 3E74A 2HPMA 4CQDA 4ICMA 4DZIA 4IFRA 3OVGA 3MDWA 4H9TA 1KRCC 3TNBA 1GKRA 4CQBA 3QGAC 2QT3A 3PBMA 4IFKA 3URQA 2PGRA 3ID7A 3N2CA 1YMYA 3GG7A 3PANA 1NDZA 3MSRA 4GX9A 5LXXA 4QS5A 1ONXA 2Z2BA 4TQTA 1RJRA 1FWEC 1P6BA 1K70A 4C6CA 1QW7A 4C6QA 4ERGA 2PAJA 4RDYA 1XRFA 2F6KA 1NDYA 4RDWA 1PO9A 3E2VA 5FSDC 3D6NA 4CNSA 1FWJC 3OOQA 1HZYA 3GU2A 4C6PA 1YBQB 1K1DA 4GY1A 4H00A 4C6BA 2KAUC 4DLMA 1A5LC 1O5RA 2VM8A 4C5ZA 2HNHA 3OQEA 4GX8A 4D8LA 2R1MA 2O4MA 2D2GA 2OODA 4KIRA 3S2MA 4GY0A 1POKA 2FTYA 1EJSC 1IE7C 3GTIA 1UIPA 1M7JA 5CH9A 4NG3A 3MVTA 1M65A 4CEUC 3GRIA 3LNPA 2YB1A 1W1IE 3NQBA 3WYZA 2Z25A 4G7EA 4UB9A 4P5UA 4QROA 3URAA 2I5GA 4LAOA 3QY8A 4GBDA 4KQNA 3EWCA 1E9YB 3LGGA 4R88A 2Z26A 4GXWA 1VFLA 2FVMA 4EPBC 4RDZA 1KRAC 2AQOA 4HJWA 3PNUA 3S2LA 4F0RA 2Z2AA 3V7PA 2D2HA 1ZZMA 5A6TC 1ITUA 3LA4A 3HM7A
chains in the Genus database with same CATH superfamily
3KS6A 5CSSA 1Z89A 3AMCA 3NPVA 5H91A 1V5XA 5LA0A 2IXVA 3DI0A 1AH3A 1UASA 2PSNA 2DSVA 1JUBA 1HGWA 2DQWA 3KP0A 1IT8A 4ACYA 1TWIA 4M81A 4NI8A 5KG2A 1JZ8A 4AZ6A 4LVDA 4O3OA 1ZJHA 3FVMA 4IPLA 3WNMA 1JF5A 3K46A 3NDOA 4ASTA 1HT6A 3NSMA 2E09A 4AH7A 4HTYA 3UPWA 1DIOA 3SY8A 1GZ1A 3FJ6A 3IRDA 1PB0A 3MR5A 1GTEA 4JY9A 1E56A 3PJTA 3GIYA 2C1IA 3RB4A 3LCGA 3UG5A 4RE2A 3ARSA 4LBUA 2AQ4A 1M01A 2BGNE 3DGRA 7REQA 3R6IA 2HCVA 4O1EA 2WHJA 1HJXA 2VX6A 2QJGA 4ED0A 4PBFA 1W54A 1BF2A 3CHDA 4OZOA 5DRIA 4IMGA 1I1WA 1J12A 4LWWA 3E5BA 4NU7A 1H50A 3GUGA 1QHOA 3IJ7A 1BYBA 4PMJA 4MKSA 3T0TA 1YHTA 4KW2A 1LP6A 3FXGA 4Q3MA 3O9NA 2V6AA 4KPLA 4KETA 3S46A 3KTCA 1N8IA 2C79A 2X1IA 4HCLA 4ALDA 1LG2A 4YVPA 3RB0A 3BLLA 4FBTA 4OFCA 5KG5A 3GVQA 3BLKA 5GJNA 2NV2A 2CZFA 4HNCA 1AMYA 1E6RA 2YBVA 1Z41A 2J6UA 3WFLA 2PTDA 3WQDA 4DWSA 4KCTA 2PDCA 3O63A 3OP2A 4XB3A 4L6HA 4AFYA 1WXJA 1NF0A 2X2YA 3T5LA 1SFSA 1U33A 1DWFM 2DZPA 5D30A 3RPMA 4RXGA 3TOPA 3E38A 3R43A 3DHDA 2G37A 4JZ5A 4CNUA 3KEHA 1XC4A 3OLIA 1EJRC 4HYVA 1RQEA 2Q02A 1F76A 1RR2A 2XSBA 1JGIA 4IXHA 4HB7A 3MV01 5IDIA 3W1UA 2XC9A 1MUWA 5HDRA 5DGBA 3RB3A 4PCPA 4GJJA 3W53A 2CESA 2OJPA 1K1QA 5ABTA 2EJ1A 4UZUA 3H24A 3WX7A 5KT4A 4ZA0A 3SI8A 2I5QA 3WQOA 3WZ0E 3BG9A 1HTIA 4INFA 1DJXA 4QE5A 3FCPA 3PZOA 2O0TA 3ARTA 3BH4A 4DRSA 3W7IA 2Y7DA 4EBEA 1G5AA 2IUZA 4OBTA 2EAWA 1R85A 1TX0A 3QKZA 1OM0A 4AD3A 2R8WA 3MTWA 1XDLA 3MWAA 3VIHA 4F2UA 1HW6A 4JY8A 4XKMA 1AJ2A 1IR2A 2E5BA 4RJEA 5CGQA 3WIJA 3WD0A 4ADSA 1D8CA 4DJFD 4AW7A 1ZCCA 4J9PA 1GOIA 2NQZA 4O3SA 1JXKA 1JD9A 4NAFA 5KFEA 3VZXA 4JFWA 4Y9PA 5HQEA 3UCDA 4MF4A 1E3ZA 3IK2A 2FGLA 1K3UA 3NR0A 2IA6A 3ZJKA 7REQB 1QUMA 2UVRA 1YIXA 3QQ0A 3W7DA 4J1OA 1EKOA 1EFZA 4Z1DA 3VFCA 2WNQA 3RGTA 4F40A 4IR1A 3VIGA 2RKXA 4YLWA 1V03A 1N2VA 5CQ1A 4Y6GA 1O5XA 1TPWA 3QMRA 3I6RA 3W1MA 1A5OC 5GJPA 4ZB2A 6A3HA 1HFBA 5FJUA 3MJMA 1KM1A 4QITA 4YJ5A 3GXIA 3W75A 1S9FA 3KRZA 3W4RA 3BICA 3WEOA 3CL8A 4B5TA 4O3PA 1YX1A 5HULA 3CZKA 2Z27A 1MSSA 1Q7ZA 4AHOA 3RJXA 2ABBA 3KBNA 4CQBA 2W9AA 4A35A 3AFBA 3AIUA 3RXZA 2VX7A 2JK2A 2DPIA 2XN0A 3WLQA 2WJZA 1Q2SA 2FTPA 3MSRA 2QLYA 3W1AA 5K4ZA 3UJSA 2DY3A 1NP0A 4EKJA 2CPUA 4F4ZA 1TPDA 3RU8X 3N2XA 4P8WA 1OQFA 1FY6A 2ZRZA 2F6KA 4NSBA 1O4UA 1E6SM 5D8ZA 1TQXA 3LI0A 4B4HA 3PZTA 4XBJA 1G94A 2HK1A 5A6BA 4JHMA 2AMGA 1FCUA 1OADA 3Q58A 1DEDA 1LZOA 2B81A 3IK4A 3W2KA 3AISA 4ED6A 3QPYA 3GZ3A 4J40A 1EEPA 3W7RA 4FP1A 2AGTA 5AYIA 5AVHA 3WLOA 3EKLA 2DT2A 1BD0A 4MFDA 2HEJA 1N82A 5H1WA 3EOUA 3JR2A 2Y5JA 2YPIA 4BEQA 3SUSA 3RK8A 2OTDA 2ZUSA 3ARRA 3R25A 4ZQRA 1CGVA 2Z1KA 2V3DA 5AC6A 5DGAA 1S38A 1GJPA 4DNMA 2YCKX 4NAEB 1B54A 3PVXA 4GXMA 7TAAA 3SGUA 3DHPA 3S83A 3UWZA 4NAFB 2IMWP 5I00A 3FYYA 5I09A 5I77A 4HA0A 3NEVA 3PZUA 1Q63A 4H4IA 3CH0A 2YXGA 2NXIA 3LHVA 4O8AA 1YE6A 3F5LA 5HBFA 4YVXA 1YXCA 4JTLA 4P7RA 4GCAA 1AH4A 4BFAA 4RZ4A 4UTWA 4IQDA 3CZJA 1CB2A 3C0SA 4UQCA 3B3DA 3CV1A 2TAAA 4OV4A 2W92A 4UOJA 3UPBA 2HXUA 3VNKA 2GVJA 1GVSA 1FCVA 4PULA 3NOEA 1JRCA 1VPYA 1QPQA 1TJ1A 2VX5A 1KV5A 3B06A 3BQ1A 2BP1A 3BJYA 1Q3NA 2W8KA 1QOXA 2W0UA 4FF5A 2R24A 5KFCA 1FH7A 4D6CA 2BXZA 3H2NA 2QULA 3QY7A 2XN2A 5DMLA 3SGGA 4WOZA 4IMCA 1Q8AA 1JIBA 1NQ6A 3S2CA 4D2JA 3U9IA 3WQPA 1RJQA 4K1GA 3WH5A 4K39A 1XCWA 4GFSA 2ASLA 1TA3A 2R6OA 2OEKA 4PE8A 4JKMA 2E25A 1M3UA 3UF9A 4HZ6A 4FXFA 3FNDA 4DBSA 4EF9A 5C9WA 4LYPA 2PP3A 4X0VA 3UWQA 2CZ5A 4MY9A 3WJXA 3WH8A 5DT7A 3KBWA 1B3XA 3H55A 3V1PA 3BUVA 2TMDA 2YXXA 3DC8A 4KCWA 2Y24A 4Q6JA 2XUCA 2J9YA 3USBA 3QW4B 2OR2A 2JQXA 4OBRA 3P81A 4I7VA 4KS0A 1VYPX 4KH2A 1TVNA 4IMAA 1OT2A 1LYXA 1EGZA 5IFTA 4QLLA 5LNRA 1VFHA 2OWCA 5D4YA 2FHBA 5KT3A 2BS9A 4MSSA 4WGXA 3OZMA 3VILA 2RDUA 3N9KA 4MZ8A 4DLFA 1TWSA 4Z2JA 3ZM8A 4O28A 5ECVA 4CCEA 2WNNA 4XBSA 4ED8A 2WSQA 2WNZA 4FS9A 1YLVA 2YL6A 5M1TA 4HZ8A 4PRWA 3DFPA 3A4WA 2BY0A 3SM0A 4MJ4A 3UZWA 1UWTA 1ZP4A 5DFAA 3M0KA 3AYTA 1S5MA 3T6CA 3ZMRA 4ZOCA 1XM3A 2C6QA 3QPZA 3UR7A 3O6YX 3KOXA 3GDTA 2VDIA 1X1NA 1NF7A 3WKZA 4O3NA 3P82A 3NQDA 1SMDA 3AXHA 2F6UA 5CGTA 2YDAA 4D6DA 3LY0A 2QVNA 4WDTA 4HPGA 3SDOA 5CZKA 1RYRA 1WZKA 4H7ZA 4XD6A 2XM2A 4DX3A 5D2YA 3CNYA 5LIXX 3WLTA 1K8CA 3EWZA 3E12A 1PEZA 3WSUA 3AXMA 4UCGA 2QPSA 3W85A 3DYMA 2QJNA 1EA0A 5E0FA 1CXHA 3BDKA 3NXFA 1W56A 1AD4A 1EP3A 4QWBA 4R7WA 1QWKA 1SZGA 3TQKA 2HS6A 3LRLA 1OC7A 3E2RA 4JIPA 3B9NA 3PPHA 1H0IA 1A5UA 4MNLA 3NYDA 2Z24A 4AIBA 2EPHA 3B8VA 3M7SA 4PMZA 3ELFA 2PGFA 3BCDA 3AUOA 4CN6A 4EPDC 1RBAA 2E5CA 3NG3A 2XH2A 2RDWA 2W66A 1KBBA 1PIFA 1QPNA 4RUCA 4IIFA 4AXKA 3GAKA 3IS4A 4Z2IA 8RUCA 3AHXA 4UTJA 2OGJA 1PKMA 3N29A 3FA3A 1MEHA 2J8FA 3G6LA 4XUYA 3AMKA 2QEZA 4LCSA 2D3NA 3RCNA 1UH4A 3GXFA 1US0A 3L2MA 1LOQA 1AZ2A 2NX3A 3IJ8A 4BI5A 1UPMB 3EDKA 3TXZA 3TTEA 2FLIA 4QS5A 1JG9A 4HA3A 2PWGA 5JH1A 4JIEA 3CUJA 2BR0A 4XO6A 3AIRA 2ZUVA 1PO9A 3P80A 1V0NA 2R8IA 4H6RA 1HL9A 5A94A 2WB5A 3FA4A 3V5CA 4Q22A 1W32A 1E6XM 1KA9F 3VA8A 4HNOA 3UQNA 2GSHA 3PPCA 4CGTA 4X22A 3OQEA 3PY2A 1NVMA 2J4GA 1A50A 4OJYA 4R3UA 1E51A 1ODUA 2EQDA 2RDTA 3O6AA 3HV9A 3HQNA 3BV4A 5K7JA 4RNNA 1SSGA 2FMNA 1GOOA 3LERA 1TCDA 4HPNA 2JEFA 4J9SA 2YB1A 4JX6A 4LEQA 5FKYA 1NU5A 5MKGB 2OKTA 1I45A 5FL0A 1OYAA 2I5GA 5F2MA 3H23A 1OEPA 4Z1BA 4YWIA 4EANA 2WYSA 4GKLA 2Z26A 2G5WA 2BZNA 5JIPA 3WDIA 3ITGA 4FNUA 5I24A 3NGFA 3SCNA 3VOIA 4W5UA 5A6TC 3J7HA 4WQ6A 3NQ8A 1NEYA 1WDRA 1IZJA 3LLDA 1R8LA 1Q6OA 1IWAA 3EDDA 1DWHM 1UKTA 3G77A 5HJLA 3W7LA 4Q8TA 4GC4A 5KFUA 3NZPA 4YL2A 4FMVA 2VVSA 1KFCA 3RX2A 2INZA 4JICA 3GXMA 3DI1A 4PSRA 2Y85A 1N48A 3WLHA 4F2TA 4GC6A 2DZTA 2ASDA 1KGXA 3DFQA 4WDUA 1G6CA 4W7UA 4M1RA 2YA2A 5T26A 3CUXA 3A5VA 1LLOA 3A3WA 1E1FA 4U6PA 3K5XA 3FHQA 5KETA 2ZRVA 1B5TA 2A85A 4LUTA 3M6DA 3R13A 4EACA 7ENLA 1NTHA 3P3BA 1RCOB 5BROA 1CXIA 5CPLA 1L2UA 1BXNA 1M5WA 3PR2A 2VC7A 1T40A 4J9QA 2WSKA 4ML4A 5DY3A 3LZ3A 1H7WA 1W1ZA 1ZAHA 4K8GA 1GWJA 4GUHA 1WDWA 5TIMA 5E9XA 1GQNA 3LXAA 1XDMA 1FWSA 1FDJA 3MI2A 2ZRWA 5EKYA 4LUIA 3VNLA 3SCOA 2W8LA 4JIHA 1S1PA 1EDTA 1R5YA 2GGEA 4I6VA 3GBDA 3QZ8A 3B0XA 3GG0A 3NNTA 4B2DD 3PBGA 3WLLA 5TF0A 4F3HA 3R0DA 3PB2A 2Y5SA 4AC1X 1IGSA 2V2CA 3E0WA 4FLSA 4PUMA 4G1NA 4DL6A 5KFWA 6CGTA 1J9YA 1G4TA 3GW0A 4Q7BA 1BRLB 1K8ZA 1EBHA 3OGSA 1IXQA 4W8BA 1NAL1 4LXFA 5HOSA 2GUBA 1EOMA 3BOLA 3VZZA 1V51A 1S2VA 1KCLA 3AU6A 4J7RA 2EPLX 4DBEA 1AA1B 5FI8A 1H11A 3H2CA 2DUZA 3SSZA 2W67A 4HT3A 5A6SA 2XGIA 1LRTA 3GD6A 5CC6A 1LBMA 1QOQA 1TMHA 2QDGA 1W3LA 1B57A 2XYLA 2VCBA 2B0MA 3VM7A 3GIIA 3ENLA 1R3WA 4GOAA 1GHRA 2C16A 4MNMA 3CUIA 1QR7A 1HJQA 4GRSA 4Y90A 3C8FA 4ZOAA 4MB5A 1WKFA 1ML1A 3NM1A 3CQKA 1H41A 3HA1A 1XRSA 2CKSA 1HKJA 1V02E 4HPHA 4L4OA 3TKFA 3T0BA 3XIMA 1TJ0A 1E73M 1VFFA 5LGXA 1X7IA 2D3LA 3ONBA 4HVXA 3CLMA 1YNYA 1X1OA 4FIRA 1BFNA 1SMAA 1TWWA 1KCKA 3PK7A 1QT1A 3KWXA 4S3EA 4TX9A 2QV5A 4M82A 3UY8A 4TIMA 2DIKA 3S5ZA 5HJYA 1YRRA 1REQB 1SO3A 2WVVA 1UH3A 4OOZA 4OWGA 1O60A 1UOKA 5EMJA 3M0XA 2TPSA 2EPMX 2GJXA 3CM4A 5CGMA 3SCWA 4LUTB 3CWOX 1N7KA 1P0NA 3SSJA 3OB8A 4IF2A 4LGXA 2VX4A 4AX6A 4DY1A 1S0OA 3W07A 3LCXA 4R34A 4O3RA 2XH0A 3S4TA 1DJZA 1PV8A 4O19A 2E67A 2JKAA 5HJXA 1E1CA 1UZ1A 2OLHA 1VKFA 4BS0A 6TAAA 1A47A 2VQTA 3EA3A 4RV8A 1SJDA 1VLWA 1E4MM 3GIKA 4DUXA 5RUBA 3UWWA 1JPDX 1W6TA 3W7EA 4I7WA 3ZVHA 1TB3A 4LUSB 1H1NA 3SUUA 3LENA 3H2AA 1T41A 1CI1A 3ISIX 1AQFA 4LVGA 4Z17A 2OSYA 2Y1HA 1HP4A 3QKEA 4GVFA 3O16A 4A22A 5LNUA 3U4AA 3C2OA 3GB6A 1QAPA 5FOOA 4BCEA 1PZ0A 3L65A 5BNKA 5DLGA 4FXSA 3E74A 2FPTA 4ICMA 1FXPA 1DXFA 3ES8A 1OVDA 3FV9A 3UZXA 4B4FA 3WBEA 1TR1A 4NF7A 2QUUA 2ZUUA 3ALFA 1XIIA 2J7DA 3FAWA 1H61A 1H5VA 3WJYA 4R7OA 4GVHA 3G1XA 1YTDA 2X7WA 3KDNA 3UGVA 4QR6A 2CLKA 1BG9A 2QKFA 2V69A 1RXOB 4CNSA 3GR7A 4JKKA 2PMQA 4GY1A 4RL3A 2KAUC 2VFGA 5CLWA 3A47A 3LCIA 4DO4A 4N4PA 1VBUA 2W79A 4F0KA 1SO5A 3H6OA 1A5BA 1POKA 4QG8A 9CGTA 1Z32X 3P93A 4C7GA 5DXYA 3VABA 1DIEA 4M3PA 3LTSA 4N9CA 3G0SA 3E9AA 4DF1A 1ZL1A 5DCEA 2JE8A 3OVPA 3AMDA 2G3NA 3FN9A 3WF3A 1WDPA 3A6OA 3KWSA 1G0CA 3VKDA 1OF6A 1H1YA 3HG3A 1IV8A 3DIPA 5U7SA 1UP3A 3MCMA 2V38A 1IWPA 2OEJA 1HQTA 1DQUA 4MUZA 5DMYA 4GQBA 2Z2AA 2WC3A 3K4DA 3V75A 2GJXB 3O3RA 4AMAA 3PAOA 4P7QA 3V6HA 4S3KA 3UWYA 1L6GA 1OHLA 4H19A 4IICA 5EBAA 1UR8A 4R9OA 5B7YA 3VX1A 3H2OA 1GK8A 4WKHA 4AWTA 1OABA 2ISSA 3GY1A 4DUWA 3M16A 2ADAA 3UD6A 5I02A 5DRCA 3NVTA 1UWSA 1PCWA 1E9IA 3L4UA 2I9UA 4IIEA 4F0LA 3C61A 2X1RA 4JDYA 4RDVA 4M8UA 3JZEA 5BU9A 2XFWA 4IPPA 1F8MA 1UUQA 3PVFA 2DPJA 2J7FA 1TTPA 3TXVA 2WMGA 5A6JA 4KWUA 3KLKA 3ZVHB 1V0KA 3HJZA 4DI8A 4QHRA 1VEPA 5C71A 1D7KA 3PTDA 4NZCA 4PC8A 4CQAA 1UBPC 4O53A 1US2A 3T05A 1B90A 3AIQA 2WJEA 5D05A 1MW1A 2A79A 3QYQA 2PI6A 2NQ9A 3AHVA 3S1XA 4MJ2A 2NWSA 3GDMA 1C92A 2GVGA 1EJXC 1G4EA 2JF7A 1QTWA 2I9EA 2ZQ0A 3CHEA 1VEOA 3GHTA 3KCLA 1GYLA 2YL8A 4DXKA 3NAVA 3W1PA 1WBHA 2H9AB 3EWDA 1W37A 4GACA 2EPNA 4U5IA 3FOKA 2P0OA 2HISA 3W37A 1E5NA 1UD2A 1Z8AA 1ENUA 2J6SA 3GVGA 2WSRA 3DFTA 3IIPA 1KTNA 3SCPA 5DBUA 3VD5A 5F9NA 1L0PA 1Z6KA 2NT1A 5JIWA 1XIDA 1J01A 4NI3A 4NQ1A 3VNMA 3IJLA 2Q01A 1A3WA 1JZ7A 3P2VA 1PZ1A 3L12A 4JEJA 3ABRA 2F2KA 1O5KA 4CVWA 1IIHA 3MU7A 5J5RA 2C1HA 3OBKA 1PHQA 3LRKA 3GSMA 3GDKA 4WSJA 1ITXA 4US6A 1J96A 4RR4A 1K8YA 1QK0A 3K8LA 4GISA 2DJLA 3WMCA 1YPIA 3LUTA 1U5VA 3CIWA 3DFNA 1ISXA 4AD5A 5KFGA 1F05A 3DN5A 5G4HC 4FB7A 1JD7A 2WC4A 3ORWA 2NQJA 4H9ZA 4JHZA 3EWXA 3Q8SB 4RE0A 2IPFA 3QYSA 4Q4OA 3UJ2A 2IPWA 1WO2A 1NM9A 3PSVA 3VMPA 3PN8A 3W38A 2PZNA 5EU9A 5AY7A 3RM8A 1QNRA 3N3TA 5L1JA 3MKVA 5I7GA 2Q71A 1I2OA 5HMFA 1Q45A 1OCBA 1RA0A 2VEKA 3VCRA 3T4CA 4AWEA 3GNXA 4AY7A 3VIKA 1XG3A 1VIZA 3RBEA 4PMVA 1KM4A 4IIGA 4J9NA 1NIUA 2P88A 1VF8A 4RNMA 2HE5A 2VZSA 3BLOA 2JBMA 4W85A 2I14A 3W2JA 4FLOA 1GOQA 4O1AA 1ZBVA 1V93A 4TVDA 4H9MA 1DQWA 4BR1A 3E6EA 3GNRA 4JTHA 1O95A 2E6FA 2FZMA 2R1NA 3N2BA 4H6KA 4DNHA 3NM3A 4HYWA 5HQLA 2PURA 2Y88A 1V08A 3N2OA 3RR4A 4KWSA 4PCNA 4A6GA 1LRNA 1A0EA 1LTDA 3LHZA 1XG4A 2F9RA 1XF0A 3OJGA 4WRHA 3C4UA 1MFVA 1J6PA 4HHMA 2GWGA 1KFBA 4XX6A 4TVCA 1AK5A 2WBGA 4UFLA 5C6MA 1A5AA 2OGYA 1W31A 3RCMA 1R9YA 3QMTA 4N9BA 5KFNA 3UPMA 3N18A 5ABFA 3CB3A 1XLDA 3W28A 2AGOA 3QRHA 2DIJA 3R79A 1VFUA 4JYEA 2DV0A 1WKYA 3P7YA 3UEQA 1DE5A 5EDWA 3E0IA 3MHFA 5D9MA 1Z42A 4KBXA 2ZUMA 3WEMA 5CC7A 1EF2A 2VR2A 3UVAA 1MEWA 4QDWA 4NX0A 3GC4A 4NJGA 3IARA 1DTNA 2CZDA 2PF0A 3IJ6A 5DMMA 3S5YA 4D1IA 3MI3A 1ME7A 4MPKA 3KBMA 4G2DA 4YMZA 4OT7A 1R7OA 1WOAA 7CGTA 1MW0A 1EEXA 1OY0A 3FDGA 3W0KA 4JIIX 1CGYA 1V6UA 2PGWA 2OZTA 1M1BA 2XWDA 3PBYA 2IS7A 1DE6A 3HQ1A 3HPZA 1RAKA 1JR1A 2VWSA 1KC7A 2VA3A 3DG6A 2YCIX 3R89A 3SRKA 1VLIA 2QT3A 3IIOA 3ID7A 1S0MA 3HGSA 4YR2A 4JTEA 1TV3A 2E6DA 1A0CA 5EY5A 5KFZA 3H4GA 2YZRA 4CD6A 2HTMA 1D3CA 1OYBA 2BX7A 2DZXA 1Z3NA 3E2VA 3C2VA 3FKKA 3RM4A 3VOCA 2EKGA 5C2CA 4IL2A 3QEZA 5FD0A 2C2EA 3MV11 4IJCA 2VELA 1E0TA 5BMWA 3APYA 1E72M 2NV9A 4ED2A 2HNHA 4ECXA 1EOKA 1BEUA 2EXOA 3W1NA 2YL9A 4ML9A 1DWJM 1S5WA 4Q4RA 1IXNA 5DCDA 3FHAA 2H90A 5HANA 1HUVA 3AWNA 1EJSC 1H7PA 2W9CA 5EWGA 4H83A 4RKAA 1U5HA 1FUYA 3PR5B 4K1WA 4U7CA 2GFTA 3A23A 1AUSL 1MO0A 3HFTA 3T2PA 1KGUA 4PUUA 1FFRA 4UB9A 4IIDA 2KX9A 4RK8A 5DEZA 4MDOA 1UBSA 4S2BA 4R88A 4AEEA 1VEMA 4UTMA 2E5DA 1VFSA 5A95A 3IVSA 1X1ZA 2G3JA 3T8QA 3I4KA 1GVIA 5CAHA 1ZZMA 1CTNA 1LL4A 3GYCA 2R8JA 4AZBA 5KFLA 3UP8A 2E9BA 5A8MA 1YEYA 3U48A 1L6SA 5T91A 5CAKA 4NNBA 5GVJA 5CBJA 3TW6A 1CZ1A 4W84A 3W88A 3BQ5A 4NYUA 1GEHA 3SN0A 3KOYA 4R8UB 3G3DA 4NNAA 1KBLA 3MBFA 4DJDD 1VFTA 1JRBA 1JYVA 3ATYA 2FZ9A 3NDYA 1OK6A 3OW1A 3VNJA 1FHLA 5HMEA 2FMOA 4DM2A 5LHEA 3N4AA 9XIAA 3ABOA 1SVDA 1XV8A 4JIQA 5KG6A 1EX1A 1ZFJA 1UR4A 3BE7A 4XD4A 1V6VA 2BGQA 1EQPA 2PD9A 1W3TA 3GTFA 3KHHA 2UY2A 1XS2A 5AHIA 4L1GA 3CAQA 1EH9A 3R4IA 3WMBA 3HZ3A 1XQLA 4UC5A 4A2RA 2Y62A 1SO4A 2EBNA 3P14A 3C2YA 3T4WA 1SU5A 3OLDA 5F2LA 3QZEA 3NOYA 3BPWA 4PUJA 1DBTA 3W2LA 5LIYX 1XCFA 4Y9NA 3FLUA 4DL3A 2YLLA 1W8SA 1P4CA 2PE4A 3AXKA 4KERA 3UZ5A 1J2WA 1R3SA 2H8XA 3WUBA 3BG3A 3CV6A 3OEXA 3IANA 1J4EA 3EX6A 1EXPA 4ATWA 2O92A 2NUWA 2DT0A 1X6NA 2F61A 3LM3A 4IG2A 2DZUA 3WBXA 4UCFA 1C91A 3E49A 1IEWA 4M24A 3RAOA 1QXLA 1UD6A 4D9PA 1AQMA 4AWSA 4WSKA 1JI1A 2VRQA 3C6CA 5FAGA 3V5OA 3D47A 5FJOA 2FLNA 2QDDA 4H6EA 3TJXA 1OFDA 3AIEA 3NQ7A 1XKYA 3VOJA 2W9CB 4U31A 5D9NA 1V7YA 3PZGA 3GDLA 2Q8LA 1H1ZA 3WK3A 2X1UA 3M9OB 4NXKA 2IXUA 3LCHA 2TSYA 4AISA 1V3LA 2XG9A 1EPXA 4NZ3A 1UP2A 3WDHA 4REQA 1EJWC 1R3VA 4OUIA 1PS9A 5BOEA 1JL8A 2C8NA 4PMDA 4MHBA 3ANUA 3P62A 2E1DA 4GVIA 3PW2A 4LS2A 4P8XA 2PGEA 5IXEA 3SW6A 3BWWA 3UZZA 1K77A 4TXEA 5LNVA 1SFLA 1SGJA 2E77A 4GQ0A 3MHUA 3VI2A 4C6JA 4JTJA 1IHIA 4H9UA 4QLJA 2MANA 3II1A 4O1CA 2WZMA 1J6OA 3PWGA 3T08A 2FB3A 4PMYA 2VC5A 3F7JA 4UFHA 4M5PA 2YDQA 3JVAA 1F74A 5EFFA 4N7QA 3DX5A 4M51A 2WHMA 3A3XA 2CLOA 2A3BA 1XLGA 2WJDA 4NJIA 1RD5A 4UTUA 3WF1A 1TMQA 1RD6A 4GC7A 1UR0A 3WK0A 4WKFA 3BLIA 2P0IA 2VEIA 3Q8QB 1R46A 4ZODA 4PODA 1W5QA 4ECRA 4ZSTA 5HQMA 2Z7KA 2TODA 2GVLA 1UUOA 1E6NA 3NZGA 3W7OA 4FX6M 3EB4A 1V6TA 5CLTA 5KFMA 3RRAA 3T55A 1CGUA 1FKWA 1LWJA 3O15A 1FWIC 4PCTA 1ZALA 2V82A 3ZWSA 4GQRA 2IPJA 1MNZA 1BHGA 3KAOA 1OGBA 4RLIA 1LF1A 2V2HA 3V1HA 4A8RA 3PP7A 1MUMA 5KT6A 4X3ZA 3VTRA 1BYCA 5C0QA 3BSHA 3ITXA 4C6IA 2ZUNA 4DWSC 2OQYA 3AYVA 3CH9A 1I2QA 1GZJA 1MI3A 4AZHA 2PC8A 3OVGA 2V5BA 1ZY9A 3UWUA 8TIMA 2GLKA 4CN1A 2WQDA 1CXEA 1TUXA 4N6EA 1LRQA 3M0HA 5LNWA 3OIHA 3WQ6A 2JGQA 1JEZA 3HURA 3UA3A 1ONXA 3FK4A 2NXHA 3W27A 3UW6A 1RJRA 4GYKA 1XYAA 2JKEA 4ZFMA 1IZCA 2J7BA 2CHOA 4WK9A 4KRZA 1C9DA 3G0UA 4RDYA 5DN1A 1XRFA 5ECUA 3L4WA 1W1PA 1FWJC 4GNKB 3RX4A 5FF0A 5M03A 4ZBCA 4WGHA 3KDOA 4IHCA 5F1UA 1XSKA 4REQB 1RP9A 5AOUA 1FX6A 3CEUA 1L2QA 3WDQA 4BA0A 3R7MA 1D2KA 2BTMA 2NVDA 1SZFA 4NJKA 3THCA 2UVWA 1IE7C 1G7UA 3UWEA 1W91A 4AZGA 4D6HA 1PCKA 3GRIA 1PTGA 4C1KA 2WMFA 3G5EA 3S5OA 3WMSA 4JN7A 2J9XA 2ZX9A 3TV8A 4MG4A 2P5NA 3EWUA 4DZAA 4D71A 2KZHA 3GLCA 3MR2A 1KLZA 1VFLA 3W1LA 3SUWA 3H21A 1IR1A 2QGYA 1NOFA 1XBVA 2F7FA 2PDXA 1HJUA 5AHNA 1M9HA 3B0YA 4MUPA 3UGRA 4IP7A 3MKKA 4EYIB 5C9UA 1JQXA 1ZJIA 8A3HA 1DWIM 3P0XA 4EE9A 3KP1A 1Z69A 2OU4A 4K2SA 3BAJA 3WD1A 3LGDA 4C65A 2ON3A 1WZLA 1OFOA 2OELA 1T3NA 3GHUA 1FWBC 3SZ8A 2JGYA 1DHKA 2QMKA 3W1TA 5LNSA 2WSPA 3AWOA 5SWUA 1F3TA 3CLWA 4TV6A 2DQXA 2C0HA 3ATZA 3DFYA 1S2UA 1GOMA 3OPSA 1DOSA 4EVZA 3CYJA 3EA2A 2WWDA 5H8PA 4Z1AA 4Z08A 4D6JA 3B9EA 3UJFA 5KFFA 1T96A 3TYCA 1YW1A 4DBDA 1KTBA 4HOWA 2V3FA 2OEMA 3QPEA 5B7ZA 5MHBA 4FHAA 3WH9A 1BKHA 3HQPA 3N73A 3P67A 3G18A 3T0AA 2QJMA 1BXBA 1GKQA 1OF8A 2W9BB 3OU8A 3MWCA 2HBXA 1ICPA 1EF3A 5FAJA 1NWSA 1KKOA 1OB0A 1WB0A 2V68A 3NPWA 1XQKA 1BTMA 4V1XA 1IGWA 4JTUA 2HVNA 1QI4A 1BLIA 3WF4A 2ISVA 4C6LA 4QRNA 4K38A 1W3IA 2OSXA 3UNTA 3DUGA 2VVNA 4W93A 1XLCA 4L1WA 1OWQA 1UA7A 5HA7A 4F0HA 3PWAA 1U2YA 2ASJA 1LWIA 5FESA 3IN5A 2ZCGA 2C3ZA 4ZCWA 1OIMA 3TQ1A 3TJ4A 1Q6FA 1A0DA 4DEZA 1H4PA 3GKFA 2UY4A 4LS0A 1TPUA 3ERPA 1L8NA 5G2WA 4QJ3B 1QPRA 3QLLA 2E8ZA 5I3KA 3LQLA 5A1AA 2GSJA 3CTTA 1JQVA 3E3HA 3TR2A 4H8NA 1MZHA 1QNSA 2WKLA 2BG5A 5U4NA 3WNOA 4MY8A 3SN1A 3OVRA 3W1QA 1GQLA 4U3CA 1WXYA 4DJFC 3GXTA 3RMEA 3GC5A 2BQ3A 4MKVA 1X39A 5M3WA 3WFAA 1EWEA 2ZC1A 3T42A 4BQ3A 4FXRA 1DJNA 4HYKA 1S2TA 1NOUA 4E3TA 3LGEA 4Y2WA 4D8ZA 3CC1A 2R14A 4O11A 4FOUA 4C6OA 3EOOA 2QUNA 1XIHA 4L5ZA 3TROA 4NP7A 2ANUA 1TJRA 3QFWA 1O1ZA 1UH2A 2ISFA 3MUIA 3RB6A 1SZEA 2XN1A 1TIMA 4V27A 3TWBA 4XVDA 1ICSA 5CPSA 4GK8A 5D02A 4MWAB 3W9ZA 3CHFA 4MPQA 4XQ6A 3NQVA 2CC0A 4S23A 3QZAA 3DEQA 1XICA 4ECSA 2VL4A 3VKAA 4R85A 2PEVA 4J3TA 2FZ8A 2VCAA 1QOPA 2CXEA 1S0NA 1D7FA 2OT1A 5IBXC 2FKPA 3HMJG 4FO4A 2FHFA 4XZIA 2WNWA 3CAWA 2A7PA 3EA1A 1IEVA 1VRDA 1RLDA 4Q8WA 3M9MB 5KEZA 3VFLA 1DIDA 3ZJ6A 5A8PA 5HATA 3LB0A 3L0NA 3SI9A 1EL3A 3R5EA 2ZZ7A 3QQ1A 1H7XA 1M04A 1RSCA 5I6SA 1U30A 3N2TA 4X2RA 3V5FA 5HNUA 2AKMA 3CUGA 1KXTA 3B0VC 1KTCA 2AL2B 1W9DM 4GZEA 1RHCA 1DP0A 4PTMA 4ZO6A 4YP3A 1W1VA 2DP3A 1PHWA 3DOPA 2WMJA 2IKIA 3WBYA 3UG3A 2PDYA 4FNTA 2EEXA 3A24A 4EWJA 2J7GA 2I57A 3K2GA 3ZR4A 5AVNA 3ZT7A 2WVTA 3THDA 2JEIA 2G4FA 1PL9A 4IR9A 2ALZA 3VO0A 3UVIA 3EWWA 4LB3A 3STPA 5E6ZA 1XUZA 4PUEA 3AIBA 2ZZ1A 3AIWA 3QJAA 4UUIA 5HR7A 2V5JA 3WQVA 4D6GA 2D22A 4YCPA 2FB2A 1IT7A 4QDMA 5A6MA 3GQYA 1XX1A 1SW3A 2PTZA 1GG0A 3PZMA 1TZ7A 4V2XA 1HKIA 4DM1A 3BC9A 3RLVA 1LQ2A 1S5NA 1UKSA 1FWEC 1EGMA 2JIWA 3L67A 3BW4A 4C6CA 4KRTA 3MCOA 3M5XA 3APTA 2YDRA 1JCMP 4OIFA 3INPA 1YDVA 3PZIA 3BGAA 1W3NA 1W9UA 1TWDA 3W1XA 5E93A 2WBKA 3BW3A 3W22A 1ISWA 3VXGA 2PWHA 3MYOA 3G22A 2HZGA 3E5PA 2FTYA 1HXJA 2Z1SA 2CIPA 1YQ2A 3LNPA 4ONVA 3OO2A 4XKYA 3W6LA 3C2RA 3NQBA 3TTQA 1AG1O 2QDHA 4KIEA 3ABQA 3A22A 3B4YA 4B5XA 2DZBA 4K8HA 2FPVA 3HU7A 5DELA 4NRSA 4ECWA 2X40A 4G9PA 3V3WA 3H4XA 3AJXA 3DECA 1TQJA 5EL1A 3D5HA 4AVFA 2PB1A 3WLJA 4QWCA 3VIJA 4PFHA 4F0RA 3IGSA 3F4NA 3T78A 1B2YA 2H3DA 4K7VA 2C19A 3SCRA 3WQWA 1WZMA 2PPGA 4IQJA 4KKXA 1WP6A 1ZPTA 3TWAA 2O9PA 3Q4DA 2BVTA 1LG1A 3AZSA 2BODX 3WLRA 4S3CA 2RGMA 2QCEA 4WIWA 2OOFA 1HVQA 2RUSA 2NW0A 4RU9A 3CPGA 5H8UA 5TAOA 5G5IA 4JL1A 1A49A 3GDBA 4KF1A 4E4UA 1PKNA 3GAYA 2PDKA 5I3FA 1UMLA 4NZ5A 1K7FA 3KS5A 5D33A 5KFKA 3VIPA 3GTHA 3W2NA 1J5TA 2ZC8A 4WUIA 4YPJA 2V81A 3NL3A 2GOUA 4FI4A 2ZUWA 1TIWA 3VGDA 4ED7A 3U7VA 3RN6A 4QGCA 1UJQA 5ABGA 4B5WA 5A2CA 3BARA 1XFCA 5KFRA 4GG9A 1UZDA 3N4EA 4F4XA 3QXBA 4UMBA 3MFIA 1QPOA 1R3TA 1IXOA 1NDWA 4PMUA 3MYPA 2R91A 5DY2A 2XVPA 2YBTA 4XZWA 4A3RA 4ZOBA 4GUIA 2XCPA 1RCXB 2D73A 3ES7A 1Y0EA 4UQEA 4HZ7A 3QTGA 5EPDA 1W2PA 1DTUA 4HK7A 2A7NA 3EEZA 3K4WA 1V8EA 4JKLA 1IIGA 5DQHA 3GU1A 2V3EA 2E68A 4MLJA 1I2PA 1S10A 5AC8A 2ZZ5A 3W24A 3OYZA 1XYMA 3K1GA 1K6WA 1DWGM 3B04A 3ITCA 3N19B 3DKLA 4TO8A 2GOKA 3BTNA 3T07A 3OODA 3RMJA 3T1GA 2R1PA 3MR3A 4M29A 3KTXA 3I6TA 3TLQA 1UD5A 4F50A 1E4LA 1UD3A 1CYGA 4NUWA 4XKYB 4YR3A 4WF7A 3GG1A 1XP3A 1UUMA 1VHCA 2Z29A 5JU6A 5IHRA 5DQPA 2XZ7A 2ZWYA 4P61A 3KUMA 3MJYA 1ITQA 1K9EA 4BF7A 2NSOA 1GNXA 3GXDA 1F9CA 4MGGA 1QASA 2VGIA 1JCXA 2DSWA 1LLWA 1EUAA 3E1F1 3H53A 1TPVA 2ZTKA 4C5YA 3SEPA 1YDYA 4XIMA 1XINA 1W5MA 4HOXA 1VR6A 4XZLX 1UHVA 3AXXA 5DLFA 4P8VA 1FOBA 1TVPA 1ZP3A 1VBJA 6XIAA 1JZ2A 4Z2KA 3VCNA 4QWEA 3TQ0A 4A3YA 4P8UA 4AEOA 3BMVA 2O56A 1SZNA 3AZTA 2OB3A 4L6OA 4ZL1A 2A6LA 3NQGA 4PA8A 1J0ZA 2HXTA 3ZJ8A 2DZWA 2I7GA 5KFYA 5TQLA 4UIOA 3XISA 4JL2A 1VFMA 1HO4A 1QWGA 2F8QA 4XTDA 3NPXA 2WAGA 3CAVA 1U83A 4M56A 1EP2A 1FXQA 3B8TA 2QJHA 2V5LA 2XJ7A 2VZUA 2OZ3A 1MFUA 1FVPA 5DT5A 4DL5A 2FH6A 4Q4MA 4L65A 4QM1A 4Q6XA 3W02A 2XFRA 4GPNA 3KE0A 2FH8A 3I4EA 1HGYA 3W76A 3AHYA 3S6TA 5HNTA 3S1VA 3F2CA 4YWSA 4H8VA 1LWHA 4JDBA 1TYGA 5LXEA 3QHMA 1E9LA 2NLYA 4KMQA 3BAWA 4PMXA 1SJAA 3GNPA 2FJUB 4H6QA 1UW9A 1UD8A 4IUGA 1O68A 1UC4A 4LB4A 4EXAA 3BOXA 1MEIA 2JEQA 3E0FA 3R2GA 2XVNA 1GTHA 3OSNA 4GZ7A 4PUDA 1ME9A 2J8GA 5CEWA 3H26A 1A4LA 2ZRYA 4V1YA 1IXPA 3IGUA 1P7TA 3F2DA 5BRQA 4GMEA 3EMZA 2HPMA 3M1ZA 1Q65A 3S5SA 4HTBA 2ZXBA 1GKRA 3LRMA 4QNWA 1I1XA 1HL2A 3N2CA 1RH9A 4NZ1A 4O4VA 1B1YA 3FJNA 4O15A 3C0JA 3CUZA 3WQFA 2OYMA 4F4RA 3C3NA 1OZQA 4GGBA 5JBEA 4OVXA 1J0IA 3I3DA 4JGDA 1OFBA 4K8EA 4A05A 1B31A 1V6XA 4F9DA 1QW9A 1HF6A 2NZLA 2P1FA 2R82A 3RILA 5CSYA 6ENLA 1YKWA 4M6VA 3G1FA 1LL6A 5KFAA 1VFOA 3DU0A 4CQ9A 2Q3OA 4O3QA 1CX9A 4N42A 3TW7A 4H00A 5T14A 3EAUA 3KHLA 1DJQA 4C5ZA 5H2ZA 2HNEA 3FA5A 1QFEA 5KZ6A 2O9OA 2J77A 3HOJA 1XH2A 4JYDA 4GY0A 5L1IA 3H40A 2BASA 1F07A 4JTRA 5H6HA 4ZQMA 1IEXA 4UR7A 4Q43A 3JW7A 4E2DA 5EMYA 1W1IE 5F1VA 4JFUA 1BAGA 3RITA 4G7EA 1KNWA 4NZ4A 4XZNX 2G8ZA 5BYWA 1K9TA 3DHUA 5DBTA 2VO5A 3VKBA 4PEEA 5CBIA 1YTKA 1XJBA 4NZFA 3QHOA 3T7VA 4LOCA 3UJRA 4QISA 4LJ3A 3S6OA 4E0CA 4G8TA 1PAMA 4KEVA 2VFHA 3PBWA 2QPXA 1XLAA 1R7AA 4N4QA 2OOGA 4L7ZA 3N3MA 3KTSA 3PF3A 3W84A 5KT2A 4TVUA 3LBCA 1DJYA 2QYGA 5AHFA 2XIQA 1V6YA 2HVMA 1Y5XA 2PF8A 1ZETA 4Q4QA 3ABXA 2E7FA 4EXQA 2RH9A 2X09A 1EP1A 1BSIA 3TCSA 3LPPA 2HWGA 1RQBA 3K30A 4PTXA 2ABAA 4MAZA 3NO3A 3H2EA 4PGLA 2H3BA 5CPQA 4W7VA 3STEA 3IGXA 2RAGA 1YXDA 3ZSTA 2D2OA 2ZRUA 3YPIA 3MI6A 2Y89A 3OZYA 4O50A 3CT2A 4WZHA 1NSJA 1UCWA 3HV8A 2WKGA 3B9OA 2D0FA 3NDZA 3L23A 2OQLA 2P76A 2ZOXA 4XV0A 2WM1A 2B7OA 2CZVA 4MB1A 2NVAA 1AFSA 1B3WA 1P6CA 3EBVA 4QQUA 3NTYA 3GYEA 4S3JA 4Z42C 3WDPP 2ZE3A 2OZ8A 3LSBA 1P7TB 1BYDA 1OT1A 2EF9A 3ZVIA 2PUZA 5A8OA 1EA9C 4B91A 2BGSA 3LG3A 3W86A 4PB5A 2CWXA 1GPWA 2FVKA 2NLIA 5ABHA 1G1YA 3TAKA 4M80A 1XC6A 3VIOA 4K37A 4L1XA 4MWAD 4OV9A 3SADA 3BLFA 3WF2A 3WH6A 1R9XA 4Y9AA 1N55A 4AU0A 1CLVA 1E70M 4XZBA 4IP5A 5F9LA 1UC5A 5L1LA 4ECYA 1XSJA 3BO9A 1A4MA 5KG1A 1ZUAX 3WMLA 4FLQA 2YLAA 1K02A 4IXXA 4UR8A 3N2MA 2TRSA 1XFBA 1OFPA 5C55A 1M7XA 1PZ2A 1XIBA 1XLKA 2BQRA 1TRDA 3IIXA 3L4TA 2QXWA 2XFFA 4JN6A 1U1UA 3TOYA 3THQA 4CQCA 2RJHA 4LF2A 1I6NA 3GHRA 3W7PA 4XTIA 2YCLA 3K8MA 3QHNA 3NQMA 5CZSA 3LBOA 2UBPC 4IIHA 3NQ2A 1V79A 1RA5A 3HG2A 2AQWA 4CEXC 2XVGA 3GZAA 2YA0A 3GU9A 4PL1A 2VGBA 4H2CA 5FJJA 4G7EB 3VGFA 4IMEA 1X38A 1F4AA 1Z9AA 2DUAA 1UR1A 4GQQA 1P0BA 3WJWA 2C18A 1R2SA 1OCJA 2Y8VA 3L7RA 2VR4A 1WAUA 2ASHA 2QV4A 1X8FA 2VC6A 2QZRA 1XIEA 1F3XA 5G1MA 5A2BA 4WCJA 2Q09A 3O06A 5L1KA 4PTVA 2D2JA 2ZIDA 1EJUC 3PBUA 1SYTA 3EMCA 3PSWA 4DWSB 1GVQA 2UVVA 3AC0A 3TQVA 4S3AA 4RZBA 4IOTA 3RX3A 1TZ9A 1GW9A 1OBAA 3H7VA 2CLFA 4AUBA 5AC5A 1X98A 4ENLA 3GG8A 3TN3A 1CGXA 3GR8A 1KRMA 1HKVA 1WE5A 3U7BA 2FYMA 4IPNB 3WQCA 1VP5A 3GE7A 1G7VA 1ADDA 3QY6A 3S1GA 4B15A 2X0YA 1CGTA 2WXDM 2WLYA 4AYGA 3U57A 1I2RA 3FJ4A 2VDGA 4GVGA 3WQ8A 3U4FA 3O6DA 2GJPA 2I16A 3NQFA 3R11A 3MBDA 4D6EA 5CBBA 4HIBA 3JU2A 2XU2A 3N11A 1M41A 5I23A 1MZRA 1FWTA 4ROPA 5E70A 4A8IA 3CUFA 2H6RA 4O4WA 1WXZA 3TN5A 2R8GA 1CCWB 2O9TA 3CK5A 4AVOA 3BCJA 2G97A 4J9RA 3WJZA 4LVBA 2FZNA 4URIA 3RYSA 1ZAJA 2PZ0A 2Z00A 4H1ZA 2XGPA 1ZHAA 2GWNA 1BWKA 4DJFA 2P8CA 4E5TA 4I6KA 1A5MC 3SRHA 2V4QA 2C15A 2CITA 4AZCA 3JS3A 1LT7A 3GGMA 1OIFA 1S2CA 3RM9A 4JHOA 3N25A 4EK7A 1JNDA 2NSXA 1GQKA 5FJPA 3CASA 2CBJA 3W00A 3M6YA 2ZX8A 3QGAC 4HHPA 4LV4A 5C7HA 2BOGX 2YCLB 3TCEA 4ADUA 1XLBA 4AG0A 3JUGA 4M1BA 4PRRA 3W7JA 3APGA 1GORA 1XUUA 2Z2BA 1HJWA 2C2RA 2BXYA 3MT1A 5F4WA 3SQSA 1FWNA 2EJAA 3CZLA 3BQ0A 5KFQA 7ODCA 3F03K 5C9XA 3LQGA 1HZYA 4C6PA 1G4SA 1THFD 3F5JA 2XZ9A 2VWTA 5IBXA 4CCZA 3QZ6A 4DL2A 3VDCA 4AB4A 4C6BA 3WNPA 1RZMA 3LEPA 4WR3A 5I03A 1T94A 2JEJA 1Q66A 4ZO7A 2O4MA 2ALDA 1SM9A 4J3XA 4KIRA 1X7FA 2Z0IA 2HJPA 1AQ0A 1I60A 1W5PA 3A5FA 4FR1A 5CH9A 4LBSA 4J9MA 5HAOA 2X42A 1EDQA 4PUKA 3NL2A 2FFCA 4MZYA 1WCGA 5L6UA 3TONA 4IPJA 2ACRA 2VYOA 3GVVA 2WM0A 3VCCA 3CO4A 3EX1A 3MC5A 1H51A 4YYCA 3ZLGA 3B8SA 4HCHA 3E2QA 3MP3A 3UXAA 2PDLA 3D46A 3L4VA 2Y8UA 3UY7A 1H2JA 4LAUA 3SRFA 4GIYA 4MNJA 3S9ZA 4Q8FA 1RY8A 3DGBA 2PC4A 5T9CE 2JIEA 2L5HA 4O0QA 2YZ5A 1TE6A 4R53A 3BL3A 4UBPC 1UZ4A 4B16A 1YYAA 3WBAA 3GC2A 3C52A 5I79A 1AJ0A 1MQRA 3PW0A 3VUSA 4LALA 3B05A 1J2BA 3W6MA 1NFPA 2ZXQA 1CT5A 1NH6A 3LMYA 4DJED 3ZOAA 3O07A 1RK5A 1VBGA 4RE4A 4FIQA 2VHLA 3DYPA 5CJ5A 5G1TA 2BQUA 3EXTA 3TJIA 3CT7A 3H22A 3VOHA 1MRAA 2WMKA 2EPKX 3V0UA 1QBBA 1TWZA 4JAWA 4XD3A 2V9DA 1ISYA 3LM7A 4OQVA 4UR9A 2QPUA 3KVJA 1L6YA 2NQ5A 3RJYA 3TVAA 2QR6A 1JDAA 2J6TA 3B8IA 1PZ3A 2WMIA 4MFEA 3VNDA 4N0RA 4EBDA 4MLRA 3EGJA 3LHTA 3RNDA 1S5TA 3BGGA 2Z2UA 3VGHA 1VGAA 4XK2A 4TTGA 1T99A 3GIJA 2QAFA 2HE8A 3EXSA 3MA8A 4ZOEA 5E0KA 1R86A 5CCZA 5FF7A 1QO5A 2BXVA 2PLMA 1ZU8A 1ZGDA 1XGDA 3SQMA 1BQCA 3TMQA 4WLCA 3CBWA 1HX0A 3WK2A 1XPGA 3C2FA 3NSXA 1KB3A 2POZA 3STCA 3CXOA 4ZE4A 1JULA 2QUMA 5DCBA 4M6PA 3VMNA 3V4BA 3KM8A 2FTWA 2JEPA 4O16A 3EX4A 1VRXA 3RF9A 1WAWA 3BAYA 1SW7A 4QE4A 2FHCA 3VDGA 2PLCA 3ARUA 2BY1A 1XI3A 4NHVA 1M68A 1DJHA 2BB0A 4RW5A 4QE1A 1PTAA 2PTYA 4JNZA 4GIEA 3NZQA 1XD1A 1ZBWA 1J18A 4D72A 2HDJA 1KCZA 4S3DA 4BZYA 1J79A 2CW6A 4DWDA 1K4HA 4IGNA 3IV8A 3R8RA 2GK1A 2CERA 1US3A 2VI0A 1TA3B 3S2NA 1G69A 2WCGA 3N9SA 3C3UA 3REQA 5F4XA 1R9ZA 3WJSA 5FF4A 3P8JA 1E4NA 3N6JA 3B9DA 1ZSXA 5HINA 4ZMGA 2E28A 3TC7A 1CIUA 2HBVA 4HU4A 1O1HA 3NURA 4D6IA 1RBLA 3IPWA 2VGGA 4TUFA 2WJFA 4NZJA 4EEYA 3WD3A 3GNNA 3IJQA 3TH6A 1JUKA 1BVZA 4B5VA 3AS3A 4JNMA 1E1EA 4ZO9A 4DI9A 2VJXA 4F66A 3FEMA 2ICSA 1UMYA 4Q8VA 1OFQA 4GUJA 5EMUA 3IEBA 4FXJA 3AU2A 4HNLA 3LMZA 3NEHA 3GWQA 4Q8MA 3XINA 3WUFA 3ITLA 3R8HA 3WUGA 2OYKA 5GNXA 3W72A 3GUWA 4TU1A 4AZ7A 3M07A 3W23A 5AZ1A 5XINA 3B9AA 2GGHA 4GH1A 1K03A 4QG9A 3OBEA 3EDFA 3IIZA 4DL4A 2CXGA 2J13A 4DB7A 1RYSA 4EX4A 2C1GA 5KFDA 3TDFA 3W1RA 3NO1A 1W1TA 3L0KA 2A21A 4HKPA 4WDWA 1Q6QA 4DXXA 1TMLA 5FSEC 1A5SA 3T5JA 4FF7A 4YVVA 4J3VA 4DELA 1GCYA 2BDQA 4QP0A 3TMLA 5D09A 3V0SA 4J35A 2R94A 1FWWA 1PX8A 4BQ2A 2NV1A 1C8XA 2BOEX 4ED1A 4MADA 1AVAA 4RZ6A 2E3ZA 1HNYA 4LRSA 4FAMA 4JOMA 2IMRA 1FFQA 2DH3A 3UCQA 4W8AA 4QJ4B 3VKCA 5AFDA 4OKDA 4ZFCA 4DYJA 5BMXA 3B8UA 4R33A 5REQA 3WD4A 1H60A 4PB3A 3DFHA 4IT1A 1C8YA 1PE1A 3U2ZA 4C1NA 3DAQA 2YSWA 3QMSA 5AHMA 3GNDA 1UQYA 1A80A 1DWAM 2DSKA 4H01A 3FGCA 3B03A 5ENLA 4IUOA 3RCYA 3MDWA 1VAHA 1ODZA 4KCUA 5DG7A 4DO5A 4ZTXA 1A53A 3URQA 4RPQA 1N8WA 2XGQA 3WLMA 1J0HA 4KGLA 2OVLA 3R1ZA 1AL7A 1XLFA 4U2ZA 3MUAA 4Z2HA 1HN1A 2QIWA 3LTYA 2ZDRA 2XPKA 3U2CA 4S39A 4I9AA 2WCSA 1IEIA 1FH9A 1V3KA 3GTNA 3OOQA 3P6LA 3UWVA 1PWLA 3G0XA 4JX5A 4XVEA 5FEPA 1MNSA 3GDRA 4NLGA 1W9BM 2CLMA 3SUTA 3QTPA 1MQPA 4GJIA 1S39A 2OWWA 2ZWZA 2INEA 4GX8A 1GVFA 3DDMA 2WKJA 3RLGA 2WLZA 4H7CA 2W7PA 5G2HA 1RV8A 4NG3A 3MVTA 2QGHA 3LNMA 2VCCA 3OSPA 2GDUA 1XXXA 3WELA 1KV8A 4U28A 1L8PA 1CLXA 3BGJA 3WYZA 4DJDC 4IM4A 3IUIA 3BW2A 5BRPA 4BQ4A 3PZVA 1GEQA 4CD4A 3EWCA 1E9YB 2ZBTA 3DZ1A 1YE4A 1ZAIA 3LX9A 4F48A 4EPBC 1Q8JA 3S42A 4M19A 5D8WA 3MO7A 3HBLA 1KM3A 4HJWA 1GVEA 2MNRA 3DYOA 4LTSA 3RO8A 3CL7A 1NFBA 3MUCA 3STFA 3CQJA 1K8XA 4M0XA 3PUDA 4U5KA 2J88A 4K68A 4IQEA 4IWWA 1ZNNA 1UKQA 1E4IA 3N34A 2E9MA 1TPC1 2GQ3A 1UR2A 2RHGA 1EC7A 4ICCX 4N02A 4YCOA 3NZ1A 4Z0SA 4O17A 4LFYA 6TIMA 3IVUA 3B40A 2O55A 1AJZA 3Q8PB 2F6XA 2XINA 2HROA 1RK6A 5K9CA 4F2BA 3G1AA 4P7LA 4FOJA 3KCOA 2X41A 3NVDA 2QJIA 4ROQA 3BJSA 4M6QA 2IKJA 4H8HA 3P5YA 3CHVA 1XH1A 2NUYA 4QSHA 1OZMA 4MDPA 2W5FA 2CCRA 3HMCA 4C1NB 2J27A 1E71M 3W70A 4TOQA 3QV8A 1YPXA 1E40A 3BLEA 4KRUA 3SUVA 3TN6A 3W25A 4DWSD 3T8LA 4HQVA 4ZVJA 1GJUA 3IACA 3FDSA 2PDHA 4EXBA 4HN8A 4N9EA 4NKCA 5AHEA 5KG7A 3BANA 4I9JA 1GVOA 2E6AA 3H12A 4GUFA 3M0YA 3VZYA 3ZLHA 3ARWA 4P7OA 4G1KA 4TV5A 4L9XA 5KFOA 3OA3A 3TSBA 3CMJA 3Q37A 1DL3A 4K36A 1OCNA 4ECZA 3H4WA 4Q32A 2IPGA 3L5MA 3NYZA 3JZUA 1XYZA 2OX1A 4ZQOA 1E0WA 1JZ4A 5HK4A 5EGRA 2CLPA 4QBXA 5E0CA 2YL5A 1E6ZA 2CHRA 2QS8A 3M4HA 3VNYA 4ECTA 2NX9A 3M43A 3L21A 5AC4A 3GIQA 1GQJA 4H9VA 2P10A 3EDEA 4RNHA 1EZWA 1E6QM 4RZRA 3M9NB 3S1UA 4UQDA 4AD1A 2V5KA 3POCA 1ECEA 4S3BA 4BEUA 2Q8XA 4OOUA 2DZVA 4YTSA 3A9BA 1JAEA 1V77A 5BOFA 1IQ8A 1GZGA 3DENA 6XIMA 3CPRA 1YADA 3I3EA 1W3JA 3BMXA 4GC3A 4HNVA 3GIMA 1XDJA 4L4LA 2VC9A 3LYEA 4B2DA 4WXYA 2BWGA 1I4NA 4Z2GA 4JTCA 1DHPA 2AKZA 4PTWA 2EG8A 3CYVA 4LANA 1TSIA 3E0VA 3SRDA 3AQUA 2VOTA 4FLRA 3IIVA 1FDYA 5A8GA 3UYCA 2XWEA 4Q7NA 2EPOA 3BJFA 3P8IA 1OINA 1W9PA 1R2RA 1PJ9A 3M0MA 4P7NA 1PSCA 3KOWA 4CD5A 4IH3A 3UERA 2VTFA 2XDFA 5I06A 2H8ZA 4W9TA 1F6YA 3DG7A 1S3HA 1WZAA 3EPGA 3BQ6A 1XR2A 5LSMA 1HKWA 1TUFA 2WTFA 4J9OA 1FWDC 2QCCA 4BQ5A 3LXBA 1OCQA 3DESA 1CXFA 3EB3A 3VIMA 4UOZA 3KX6A 1AQHA 5CC5A 4X9SA 3SR7A 2HMCA 4CU6A 3L2IA 3NGDA 4FSAA 4WJ8A 1RCQA 4S3GA 1GHSA 3WENA 4B3ZA 4FNSA 5D2XA 1K7XA 4RXFA 2DT3A 2B7NA 4O14A 5DLCA 1XRTA 3LLFA 1A3XA 4FR6A 3HQOA 2A2IA 4LYKA 4US5A 3S9YA 2PDMA 4KCVA 5CSUA 1FHUA 5KG3A 1W3KA 4A3UA 1U1HA 3DERA 1KWGA 1PX3A 2ZVIA 1O12A 2HV5A 3LPGA 2WVVB 3NQ6A 3OTRA 3PFMA 1XYLA 5F7UA 4D6FA 1KR1A 1P48A 1DIKA 2V0TA 2D0HA 3BOFA 2A0NA 3IJ9A 4TQSA 4XO7A 2BVDA 4OBSA 4AF0A 4OTKA 1B3ZA 3QLDA 4RE3A 1W2VA 1G4PA 1JZ6A 1MVYA 1UKOA 3TN4A 4EF8A 3GFYA 4O0KA 3NJ3A 4AZIA 5A6BD 3GX9A 1Q2RA 3V36A 1TE1A 1IWBA 2I1OA 4JEQA 4MWAE 3WBWA 3QR3A 1H62A 3GM8A 4AIUA 3TSDA 2LLEA 1Y8BA 4DL7A 1HVXA 5FF2A 1KRCC 4GUGA 3MS8A 1C90A 1QHPA 2I56A 4JTAA 4AY8A 5C54A 1E1CB 1ZS2A 4IFKA 1GGOA 5C70A 2Q6ZA 1DJGA 2FZBA 4DVOA 5BZAA 4TTUA 3VDAA 2DH2A 4TQTA 3TLLA 5KMYA 1VH7A 4ERGA 3CEPA 5DX7A 4PZVA 2XM1A 3KBSA 1UD4A 2NXGA 4RDWA 3UZYA 1PYFA 4ZXOA 3WY1A 1PPIA 3TA9A 2PLKA 3AO0A 1O5QA 4IMFA 4NAEA 3L68A 3MMWA 2R1MA 4QAIA 1RALA 5D32A 1QNQA 6REQA 5FEXA 1D3HA 5HPCA 2EGZA 1J10A 3LN3A 1M7JA 1QO2A 3NZRA 4A8NA 4YNGA 3BLDA 3W3OA 5JUMA 2BMBA 4E3VA 2J7HA 1XYFA 4L80A 2W91A 1XH0A 5E9AA 2ZZ2A 1V3HA 3IAQA 3I10A 3NCOA 5EB8A 4GBDA 3WNKA 4O1BA 1XIGA 1E55A 5J8LA 1LL7A 1KQZA 1TR9A 4IX2A 1TV7A 4YTUA 3RO6A 4Y8EA 3UZJA 5L9XA 3NGJA 1DYSA 3CWHA 2D20A 5LYRA 2DU2A 4JX4A 3O1NA 3L4XA 2XGBA 3PJXA 1TELA 2X1SA 1XD0A 4ERAA 3HPSA 4GYFA 3D3AA 2VGFA 1LM1A 2QAPA 3KBJA 2C71A 2PDIA 1UWRA 2J78A 2ATMA 2VZOA 3EZ4A 4HNNA 3RRXA 4MYAA 2W3ZA 5BRBA 4JCMA 3HTWA 2OXNA 4UWMA 3PM6A 3WQEA 2QCGA 4GZJA 4Q45A 4GABA 4QJ1A 2AMXA 3V35A 3MW7A 3TK7A 1JFHA 4AYSA 3PUEA 4L56A 3GBEA 2VENA 3KOZA 3CPUA 5AC7A 3VOGA 1WUFA 2RFGA 1F61A 2QQ6A 1HJSA 4L9YA 1H3GA 1F5ZA 3P5ZA 2P50A 4GJ1A 4AF0B 1S97A 4GKTA 2O7QA 4ZO8A 1OYCA 4QWDA 3PUGA 1FTXA 3R12A 4QEEA 4JTKA 4HZMA 4LT9A 3NWRA 1HL8A 1ME8A 4V28A 4Y9OA 4AAJA 2OT0A 4ATLA 4MMWA 4HNUA 1SR0A 4M7TA 2DT1A 3DXIA 3EOSA 2J79A 1P1MA 3FEQA 2XVLA 1CLKA 2PCEA 3MP5A 1JYNA 4E8GA 4IFKB 4NJJA 3F1QA 3FX4A 5EA9A 2RGLA 3A3HA 4W7WA 1UB3A 3SCTA 3VIFA 3L66A 3LPFA 5CZ0A 4Q7IA 1HP5A 5GNZA 2VUNA 2AL1A 3G24A 3Q67A 1JNEA 3SGZA 1WNOA 1U1JA 1ONWA 2DPEA 2VEMA 4QCFA 4C91A 3K8KA 4P2VA 3G6YA 2WQPA 4KEMA 1O66A 2ZYFA 3U8GA 3VD9A 2AQVA 4EAMA 3V6KA 1UR9A 3V0TA 1FQ0A 3CMFA 1Y5WA 4AD2A 3W7NA 4I8DA 1TTQA 3MMTA 4AHPA 1DKWA 2XFYA 6REQB 3W7MA 4PCFA 1BVNP 2V4RA 1ZQ5A 2VRKA 1UR3M 1QW8A 3PW5A 3T40A 3VE9A 1JPKA 5C8BB 2G96A 3L9CA 2FVLA 3ZSSA 4OECA 3W74A 1YBQA 1JDCA 3FJLA 2IBKA 1CB7B 3EPOA 4DPQA 3ANVA 1K7EA 4AX7A 4PEKA 4GGHA 1BKSA 4HSNA 4NRRA 4A3HA 3SQLA 4UTHA 3LBMA 3WDRA 1JYXA 1I75A 3H7RA 1TCMA 3VD7A 4ZGYA 3ZXWA 2ATSA 2E1WA 4W88A 4CU8A 5CZJA 4AQLA 2D69A 4E38A 4QDPA 4PH6A 1HO1A 3MDUA 5KT5A 3U2OA 3S47A 4JV2A 1T6MA 3U2EA 4LX4A 5I78A 2W27A 3TYEA 1JJKA 1M6JA 1FWAC 3CQ0A 4Q44A 3EMQA 2I17A 1KW1A 1TVLA 3S2JA 2F2HA 1H7RA 1J11A 2J7EA 4LAMA 3UBPC 3SBFA 3MUZ1 3ZO9A 4Q33A 2AOSA 2P9BA 1QI3A 1E9ZB 3HGOA 4Q8OA 3QC0A 5IM51 2PWDA 2YYUA 4I9MA 5DXXA 3WNLA 4Z0JA 3ITVA 3LS9A 2Z28A 4RNIA 4WJXA 4A21A 1WKEA 3BV7A 3NQAA 4C1LA 4LAKA 3E0LA 2FLLA 2CNCA 1JZ5A 4J3ZA 4E4PA 4YTRA 4JFSA 3A4JA 4Y8FA 4ERIA 3GILA 3W7CA 2NVCA 4LC6A 3QW3A 2VKZG 2PDNA 1YNQA 3B4UA 1DVJA 2X05A 3WF0A 4L6DA 5CC3A 1MDLA 4D8AA 4LBRA 3VYLA 3VC6A 2BBFA 4L61A 2PTXA 4QFUA 1XBXA 3G1VA 2ZVRA 1VJIA 3G2GA 4J4KA 5I0DA 4YTQA 2A5HA 1XSIA 1S46A 4Z1CA 1NWRA 1JPIA 2W6RA 3FFSA 1WV2A 1XYCA 3TTSA 2A4AA 4IMDA 5BXTA 3MPGA 4Q8EA 2DZAA 2VZTA 1W9XA 1G01A 4MB4A 4CQDA 2GGGA 1R47A 2YYTA 4DAIA 1FHDA 5HPOA 5ABFB 1S2AA 1XKJA 2QCLA 3PANA 4GIRA 5HWJA 4AD4A 5FEWA 2VUYA 3CQHA 5AYBA 3KHDA 1P6BA 1XLMA 4WOQA 5MKGA 2ONEA 4M6UA 1OGSA 4DBWA 3QC3A 3UA4A 5K2ZA 1UWIA 3SCVA 1T7LA 3D6NA 1YBQB 3HGJA 4O10A 1KFJA 1QHZA 3SAZA 4DLMA 3EPIA 2ZA1A 2BHUA 3KHGA 1AODA 3W01A 2IQTA 5JQ9A 1E6PA 4ECLA 3WLSA 3CZGA 2GDVA 1SZRA 4AZ5A 5I3DA 4YHGA 3IJIA 1CENA 2UY3A 1Q6GA 3OVQA 1B9ZA 4Q8QA 3OYXA 5KZDA 3S0CA 4P5UA 3W2UA 1UYQA 2J9ZA 2E8YA 2A3CA 4AWUA 1HJVA 1V3JA 3GVWA 4LW7A 1D3GA 2IW0A 3F4WA 4Q8UA 2GUYA 2NQLA 4JQ2A 3KZSA 1P6WA 4IL0A 4LVFA 2VDHA 5A6LA 2FVMA 2XIBA 3L4ZA 2QUVA 2AQOA 5MF5A 4LUJA 3KL5A 4EBCA 3CU2A 4H3DA 1MXGA 3LA4A 1K1SA 3HM7A 1SJBA 5I3HA 3F5KA 1H49A 4GD0A 4NILA 4EPEC 4MNKA 3UXDA 3ITOA 4JTTA 5KFSA 2GDQA 1NELA 5M5DA 4UQ9A 5AYYA 5DMNA 3G1HA 3Q94A 2VD9A 2Z1WA 3TC3A 1KFEA 5BCAA 5IRPA 3EPNA 1JIHA 1NJJA 2GJNA 3PZPA 3O7UA 2FGZA 3GNOA 4F8XA 3GK0A 5D03A 1QVBA 4A29A 1JZ3A 4JTDA 2XIOA 2YFOA 1B3OA 1YTEA 4BHYA 2BSLA 4F9JA 2J66A 3PPFA 3TQPA 4NVTA 5F2GA 3B0UX 4GNVA 3QOKA 4WHBA 3KRBA 3PG8A 4W86A 1B9BA 3LSCA 2Z1BA 1W1B1 4DO7A 2OG9A 4RNFA 1F4HA 1EGVA 1KGWA 1ECQA 4ZR8A 3THUA 1XGEA 1DJWA 1XBYA 4HP5A 1OFAA 5JVLA 1BRLA 1F2JA 4HSHA 4QAWA 3O6CA 4LCQA 3LXCA 1KXHA 4U3AA 4YHEA 4DJDA 1C8QA 3THAA 4CN4A 1R3YA 4C6MA 3MO4A 2GQAA 2J6VA 2HPIA 4W4QA 2X8RA 1POJA 2C2DA 2NWRA 3G1YA 3QFEA 1FWCC 1XIJA 1AW1A 3OLEA 4UTTC 1U5JA 4JD4A 3UT0A 2CLIA 2XHYA 2UVUA 1K6AA 5I07A 3H8AA 5DF0A 3F4CA 3MMDA 2PWEA 2X7VA 4H41A 4B92A 3H2MA 1Z44A 3BMWA 3AALA 4FPSA 5CPMA 1NOWA 3NL5A 1KQYA 1NARA 4U33A 3U6WA 2NQHA 4J27A 1Q5MA 3IV3A 3IAPA 3TU9A 2PRHA 3MUXA 2V5DA 4LNCA 4RX0A 1GONA 3U3HA 2G3MA 1KKRA 2OH2A 4DUOA 3KL0A 3M0ZA 4GZIA 3QR1A 1LLZA 1R6WA 1XW8A 3O0FA 3CJPA 2FGBA 4JCLA 3UCCA 1FA2A 1QCWA 1GYMA 2D1ZA 1REQA 4BKNA 4NYYA 3WN6A 4GI8A 4B3LA 4IG2B 4X60A 1C7SA 2PLJA 5A8NA 3H70A 3I7RA 4OU1A 4DQWA 5L9FA 2PS2A 4GY7A 4GNJA 2WC7A 1Q6RA 4WVXA 4ED3A 4AIOA 2Z6JA 1R0MA 1UZHA 2ZXDA 4UFJA 1OD8A 1TPH1 2F84A 2A3HA 1AW5A 2YX0A 3A4AA 1T8XA 4N9DA 4JTGA 1EYWA 1WQ5A 3FSUA 1OG0A 2HVOA 4B9YA 2OMAA 5AKQA 1F6KA 1X8CA 3TTOA 2VA2A 1FDZA 5D9OA 4IZGA 3CL6A 4S1FA 5FEZA 4LUSA 4KWWA 3R58A 4B90A 4LH8A 2J62A 1A5CA 5I3GA 3NIYA 4G6CA 3ANYA 1J0JA 2J47A 5KFBA 3M64A 4LU0A 3SJNA 4AXNA 1ZBKA 1H5YA 3OG3A 3N15A 4DYEA 4E8DA 2X2GA 5FACA 4E2VA 2Q3RA 4X63A 2DJXA 2O9RA 3PPGA 4G7FA 1MRQA 4JV0A 3W7KA 3P84A 4LPCA 4HMEA 4HBKA 1T0OA 3N6HA 3CZEA 1FRBA 4ECUA 1UQZA 4UTIA 4GI9A 1GKPA 3C0LA 3HPFA 3CS2A 1Z48A 4QSFA 1RVKA 3KRUA 1EZ2A 4MM1A 1EJTC 3N1AA 2IQDA 5GPRA 3AI0A 4XZHA 3QZ7A 5KZEA 3MFHA 3ALGA 4DYKA 4FBUA 1AD1A 5AECA 5CG0A 4ACZA 3NO5A 3IVTA 4C6DA 3WLNA 4ATDA 5C5YA 4C6KA 3GS6A 4CKQA 2F38A 2GGIA 1H09A 4HU3A 2J75A 2V5CA 2XGZA 1J93A 4NJHA 1Q7MA 1XLIA 1AZ1A 4PB4A 1ADSA 1W3HA 3VK5A 3NFUA 3M7WA 4Q4PA 1LORA 3ZIZA 4YQWA 1EJ7L 3EKZA 1Q4NX 4B5UA 1VENA 3RR1A 5C9RA 3TNBA 3S8HA 4YU1A 3NXLA 2PDPA 3PBMA 5A6AA 2PGRA 1YMYA 3HF3A 3ARYA 3GXNA 4HHLA 3VINA 4US5D 4IRKA 4MTVA 2POTA 1ZENA 2HK0A 1L6WA 3GVRA 1OFRA 4O54A 1JCLA 4A3QA 1UA3A 2C14A 2PAJA 3PG9A 4UNKA 2G0WA 3AICA 3S6DA 4KGJA 1EDGA 5E09A 1CBGA 3RIKA 1F7BA 4QCEA 2P8BA 1M53A 3CUHA 4MAVA 1S1RA 3DKJA 5LIKX 3AXIA 5D2TA 3WQ4A 2J6XA 3EX2A 4D8LA 1QNVA 1J8VA 4GHRA 3S2MA 4JQAA 5GJMA 2QVHA 1UIPA 2QMJA 3HB9A 3WH7A 2EHHA 1XLLA 4HA1A 4OHQA 5CPTA 1RLCL 1T5AA 4DAFA 4ZQNA 2VFIA 1EIBA 2G41A 2Z25A 4UFMA 2CLLA 1OX4A 5BWAA 3CMGA 2JF6A 3RPDA 2QDEA 2DUXA 4KQNA 3VC5A 5LIUX 3ABZA 3KRSA 1B4KA 1GJWA 3T9PA 1RPKA 4E2OA 3E02A 1QNOA 2VT0A 4IRCA 4HSOA 4RDZA 5HR6A 4AMCA 3S2LA 3B8WA 4V15A 3WDJA 1ITUA 3S5NA 4PL2A 3N04A 1RUSA 7XIMA 5HMDA 3OHBA 1SR9A 3RPTA 1JFXA 3T44A 4HPXA 3LOTA 1FWHC 4OUEA 2GUUA 1VZWA 1JCYA 3CHCA 4I9TA 3DC0A 3G6MA 2FPYA 4LV9A 1VQTA 4FOKA 3M5ZA 1KO0A 4QLKA 3SY1A 3N12A 5AYZA 3RFAA 2VMFA 3QR0A 3Q2DA 4GYPC 1XISA 3V6JA 1CW2A 2ACSA 4MYXA 1B4EA 3OHAA 4A2SA 2R1KA 3COTA 1GYNA 4F0SA 3OHIA 4MWAC 3UR8A 2H9AA 3SCUA 3C5QA 1TV2A 1GPFA 1XBZA 3A21A 3GV7B 2VQUA 3AIVA 3M5VA 1MQQA 3OQ8A 1LJYA 4ACZB 4GINA 1IEQA 2V30A 1JF6A 3HG4A 4PUWA 3FDKA 3R10A 4O1DA 4OGZA 4ZEPA 2RJGA 1XGZA 2WZHA 1XWYA 3GH4A 1EPVA 1OC5A 2FDMA 2A3AA 2INFA 4GA8A 5D2VA 4ILSA 4HU8A 2YR1A 4MOZA 1JX4A 2B7QA 4TMCA 4Z2LA 3E96A 3QVQA 2CFFA 3KZPA 3LK6A 4QW9A 1EB3A 5M17A 2OO6A 1KFLA 1YDNA 4RV3A 3VUPA 1WX0A 4PMOA 4FALA 3LD5A 3KVLA 3AYRA 2VEFA 2DIEA 3TZFA 4Y9MA 4QJ5B 3MP4A 3IJDA 4ORMA 3P0WA 3NQEA 4LQ1A 4HK6A 4GIAA 1IYXA 1WBJA 3QV7A 4DZHA 1VYSX 3EOLA 4Z1YA 3ZT5A 2PDFA 4GXPA 4YTTA 3BJTA 4JQ4A 4XWUA 3R0KA 3W7HA 1QRQA 3KVMA 2P3ZA 3TYBA 3ZT6A 3ITYA 4XUGA 4WXZA 1F3WA 1BYAA 1BTCA 4XD5A 5KTLA 3VD3A 4GBUA 3A4XA 1DV7A 2G3FA 2XIJA 1Q85A 5JUVA 4JFVA 1E0UA 3LV5A 4DIAA 3QSRA 3O05A 3I68A 2Y0FA 1S3TC 3G1SA 4XAZA 3VGBA 1FP9A 3I3BA 3AZRA 4ZXLA 1GG1A 1HKMA 3LDVA 4CNPA 3CV7A 2ATLA 2OKOA 2ACUA 1OX4B 4EYHB 2G3IA 3VDHA 1UG6A 4WY0F 1CWYA 1MXDA 4BY3A 1VCVA 3A9IA 3CGTA 1OJXA 1CEOA 3P61A 1QNPA 3WLPA 3BCFA 3GIPA 4C60A 3TFCA 1JUEA 2XISA 1DXEA 1XYBA 1VYRA 5KFIA 4X0NA 3C0QA 2YOCA 2DGAA 5K3VA 3VVGA 1W8GA 3BZGA 2PRMA 5AN7A 2GPTA 3UR5A 2PBOA 8CGTA 1XCXA 4FK9A 4BF9A 2E9LA 3VE7A 2V63A 5C9ZA 1MWOA 4PTDA 3PULA 2GL5A 2EG6A 3DBNA 1C93A 1BXCA 1O7AA 3BVJA 1GUVA 2DW6A 3ICJA 3OIXA 2I5IA 3ARVA 3SY5A 3H2FA 2QF7A 5C5JA 3PFRA 5JBDA 4JBRA 2DSZA 1NQKA 4I5UA 3STGA 4ICNA 1GOKA 4LRTA 1CECA 3VKKA 4DN1A 4UXDA 2E40A 3G8RA 3NPUA 4TQRA 2Z1XA 2VURA 5JMUA 5HUOA 3KHRA 4IPIA 3CV2A 2CBUA 2GJRA 2OO0A 3PTMA 1XL9A 3CAKA 3T0DA 4F0MA 3NSNA 1QJWA 3TA6A 2QF8A 2GQ9A 3PC0A 3MSYA 3QQWA 3AS2A 4UTKA 1UPPA 3G6VA 1ZCOA 3QBUA 3HG5A 2ZX7A 3EEGA 1UP0A 3BAKA 1RY0A 1YXYA 7A3HA 3PZQA 1FHVA 3MZNA 3A12A 1D8WA 3SCSA 3ONCA 3LLXA 1M7PA 4W5ZA 2QJJA 2E4TA 1F73A 3FVDA 1KLYA 2J24A 3M5YA 4C7DA 1EJVC 4JUZA 3SO7A 5DQIA 3UG4A 3QV6A 1EX5A 5BXPA 2GSEA 2HSAA 2PTWA 2VNCA 1JGMA 1QPKA 2VFEA 2YJQA 4XIAA 5KFHA 5FJRA 3WLIA 2VP8A 3M41A 4DZIA 1BWLA 1JI2A 3DFSA 3RG6A 4H9TA 2VD8A 4B5NA 3N14A 3TAOA 2NX1A 1B3YA 4PUNA 1F3EA 1W5OA 4H7VA 3Q45A 4GX9A 5LXXA 3POHA 1LBLA 5HNRA 4BI7A 1CXKA 3PJUA 3AOFA 4LYRA 1ZLPA 1YNPA 4IJBA 2J8TA 3A13A 3FXYA 2UV8G 3NQCA 1KBKA 3M0LA 2QW5A 1NDYA 2ZRXA 3TW9A 1VJSA 1Z7AA 3CIXA 2DORA 1RBOB 4PCSA 3RAQA 3ARQA 5C2XA 2WZIA 2WPBA 2VRJA 2P3EA 2CKRA 3ME3A 3SN4A 5FJIA 3S9IA 2PWUA 2YA1A 2XH7A 2D2GA 2ZZ4A 4CNOA 1K9DA 1BPLB 4AIEA 4B9ZA 1XLEA 3M0JA 2ODOA 1SJCA 3EDJA 4R8UA 1QDSA 2QCMA 5C7VA 4QG6A 2YIHA 5I3JA 2Z6IA 3URAA 2ZDSA 1PKLA 3G3MA 3PUOA 3TTYA 4DJEC 3QM3A 4JIRA 2WHLA 2IQ0A 3RBDA 3AUJA 3WFZA 4L64A 3PTQA 3WG6A 1EWDA 5LZLA 4HMDA 1DXIA 2OYLA 2PU1A 3V7PA 3DFOA 4O1FA 3BK0A 1ISVA 1QBAA 2WK2A 2DW7A 1E5JA 1V7AA 4IFOA 4HGXA 4JQ1A