1XRFA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
423
structure length
363
Chain Sequence
WMLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLDRLALIEGVKRGIIDCFATDHAPHQTMPGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords Dihydroorotase
total genus 127
structure length 363
sequence length 423
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrfA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrfA02
1EJVC 4R7WA 2PGRA 4G7EB 4F0LA 3GTHA 4J2MA 4ERGA 4LFYA 3SFWA 3O0FA 1KRBC 3AUOA 1KRMA 2HPIA 4GXWA 3JZEA 1FWBC 1NDYA 4HK6A 3IACA 2Z29A 2ICSA 4RDWA 4PBFA 3NURA 3IGHX 3DCPA 1POKA 1PTAA 2GSEA 2HBXA 4LCSA 3CS2A 4H9XA 3WMLA 4B3ZA 1EJUC 3F4DA 4LCQA 5FSDC 4C6CA 1R9ZA 1PB0A 4KEZA 3G77A 4KEVA 3WYZA 1EJTC 2VM8A 3HM7A 2P9BA 4KEUA 1FWIC 3NQBA 4KF1A 2Z4GA 1EJSC 1V51A 3GRIA 1BF6A 1A5LC 1V4YA 3MDWA 2EG8A 4XAZA 2HNHA 4XAFA 2QT3A 3RHGA 3LGGA 1RJRA 4F0SA 4GY0A 1PSCA 4LAKA 1GKQA 5FSEC 3PANA 4EPEC 2O4MA 3PAOA 4C5YA 1P6BA 4DNMA 2HQAA 4J5NA 3MPGA 2FTYA 1R9XA 1I0DA 3DC8A 4YIWA 1A5NC 2A3LA 3S2NA 2AQVA 3B40A 1K1DA 3A3XA 3PNUA 3UPMA 2GWGA 4HK5A 4DI8A 4C5ZA 1S3TC 4J35A 4DYKA 1NDWA 3LGDA 3DUGA 3F4CA 4C6QA 4XAYA 4C6IA 3BE7A 2KAUC 3URQA 3QY7A 4IGMA 4LAOA 3GU1A 3S2JA 3MVTA 1FWJC 3NEHA 4RDZA 1FWFC 2Z2BA 1IE7C 4GY7A 4CNUA 3O7UA 1RK6A 1J6OA 1EZ2A 1FWGC 4LEFA 1ZZMA 3T1GA 4DI9A 1YIXA 3V7PA 2HBVA 3S2MA 4WGXA 3ID7A 2OB3A 2R1NA 2Z28A 4I6VA 3TNBA 1NDZA 4QS5A 3N2CA 1V7AA 4LCRA 4G7EA 2D2HA 3EWCA 1RAKA 2GOKA 1QW7A 1YRRA 4BY3A 1V79A 2UZ9A 4C6BA 4AQLA 4DZIA 3F2DA 1M7JA 2AMXA 2R1MA 4PE8A 1RA0A 2BGNE 2WM1A 3K2GA 3T8LA 4IH3A 1GKRA 2DVUA 1FWAC 1FWEC 5HMDA 5HMEA 2VC7A 4ICMA 4WVXA 1UBPC 3HPAA 4L6DA 1YNYA 5HMFA 2YXOA 1P1MA 2AQOA 4KQNA 5G4HC 4H9TA 2FVMA 1J5SA 3QGKC 4V1XA 4C65A 1UIOA 3IRSA 4XD4A 4BJHA 4LANA 4GK8A 4IG2B 4NP7A 3RN6A 5LXXA 2Z00A 1RJPA 3QGAC 3E0LA 3OVGA 1VFLA 1ADDA 3A4JA 1W1IE 2QVNA 3MDUA 4GC3A 1XWYA 4CQBA 4ERIA 3OODA 3EGJA 4H00A 4GOAA 3E0FA 3EWDA 4IFKA 2Z2AA 4LH8A 4H9ZA 3GTIA 2OOFA 3F2CA 3UBPC 3ICJA 2I5GA 5CH9A 3A3WA 1E9YB 4KIRA 3K5XA 2EG7A 2DVXA 3FEQA 4IFOA 4UBPC 4H9VA 2YZ5A 3MVIA 2FFIA 3C86A 3IARA 3E2VA 4IGNA 4WHBA 4XD3A 4R85A 3UR5A 3GUWA 4B90A 1O12A 3R0DA 3IPWA 4OFCA 4EPDC 1EJWC 1JGMA 1FKWA 1M65A 2W9MA 4RZBA 2UBPC 4B92A 3E3HA 4DIAA 1P6CA 3OQEA 4I6KA 1NDVA 3AU6A 2FTWA 3WZ0E 4IFRA 4C6KA 2ANUA 1V77A 4QRNA 2I9UA 4RDYA 4C6JA 4DLFA 3GGMA 1XRTA 1XRFA 4CNSA 4R88A 4CEUC 4ERAA 1J6PA 3F2BA 1XGEA 4AC7C 4KESA 1M68A 3K4WA 3HTWA 2Z26A 3ORWA 1RJQA 4ZSUA 2F6KA 2BB0A 1RK5A 3RYSA 4BKNA 3TN3A 3LSBA 1O5RA 4C6FA 2R1PA 2OGJA 4GZ7A 3S2LA 4C6EA 4HJWA 1FWCC 1KRAC 2CZVA 4C6PA 4KETA 2DVTA 4EPBC 4C6NA 3GU2A 3OU8A 1QXLA 4NG3A 2HPMA 2IMRA 3GTXA 1DPMA 4H9YA 4JOMA 1EJXC 4C6DA 1WXZA 4MUPA 3ITCA 5A6TC 3PNZA 1A5MC 4IG2A 3RCMA 1UIPA 4XD5A 4CEXC 1GKPA 4GBDA 2P53A 1KCXA 2Z24A 5E5CA 4LAMA 1ONWA 3MKVA 2YB4A 3FDGA 4NI8A 4CQDA 4IF2A 4C6LA 2Y1HA 3LY0A 1UMLA 4Z42C 4INFA 3MSRA 3TN4A 3KM8A 1NFGA 4RDVA 1FWDC 3UR2A 4B91A 4EP8C 3SO7A 4PCNA 3TN5A 1YBQB 3QY6A 3LNPA 4V1YA 1E9ZB 2Z25A 1WXYA 1A4MA 1J79A 2PGFA 4HK7A 4XAGA 2OODA 5AKQA 1POJA 1HZYA 4M51A 4RE0A 4C6OA 3LSCA 4GY1A 2Z7GA 3GIQA 3URNA 4XD6A 1ITQA 2FVKA 4F0RA 3MTWA 3T81A 3OOQA 3ISIX 3IJ6A 2WJEA 4GYFA 2Q01A 3GTFA 4IFKB 2PUZA 2Q09A 3LA4A 2QPXA 2VHLA 4DZHA 3LU2A 4CQCA 4D8LA 4QS6A 3S4TA 4C6MA 4G2DA 1A5OC 2YB1A 1RA5A 3URAA 2E1WA 1R9YA 4DO7A 1FKXA 2G3FA 1EJRC 4PBEA 4ZSTA 3B0XA 4C60A 2D2JA 1ITUA 2Z27A 1I0BA 3LS9A 2R1LA 2WJFA 3FDKA 4H9UA 4EPKA 3E74A 2ZC1A 4CNTA 4H01A 3B0YA 2EG6A 3OJGA 2WJDA 3MJMA 3TN6A 4DLMA 4KERA 1YMYA 3GU9A 1KRCC 2P50A 1ONXA 2GZXA 4QSFA 3E38A 4UB9A 4E3TA 3GIPA 2O4QA 4HA0A 2PLMA 3GG7A 1PO9A 4P5UA 1K6WA 1FWHC 3CJPA 2RAGA 2R1KA 3IV8A 4IQJA 4LALA 2OQLA 1EF2A 4GX8A 4QROA 1K70A 2VUNA 1EYWA 2XIOA 3URBA 4GX9A 3AU2A 3D6NA 2VR2A 4PCPA 1YBQA 4QTGA 2D2GA 2VC5A 4TQTA 3PBMA 2GWNA 4H9MA 2QS8A 3CAKA 4L9XA 2ADAA 3UF9A 2E25A 1A4LA 1A5KC 3QY8A 2PAJA
chains in the Genus database with same CATH superfamily
4NIRA 4J9JA 4IGSA 2FJUB 1LLOA 1JX4A 1YDOA 1DWFM 6XIMA 1BVWA 4GXWA 1CGTA 3SN0A 2E9MA 3RILA 2O9PA 2Q8ZA 1UR4A 3NURA 4IPLA 1O68A 1E73M 2WMFA 5G2WA 3IJIA 1JZ3A 3E9AA 1AH0A 4A8LA 3ITVA 1QHPA 4Q4PA 3FYPA 5U7SA 1ISYA 5CSSA 2JKAA 4KEZA 1H7OA 4DUOA 1PZ1A 1OX4A 3ARWA 2P9BA 1GHSA 1FFRA 1UKPA 3M47A 2AQWA 4JEQA 4PULA 2EG8A 2PF0A 2XFFA 1ZCOA 3PZGA 2VOTA 1NH6A 2GQ9A 4F0SA 4HYRA 1E51A 3G1SA 2PWGA 4WLCA 4LAKA 1H49A 3NZRA 1QI0A 3PANA 3STEA 2P76A 5LGXA 4Q4MA 4HOWA 4XZMX 2DJXA 2BHZA 4KWUA 4HU4A 4P61A 2Q8LA 5I7GA 3WY1A 5CZ0A 4LOCA 4ASTA 4TQRA 4BK9A 4MUZA 1DIKA 3I7QA 4NZJA 4WSKA 4DWDA 1TMHA 3B8IA 4JTFA 1WUFA 3QBUA 4C6QA 1XLEA 4O54A 5EKYA 1OC7A 3NVDA 3ZIZA 2DDXA 3MVTA 2ATSA 2X1TA 1H50A 3T2QA 5FF4A 1L8PA 2CXGA 3UA4A 4LS1A 3L5LA 1RBLA 1VJZA 2A7RA 3AS1A 1BAGA 4CQAA 1EXPA 3N2CA 3L67A 5AHLA 1DQWA 4HZ6A 4H2CA 1XIIA 4G7EA 4RUBA 4HT3A 1OK6A 3B05A 1QW7A 5E0CA 2OZ8A 4ZENA 3M7SA 2IW0A 2O0TA 4AQLA 3TK7A 2UY5A 1JXLA 3GTNA 3F5KA 3P5YA 3IAQA 5A2CA 1ZAIA 1TIMA 2PA6A 5FD0A 4LNYA 2QXWA 3OLEA 4KCWA 1JPIA 2G4FA 2F9RA 3ABXA 2DZBA 4ICMA 4IGHA 4S39A 3BGGA 4GZIA 1U30A 4RW5A 3S5NA 4JTIA 4IG2B 2CWXA 2GGHA 3QGAC 5EBUA 1VFLA 1ADDA 1KGUA 1KGXA 1UKTA 3LXBA 4DBEA 2QVNA 3MP5A 1G4SA 2ZOXA 5LIYX 5KFZA 1KQYA 4YL2A 1DQUA 4AD1A 1JCXA 5KFWA 3PFMA 4LYKA 1QNPA 2X16A 5HXMA 3GILA 4JTHA 4NU7A 1S5MA 1L6SA 2HDJA 1E5JA 3BICA 4P7OA 2G97A 3FX4A 1KV8A 3AICA 2PWFA 3BAIA 4Q6XA 3XISA 3EMZA 1B90A 5H8PA 1XR2A 1EJWC 2YYTA 1MXGA 4IMCA 2EXOA 4DBWA 3MV11 2DSWA 1LM1A 2BVWA 4CCCA 3M9OB 2AGPA 1MRQA 1UZ1A 2QCDA 3GG0A 4PMDA 1TKKA 1TSIA 1Q85A 1EWDA 3MV01 3WH9A 5FA5A 4IPNB 4CKQA 1M6JA 4Q8MA 4KMQA 3V1PA 4IIBA 1Z7AA 1OINA 3ZWTA 2XIMA 4JQ4A 1F8MA 2BVDA 4LUSA 1YPIA 4PTDA 4EOUA 2Y5EA 2PF8A 3OU8A 2Z6IA 3BAKA 4HPXA 1IGSA 4ZCWA 1TV3A 1RHCA 3ITCA 2VRQA 4KBXA 2NLYA 3T8QA 1XFCA 4U31A 1VEPA 2WHLA 3JVAA 3PZTA 2DQWA 3LRKA 1ONWA 1CXFA 2PWVA 1FDJA 3H22A 3P0XA 2XIQA 2O7SA 3AALA 4FOKA 2QCCA 1X6LA 3CEPA 5FIPA 2RJGA 4C6LA 4O11A 3IUIA 4ALDA 2ZA1A 2BS9A 4AHQA 5A8NA 4B91A 4O3NA 3L2MA 4ECVA 3E0IA 1V6VA 2O56A 4HCDA 2OO6A 3QY6A 4B4HA 3PBVA 3BSGA 1EX1A 3NDYA 3HO8A 3EBVA 2ISFA 1SFLA 4QNEA 2WVVA 2W3ZA 4GUGA 3SIMA 4H4IA 3GIQA 5KFAA 1X6NA 3GNPA 2JF7A 3HQNA 1LP6A 4AZIA 4L1XA 4V2XA 2DY3A 4KWOA 1OFQA 3WLQA 2DP3A 3OHIA 3WQCA 1XBZA 1KBIA 3BG3A 3USBA 4IPIA 1PXGA 4DRSA 2C3ZA 3MANA 4DL3A 2EF9A 2G3FA 4QG6A 1KD0A 4R7JA 4FOJA 4OTKA 4TVDA 1ITXA 4PUKA 4HIBA 2C1GA 2Y24A 4QM1A 1A47A 2O55A 3T07A 4AW7A 5E0KA 3EOEA 4UQCA 5K9CA 2YFOA 3JW7A 4KGJA 6TIMA 3UJFA 2CERA 4P5UA 3TFXA 1CNVA 3WJZA 3KTCA 3DN5A 4FX8A 5BXSA 1K70A 1IWAA 3UJ2A 3IRDA 2VR2A 5KFGA 2Y62A 3C0LA 4FIRA 5G4EA 1CLVA 3OZYA 3RRXA 3WMBA 2FZ9A 4L1WA 1EOKA 1RD6A 3LHVA 1MZRA 3N2TA 3QY8A 4HNTA 4F0LA 4FXJA 3VIFA 5HPCA 1NWUA 4HJFA 4TMBA 1S38A 2V67A 4UFIA 3UG3A 1KRMA 3CV6A 5D8WA 4WKHA 1ECQA 2DU2A 4X9YA 5H2ZA 3S1UA 1DWAM 3HV8A 4M5PA 3K8LA 4LCSA 5C9XA 1JXKA 3WDRA 3IJQA 2D22A 4QFUA 6ENLA 5DMMA 2XSXA 3BAJA 4DBDA 3L4WA 3V18A 1EHNA 3C5QA 3BLPX 5H6HA 2QUNA 4O8AA 5AYXA 1KFKA 5K2ZA 3AIUA 4N2YA 2A7PA 1YNPA 2NXIA 3LGGA 2ZX8A 2NWSA 3OHMB 1WKDA 3B8TA 2QCGA 1DWHM 4WCJA 2V3GA 2OYLA 5C54A 3S83A 4GYJA 3NA8A 1K8ZA 1P6BA 5C0QA 4I7WA 1K77A 1Q5MA 3VX1A 4J9NA 2VRJA 3B40A 3JR2A 1VBJA 1XF0A 2REQB 4FI4A 4Z2IA 2DJLA 2WC3A 1S2UA 1F7BA 3E2SA 3LGDA 3NPUA 3NAVA 4XAYA 1KFBA 3TA9A 2OEKA 3ZJKA 4HB7A 1MEWA 2OOGA 5E09A 3O6AA 2A3CA 2TPSA 1EZ2A 5TIMA 1JG9A 5LSMA 4DN1A 2V0TA 3OVPA 1CW2A 5C9WA 5A6BD 3KX6A 4MGGA 4MAVA 1UYQA 4FIQA 2MUCA 2DIJA 2HXUA 3WH6A 1LF1A 4BA0A 5AVNA 5FJTA 4KFNA 3T2OA 1W1A1 2R91A 2BGNE 1SMAA 4WKAA 4Q32A 1FOBA 4K2SA 3RR4A 1ALDA 1C8VA 1W8SA 1K4GA 1PX4A 1BSLA 4ILSA 4CD4A 3CUZA 1Q4NX 3LK6A 1GVEA 3EXTA 3LTPA 3ZLGA 4YN5A 4NASA 3T40A 5C9ZA 3W00A 4ED3A 5IHRA 1H4PA 2Z00A 3BCFA 1B3WA 2PD5A 4FR6A 4ZOEA 4NJHA 3MO7A 4JQ3A 5CZKA 3VA8A 4PC8A 3FGCA 4CQBA 3NDOA 3GD6A 4NVTA 2IMWP 1W5OA 3P7YA 3NPVA 3M5VA 1YDNA 5LYRA 1MMFA 1WYIA 5HANA 2V6AA 1X1ZA 2J4GA 4C90A 1VEOA 3LHZA 3SAZA 1W3LA 4B9ZA 4ROQA 3EDJA 3GDMA 3N9RA 2XN1A 5KFRA 1J4EA 3GY1A 1M65A 4A3YA 4GIEA 3FIGA 4PMVA 5DFAA 3KWXA 3PSWA 3E3HA 2JFEX 3SJ3A 2ESCA 2OLSA 1UUMA 1OF6A 4R88A 4ZVJA 2QR6A 1FWRA 1MZHA 7A3HA 3UWVA 1DJIA 4RR4A 1UOZA 3ALGA 3M16A 4R8UA 1B2YA 3AROA 1H7PA 3DFTA 3RLHA 4JYEA 3BJTA 3KCOA 4ADTA 2OVLA 3N6HA 2Y5JA 4RUAA 2RUSA 4EK7A 3PY2A 4J3VA 5KFVA 4F2TA 3MUAA 1HKJA 1V93A 4JOMA 2BY0A 1WXZA 4MUPA 4IG2A 2NV9A 2WVTA 1SVDA 2E6YA 4J7RA 3VGHA 4J9KA 4IXHA 4Z2GA 3EPNA 4RE2A 4LVBA 3CB8A 1Q7QA 4GACA 3M0JA 2QDDA 2ZXQA 2DUZA 2P8CA 4ZB5A 2AKZA 4IMGA 4LUTA 3V0TA 2EJ1A 5A6LA 4WY0A 4P7RA 2FPYA 3RAOA 3PBUA 3EDFA 3EEZA 4ZQOA 1EGVA 4IR1A 4PCNA 2QJIA 1MW2A 5DANA 3SCNA 2PWHA 1ADSA 2J74A 2OH2A 1R3SA 2F7FA 3AMLA 2X1RA 3RR1A 1XLGA 5DT5A 2X05A 1PEZA 4WZHA 3DHPA 2HCVA 4O3PA 1CCWB 1RY8A 1XDJA 3RFAA 3CK5A 4PRRA 3D5HA 4NILA 3AS3A 4Y9NA 3BSMA 3OOQA 4H1ZA 2RGLA 3PG8A 3RO8A 4Z1AA 2NQHA 4W85A 2HVOA 3BOXA 5CC3A 1EZWA 1KR0A 1SJAA 2BMBA 2E9LA 2GLKA 2X42A 3WF2A 5XINA 1I2NA 4FXSA 3WF0A 3FAWA 1BRLA 4NQ1A 3E49A 1WDRA 3AS0A 4DJFA 3N12A 3PWAA 3OLDA 3G0UA 1HFBA 4L9ZA 5C71A 5KT3A 3G0XA 3AHYA 2R1LA 3FDKA 3WBYA 1KWGA 4Q22A 1J0KA 2ZC1A 4H01A 3WF1A 2C6QA 4PL2A 4I5XA 3UXDA 3UPWA 2GUBA 2AGTA 4A3QA 1Q6DA 1CGXA 3SN4A 2UVVA 1RSCA 3P3BA 4S3KA 5HA7A 1QASA 3LEPA 4UB9A 4LAZA 5F4WA 3COTA 3PW0A 3A22A 3S1XA 2BGQA 2R1KA 2WSQA 3K4AA 1JIHA 4Q8VA 2POTA 5GJPA 5JBFA 1L8NA 2QUUA 3URBA 4ED6A 2YZRA 3H4WA 1V02A 4EACA 3ABZA 1WKYA 1LBMA 4Z0JA 3DAQA 3UCCA 1OD0A 3TQ1A 3WNMA 2YR1A 1AQHA 1Q63A 4KCTA 4AIBA 5KTLA 4RDWA 3ES7A 3WDPP 3IGHX 1TR9A 3SADA 1RYRA 3HURA 2W8LA 3WK2A 1GONA 1K6AA 1F05A 5FJUA 2WKLA 1QOQA 3PVFA 5CPOA 4Q7BA 4AZCB 5GJNA 1A53A 3OB8A 4LUIA 3KL3A 1SO5A 4KEUA 5FEZA 1UPMB 4N9BA 3WLMA 1TQXA 3E12A 4DNHA 4J9LA 1DJZA 2V82A 1DIOA 1BHGA 1SJDA 5BW6A 3I3BA 2A6LA 4ZR8A 1E1CB 1KA9F 1OCNA 3R0KA 1OCBA 4WDWA 3A24A 7ODCA 4XB3A 4GUHA 2O4MA 2AAMA 1E3XA 4JFVA 4HZMA 4P2VA 1TV4A 1UWQA 5IDZA 4M7SA 4JIRA 3G5EA 3E2QA 4XZLX 1TPFA 3NQVA 1HX0A 4HOZA 1Z3NA 4HK5A 1VB9A 3VNZA 4GQ0A 1PDZA 2HRWA 4L1GA 4DBUA 3QQWA 3URQA 3WQ5A 3GU1A 5DN1A 1DWGM 3NQ2A 3FEMA 4ML9A 1B3OA 4A2SA 1RQEA 4LUSB 2EPNA 1GNXA 4BQ5A 3FNDA 2VO5A 3ZJ8A 2HE5A 1R3VA 2CBUA 1GEQA 4MMWA 2B7PA 2PLCA 2OB3A 3ARTA 5DXYA 3UGRA 4GIAA 3WH8A 1NDZA 1S2CA 1PHQA 1V7AA 2P3EA 1GZGA 2PWEA 4BI5A 4K7YA 5C5YA 1P0EA 3ELFA 3IGXA 3R13A 3QSRA 4Q4QA 1JZ7A 1MDLA 2H9AB 1AMYA 2WM1A 2OSWA 3VO0A 5BOOA 3UG4A 1H5YA 4M6VA 3GW3A 3SUWA 1IEVA 1ZENA 1Q13A 3PJUA 3BO9A 3OVQA 2WHKA 2XGPA 4MADA 1QATA 4W7VA 1KBLA 3DFNA 3V5FA 3MI3A 5HPOA 5G4HC 3E02A 2CW6A 4C65A 1V3KA 4NAFB 2A2IA 3OVGA 3WELA 5HOSA 3AIBA 3P74A 3PPGA 2JEFA 3E0FA 3VE7A 4DUWA 3BGJA 2W9CA 3OBEA 1UKOA 1L9WA 1ZBKA 3P0WA 4HZ8A 4EVZA 2W9AA 4TX6A 3SCUA 3VIJA 3A3WA 4YJ5A 5D33A 1QCWA 1RVKA 4NKCA 4UBPC 2VX5A 4LSBA 4D6HA 1N8FA 4YVVA 5J8LA 2YBVA 2FYMA 3N73A 4AWUA 5KFNA 2Z6JA 3VUPA 1ESWA 1VFMA 4DIAA 1P6CA 4LRTA 1TVLA 2SFPA 4QQ3A 2PDXA 3MFIA 9RUBA 1VFHA 1IWBA 1O6IA 2FLLA 3WNKA 3SCTA 4CNSA 3U9IA 3QGVA 4P8VA 1W9XA 4KESA 3H4BA 1M68A 1GOMA 4W4QA 2HISA 4F4ZA 1WX0A 2CPUA 1XUZA 3OSPA 1IZKA 1OY0A 5C7VA 2ZXBA 1QW8A 4DPPA 4FEZA 4LS0A 4IIGA 4S3DA 2B31A 4D9PA 3LXAA 2VCBA 3SN1A 3GU2A 4YR2A 3CNYA 3VDBA 1E4MM 2HZGA 4RXFA 3GTXA 4S23A 1LORA 5KT7A 3I65A 4JIIX 3KW3A 2JGQA 4AYGA 4CEXC 4GVHA 1YDYA 4MM1A 1QVBA 3OW1A 1ELSA 4K39A 4OT7A 1E55A 3FDGA 2FHCA 2NX9A 3G8RA 1LLWA 3I3EA 3WD4A 3Q67A 3TSDA 4ZXLA 5C9UA 1LQ0A 3NZPA 1DE6A 3IS4A 4RZ4A 3IIZA 3QMSA 3QC0A 3U7BA 4GVGA 4PL1A 3B8UA 1AJ2A 2QV4A 4QLLA 1JFHA 4XAGA 4NSBA 3AZRA 3EOSA 2CESA 2OT1A 4R53A 1JQVA 4K7VA 2VNCA 1SW3A 4A3HA 3B9DA 4A8NA 2EO7A 4E8GA 4PUDA 3PTQA 1RYSA 4DZHA 2YCLA 4QAWA 1FCVA 1CGYA 1WBHA 4AD3A 2E40A 5CJMA 4N7QA 1OX6A 3CAWA 2QDEA 1RA5A 1R2RA 2PCQA 4DO7A 1J96A 2A85A 4RV8A 1V6TA 4UQDA 4EPKA 3FA4A 2WJDA 5DELA 4JCMA 4QE4A 1YXYA 3KVKA 3W73A 5ABGA 1BXBA 2D23A 5C2GA 4H8VA 2GQAA 7PTDA 1NWRA 3TE9A 2CNCA 3AXIA 5AZ1A 2Q3OA 3IV8A 3TNOA 1AZ1A 2Z1SA 2G8ZA 4N42A 4ZGYA 5H8MA 4HSHA 1FP8A 1UZDA 3AU2A 1E56A 3L23A 2ATLA 1I2PA 4LXFA 3S6DA 3WX7A 2YCJA 2VC5A 2R8HA 3ITGA 1N2VA 1V08A 3KBWA 3KZPA 1IYXA 3PTKA 3U5YA 4IOTA 1OZMA 4HU0A 3DHFA 3PW4A 3EWUA 1CECA 3CZLA 1I1WA 2GDVA 1C7TA 1W1ZA 3L2LA 3O3RA 3AXMA 4MB5A 3H7VA 5IFTA 5DXXA 2OT0A 3VOCA 5CBBA 3TTYA 2PZNA 3TDFA 3O63A 1H63A 2VEPA 3VGDA 1P7TA 1ML1A 2NQJA 5G2HA 3S6TA 4KWSA 4GG9A 4ZFCA 1NU5A 3FXGA 4NY2A 3TZNA 2WK2A 1E6XM 3T09A 5JBEA 4N9DA 1R9ZA 2GJNA 3G77A 2WQDA 3KOYA 1V3JA 2UY4A 1J0YA 1TJRA 4RPPA 4RCXA 3UJRA 1KM1A 4US6A 2C14A 2Z4GA 2CZFA 3FXYA 3ABRA 3VOGA 1W56A 2QF8A 3CPRA 4DJFD 2V5CA 1PSCA 2E3ZA 1WBJA 4JZ5A 4QNWA 1WOBA 1IIGA 2VFEA 3G3MA 1RV8A 2FTYA 1TWWA 5I3JA 1UWSA 1I0DA 3VOFA 4GUJA 1E9LA 2G41A 1GQNA 3DFHA 3TJIA 3PPHA 3GNXA 2GWGA 4W5UA 1MFUA 4J35A 4Q8PA 3C56A 4XVEA 3RNDA 4MZ1A 5LZLA 3E0VA 4HPJA 3W7EA 4P7QA 3RLVA 1C92A 4C7DA 1RCOB 3BH4A 4ZOCA 3CO8A 1KXQA 1PAMA 3I68A 4I90A 3UWYA 4TX8A 1F3XA 3TVAA 3ZR6A 3ZT7A 3ENLA 2R1NA 5AOUA 3LCGA 3QR0A 4HCLA 1M7OA 3OLGA 5KG2A 1Y8BA 3GO2A 3LHWA 3R4IA 3EWCA 3THQA 1K7FA 1BD0A 3QN3A 2QAFA 3DI0A 3V75A 4TMCA 3SGUA 4GGBA 1P48A 1TPC1 1ZP4A 2AMXA 4PE8A 4L56A 2QULA 1ZBCA 2ZUMA 1XD1A 4MNMA 4ACZB 3TTSA 3PB0A 1NSJA 2NQLA 3W0KA 4F9JA 1H1NA 2V2HA 3LM3A 1AL7A 4OJYA 3ITXA 1S5TA 1B3VA 5A94A 3GHRA 1M1BA 3LPPA 4PCFA 1EHAA 3UVAA 2UY3A 2YXOA 4XZHA 4WSJA 5A8GA 1TB3A 3W1PA 1UR8A 3BTNA 2CYGA 1DYSA 4XD4A 1FY6A 3IRSA 1SZRA 4ZFMA 5MHBA 1FVPA 1PCKA 3WUFA 3AISA 2VC6A 3HGJA 2ZRZA 4GC3A 1WAUA 1MQRA 4XBSA 3P84A 4MSSA 1LJYA 2OZ0A 4KFOA 5A8MA 3HG5A 2FJKA 2PTWA 2I5GA 3N15A 2XZ9A 3MBFA 4AY7A 4KIRA 4JXCA 2PC4A 2Z1BA 7ENLA 4H9VA 3K13A 1YADA 1XPGA 3KHGA 1VD6A 1JDFA 4DJFC 2WNQA 1EIBA 3T5KA 1F6PA 2QCEA 1LOLA 3EMCA 3M0KA 1FKWA 5FJPA 5EBAA 4AD0A 3C3UA 2RGMA 3D47A 1CIUA 2DZUA 5HJYA 4NHVA 3EWZA 1CENA 3MKCA 3O07A 5G5IA 1XBYA 4F0MA 2UV8G 1OZQA 3LV6A 1NFPA 4LV9A 2OU4A 1JCMP 1ZJAA 4EAYA 2J62A 1KNWA 5BROA 3K4WA 4YTQA 3H4GA 3P93A 4D6IA 2YFNA 1GZ1A 3TN3A 4ZBCA 3SBFA 1JFXA 1A80A 2BXZA 1YE4A 4AHPA 1E72M 4KETA 5GPRA 3DBPA 4UXDA 4TVCA 1QI4A 1AQFA 2IMRA 1GQKA 3VKBA 2ZFAA 2CLFA 3GR8A 1EQPA 4C6DA 4R9OA 1GQJA 2WMKA 5I06A 2BG5A 3ALFA 3C0SA 4XD5A 3N2BA 3W1AA 2Q8XA 3GHUA 4XBKA 4YCPA 1KLZA 3DGBA 2ZZ6A 4NI8A 4PUJA 5KFUA 4RNOA 3PZUA 4FALA 3S8HA 4QCFA 3TTOA 4K1WA 2YDRA 3VMNA 2BVYA 1MDRA 4HMDA 1PJ9A 5CPTA 1DKWA 4B15A 1XLAA 2J24A 2J77A 5KG7A 4L4PA 2RDIA 1BWVA 3E5BA 3NNTA 3H7UA 1W5PA 3MB9A 1W17A 2AAAA 5FJIA 4CVWA 3PTMA 4WGHA 4MB3A 1GG0A 1UZHA 1VFOA 4R3UA 3N11A 4BEQA 1Z8AA 3W7IA 3R43A 4B3KA 4M1BA 3LA4A 2YDAA 2FIQA 2X09A 2VHLA 2PDFA 4U2ZA 3HG2A 3QZEA 4DM2A 2BNJA 5D32A 5HQMA 5DMNA 3PZ9A 3G1HA 3UU0A 4JKLA 5I77A 2VOMA 1R9YA 4HHMA 4EF8A 2GGGA 4Y96A 4GNJA 2C79A 4UTIA 2D2JA 5D05A 4DWSD 5A8OA 3AHTA 1F6YA 4QIUA 1B54A 1XLJA 4MVAA 1OFEA 3UZ5A 1RBOB 1XIFA 4MWAC 1ONXA 1JVNA 5EMJA 1OWQA 3NXLA 4HYVA 5AYIA 3VKJA 1NQKA 2JEIA 3WEMA 2VKZG 5EU9A 3DESA 4IQJA 3W74A 4IPJA 3G1RA 3M0HA 3V36A 3PM6A 4GX9A 2A3HA 4PTVA 5CC6A 3EPGA 3CAQA 2REQA 1VCVA 4YS1A 3F1QA 3FDSA 2WLYA 4L9XA 4YP3A 4NX5A 2Y85A 1D7KA 2E25A 1B30A 3I7SA 1WOAA 2QPSA 2PAJA 4PR4A 3CU2A 2Y63A 4G8TA 2HPIA 3WDHA 5EWEA 3G1AA 3ECQA 1IT0A 2A1YA 2CLOA 2I7GA 3LERA 2W4XA 1YDVA 4LUTB 4H9XA 5D09A 1EJUC 2XGZA 2JGYA 5FSDC 1OIMA 2AU0A 3UY8A 3TQPA 4GA8A 3HV9A 1R3RA 3N2OA 3DYPA 5FJOA 1HP4A 1T3NA 1BTMA 4DEZA 4JPGA 3KRZA 5IDIA 3S5YA 1VPQA 1A5LC 1XDLA 1YX1A 2O9TA 1UG6A 3AS2A 1PIFA 3UW6A 3OO2A 5DF0A 4G1KA 2HMCA 1DIDA 4AZ7A 1JIBA 2WKGA 3DC8A 5CPQA 3AJ7A 3UYIA 2PP0A 1K1DA 3F4VA 2Y7GA 2Y8VA 1N55A 4MIMA 2CLLA 5EMKA 1TPUA 5G1MA 4GI9A 1GZJA 1M7XA 4RV3A 4DJDD 1FWJC 5L1LA 2Z2BA 1I2RA 1V03A 1VP5A 2A79A 2J9YA 3TMQA 2VP8A 4DI9A 5HINA 2EQDA 2YGYA 1LYXA 4IIHA 5KT5A 3I4KA 2J88A 1ZBWA 3ANVA 3MY9A 2CHOA 1CZ1A 3WEZA 3PZNA 4TTGA 2ACRA 9XIAA 4O28A 3PJXA 4L64A 4HA3A 1JCTA 1NQ6A 5FESA 3WNLA 4QWBA 1GPWA 4E38A 1WUEA 1M7JA 1JULA 4O8RA 3F5JA 1JL8A 2DZTA 3EX6A 1MQPA 4HNLA 3RAXA 5D2YA 4UOJA 1LWHA 3DI1A 5D03A 5I09A 5BXRA 3E96A 2AQOA 4OV4A 3CUFA 3LLFA 4FO4A 1HGWA 4O1BA 5F2MA 3OG3A 4LANA 5CQ1A 3CM4A 3RN6A 4DELA 1KKOA 3SJNA 4E2OA 3B8DA 1V5XA 3FHAA 1BEUA 3A4JA 1W1IE 3MDUA 3PUOA 4F50A 3ZQ9A 2E5BA 3M43A 5CPLA 4IL0A 1IXNA 4GOAA 4PMXA 4GI6A 5BU6A 3STGA 2ASDA 3SUTA 3UBPC 2F2KA 1V0MA 4JQ2A 5AECA 2QCMA 2QVHA 3CH0A 2ASLA 4JNZA 2WXDM 1E9YB 4W87A 1SSGA 5ECUA 2V38A 3G18A 4IFOA 4K8EA 4AZCA 2V4QA 2VA3A 4H7CA 4YTRA 5BCAA 3DEQA 2J27A 3C52A 2VR5A 2Q02A 2RDWA 3G6VA 1WZMA 2I5IA 2WANA 3WUGA 4QBXA 4FXFA 3R25A 1GCYA 5D04C 4GFSA 1G94A 1NDVA 1B1YA 3WJXA 3BXWA 4GLEA 5KETA 4IP5A 3WUBA 1GK8A 2XPKA 3IAPA 1T0OA 3KCJA 5JUVA 5FL0A 3NSNA 1O94A 4IQLA 2PP1A 5KINA 3QRHA 3MO4A 2VGBA 2X8RA 1VIZA 1XIBA 4GYPA 3JS3A 4WIWA 3DFSA 4JTAA 2OGJA 1QNVA 1V6WA 4MOZA 5EY5A 1DTNA 4GYKA 2DVTA 1JR1A 5D37A 1H0IA 3IEBA 1H7WA 4GINA 4DHGA 3M1ZA 3UG5A 1NVMA 3GXMA 2PDWA 5E5CA 1TV5A 3N19B 4DQWA 2Y1HA 2ATMA 3DG6A 1XPYA 1XKJA 3KM8A 2WCAA 3RBEA 4AZ6A 1Q7MA 3W38A 5T9CE 3NG3A 3EB3A 3W71A 1KV5A 5CKSA 2HSAA 3QZ7A 3W7PA 2ZVIA 3USZA 1FCBA 4NX0A 1POJA 5KG5A 5FACA 3THCA 3GDRA 3W86A 1OADA 5H1WA 4BEUA 2EPKX 4LVFA 2YA1A 3E0WA 1Q4WA 4F9DA 4O1EA 2IBKA 3NQMA 2VFGA 1OG0A 2PDHA 2QPXA 1GJUA 2QV5A 3CL7A 1MUCA 2WBKA 4PMNA 3NGFA 1VFSA 1C29A 3IIVA 1Q2RA 2BX7A 2V5LA 3MC5A 5KFEA 2VD9A 3GSMA 4IPPA 1EJRC 4O0KA 5JH2A 1WDQA 3R10A 4MB4A 2Z27A 1HJUA 2ZE0A 2HVNA 1IZCA 3RBDA 9XIMA 4J3UA 3LD5A 4JTCA 3WBEA 3AFBA 4ROPA 5KFOA 4E6MA 1E6SM 1A50A 3BL3A 3WO8A 2B0MA 2GSHA 4IMAA 4TXEA 4QLJA 1NM9A 3H2MA 3OIXA 5ENLA 1PX8A 4E5TA 1ME9A 4FA3A 2NXGA 1EYWA 5K7JA 3ZSSA 4LX4A 4W5ZA 5GJMA 2ALRA 4IL2A 4Q8WA 1EBHA 4HMCA 3PBMA 3N3MA 4QWAA 3U8GA 2I16A 3FKKA 4NRRA 3TA6A 4D6GA 3VX0A 4WY0B 1UWUA 1ISWA 1SFJA 1J5TA 4GD0A 7TAAA 1EDGA 3O0FA 4MHBA 7TIMA 2ZA3A 3PB2A 1MEIA 4HK6A 4ED7A 4H6KA 1D3GA 2ICSA 3RITA 3ITYA 1BPLB 1POKA 3U2ZA 2Y0FA 3GC5A 4YNGA 4WJEA 2D0GA 4YQWA 3WK0A 2PTYA 1LL4A 3NQCA 1NJJA 3A47A 4KEVA 3L4TA 2VX7A 4QJ4B 1EJTC 1YE6A 1F3WA 4R8UB 4KF1A 3EWBX 2F8QA 1VFFA 2YYUA 3O6CA 5HDRA 1ZQ5A 3G1FA 2X2YA 3ONBA 1X96A 3DECA 4KPLA 1AJ0A 3H26A 3PUDA 3KFTA 4GGHA 4C5YA 1MVYA 1F07A 5D9PA 4AEEA 3GXNA 4GC6A 1GORA 4WEVX 4AZHA 4L7ZA 1T94A 4UR7A 4NXKA 2J79A 3CZ8A 3SZ8A 3C8FA 1XYBA 4ZB2A 3ZLHA 1EYEA 4C5ZA 3B03A 2FHBA 2J6VA 4K38A 4JX6A 3W7GA 1TX0A 2ZRWA 6REQA 2O9OA 4LAOA 3W1QA 4NJIA 4XO7A 1PIGA 4PMRA 3O2LA 4CNUA 5AHMA 3DYOA 1J0ZA 3WJYA 1W6TA 4UUIA 1YTKA 2GUYA 4WGXA 2QYGA 1H09A 3HFYA 1IF2A 3LXCA 4XVDA 4I8DA 5ABTA 4O1DA 2A3EA 1ZGDA 3KP1A 1HIZA 1I2QA 1U5VA 1JYWA 4XZIA 3H6OA 5DLGA 1Y65A 1HTIA 4PUUA 3CAVA 4C6BA 1QNQA 4DZIA 3R94A 3TOYA 1GGOA 2C1IA 4TV6A 3GWQA 3MMWA 2WLZA 3LX9A 2BTMA 3ZJ6A 1S9FA 3M41A 1DXIA 4O17A 1Z42A 1TE6A 1US3A 5I0DA 4U5IA 5DY2A 4J3WA 1DHKA 2FVMA 2PDGA 3QGKC 4I5RA 5EDWA 3BAYA 2E67A 3IGSA 2PTDA 3LBMA 4LNCA 3L12A 3TW7A 2EJAA 1EO7A 3CH9A 1Y5WA 4EE9A 3HG3A 2PDPA 3F2CA 1IHIA 2PGEA 5CPNA 2XHYA 4MNJA 5REQA 3R8GA 3AUJA 4S3BA 2RJHA 3LZ5A 3T42A 4W8BA 3MI6A 1MXDA 3CT7A 2GPTA 1JQXA 1VFTA 3MI2A 3WQPA 4DUVA 5F9LA 4LGXA 3GK0A 2J75A 3IVTA 1WO2A 1V6YA 1XD0A 3ME3A 1EP1A 4R85A 3FJNA 3ZYZA 5A5WA 2YLAA 4O52A 3SGZA 1EFZA 4PB3A 3VDHA 3GG1A 4B9YA 4RZBA 2CIPA 4ORIA 1G5AA 2DPEA 1TPWA 3NPWA 4AIOA 2XWDA 4DLFA 3PZVA 1HJSA 4HQVA 2WNZA 5DG8A 1K8YA 3VDGA 2OZTA 3WMSA 3AIRA 5AY7A 1OFBA 1HKMA 2A3BA 1OGBA 4AD4A 4ATLA 4QWCA 4HA1A 2ABAA 3HTWA 1VBUA 3GAYA 2FLPA 1VJIA 2TSYA 4J28A 1RK5A 2V68A 1JCNA 1XM3A 3LSBA 8RUCA 4GZ7A 8CGTA 3S2LA 4AX7A 4DO6A 2RKXA 5KZDA 5EMUA 4C6PA 4DPQA 2ZRVA 3QV6A 2QUVA 3FJ4A 3MMDA 2ZRYA 4WR3A 5IOBA 5E0FA 1KTCA 4EBDA 2WAGA 1OBAA 3RCMA 5ECVA 2D20A 3V5CA 2C8NA 2WC4A 4S3CA 3WLHA 2P53A 4M7TA 5E93A 3UXKA 3AYSA 2P0IA 3VOHA 4O13A 1GVIA 1LRQA 2VURA 4DL4A 3LY0A 4LYRA 2E6DA 2VX6A 3L0GA 2XM2A 1GVOA 4PB5A 3LTYA 1JPKA 1PWMA 5I23A 3TTQA 3A21A 4D6CA 3TN5A 2CZ5A 3G22A 3PR5B 5CLTA 1OGGA 1WP6A 4K37A 2QW5A 5EPDA 3UXIA 3TCSA 4GWEA 1TCDA 2F6UA 4C6OA 1HF6A 4A29A 5HATA 2PODA 5A1AA 2V69A 3PN8A 3T81A 3RXZA 4AVOA 2CLIA 3Q8RB 3QTPA 3QYQA 1G1YA 5AVHA 3MS8A 2XVNA 4FLRA 4LWWA 3KLKA 3N2XA 3LRLA 4IFKB 4CD5A 3T0BA 3GBDA 1S2WA 4D8LA 3N14A 1QK2A 1TPH1 1RBAA 1AQMA 4Q7IA 4MJ2A 3W6LA 3RJYA 1G67A 4PUWA 5KT4A 1RZMA 3RGTA 4DZ5A 2CCRA 3MCMA 2DH3A 3F03K 2VWTA 3LUTA 3S0CA 1J2BA 1F4AA 2PDYA 3V6JA 3NQ7A 1KFEA 2HTMA 2XWEA 1BKSA 4F0HA 1JZ6A 1ADOA 3W26A 1JF6A 1VKFA 2DQXA 4FS1A 4UFKA 5XIAA 3R1ZA 2VDIA 1R3YA 2VL4A 4O50A 4ZQMA 1NOUA 2ZTKA 3C2FA 1GOIA 1JAKA 4QG8A 3B4YA 1X97A 3VOJA 1CLXA 4GQBA 1W1VA 3OBKA 4Q8UA 1AODA 1LOQA 2Y7DA 2ZUUA 5BXPA 2XUCA 2PGWA 1UQZA 1TWSA 1CPUA 2D2GA 1TPDA 3VAVA 3GDLA 5C70A 2OX1A 2R8IA 2QS8A 2H8XA 1NP0A 4JKMA 3L66A 3NUKA 3REQB 4YWIA 2QCDB 4OVXA 5LHFA 3V6KA 1FCQA 4DM1A 2X2GA 1AJZA 2W7PA 4Y9MA 1GW9A 1YLVA 3NXFA 2XIIA 5HWMA 3ZMRA 4PBFA 3I3DA 2JIEA 5T26A 4F0KA 3WF3A 3MKKA 4QE5A 1IEWA 3QM3A 4X60A 2GSEA 8A3HA 1S3HA 4LY4A 5GQBA 1HVXA 3Q37A 2AMGA 3ZOAA 4R33A 3RB3A 4W9TA 4LF1A 1PB0A 4FNTA 3GFYA 1PZ2A 4S3AA 2YPIA 4X0VA 1TTJA 2DSKA 1QAPA 2ZUWA 2ISDA 4B5NA 2QLYA 1NOWA 2E9BA 2PDNA 3LTSA 4ZMGA 2I9EA 4JNYA 4WY0F 1VCFA 3CQ0A 4PFMA 5KFYA 1R2SA 3MYPA 4NZFA 1E3ZA 2DPIA 1WB0A 2WQPA 1VCGA 4TUFA 3T0CA 1U83A 1Q45A 3IANA 3CWHA 2DEPA 4RZ5A 3EOLA 4OZOA 5KZEA 1TZZA 1FCUA 5BOEA 2YCLB 4Z08A 3DC0A 4LBRA 1Y7VA 5DQHA 2HS8A 1E4LA 1A5AA 1OABA 3UPMA 3FSUA 1S3TC 5HWJA 4LS2A 5A6KA 1Z44A 3RIKA 3MHGA 1I1XA 3M0IA 2XGIA 4FBTA 1H7XA 4AZ5A 2Y8UA 1ISXA 1N56A 3LV5A 1LRTA 2FZDA 3AIEA 4QX4A 3O7UA 5HWNA 5PTDA 3ID7A 5LA2A 5BMWA 2E0PA 4MB1A 2Z28A 4I6VA 3O8AA 4QJ5B 2BZNA 1PUDA 3G3DA 3BLOA 4OOUA 3GBEA 1XYFA 3MZNA 4ECWA 1GOKA 4LJ3A 1OCQA 1C91A 3FYYA 1X8FA 1JI1A 4JL2A 3VIHA 4JKKA 4MJMA 4BY3A 4JTUA 2UZ9A 2GL5A 1XLKA 3A9BA 4MLJA 1HG3A 2FGZA 3WQOA 3SURA 4M6UA 3T8LA 1S46A 4IH3A 3T5HA 2V2DA 2P5NA 1SR0A 4O0ZA 3EEGA 2WTFA 2D0HA 1KB3A 3MMUA 4GRSA 1CXKA 5HMFA 3N9KA 1KXHA 4E2VA 2Y5SA 4MYAA 7REQB 1JCYA 1J5SA 4NP7A 1EBGA 1E5NA 4GIYA 1HL2A 3QZ6A 2HK1A 4D6FA 2OWXA 3CWOX 1DTUA 3FY1A 3GXPA 1QHOA 5I2UA 3QV9A 4MJ4A 1JDCA 2HV5A 4UFLA 5ABHA 2ALZA 1TUXA 4JDBA 3L0NA 4IXXA 3W3OA 1I4NA 1THFD 3BZGA 1SFSA 5J04A 2EG7A 1PKLA 2G3IA 4PODA 3GXFA 3W25A 3RB4A 5HBFA 3M9MB 4S3JA 3H55A 4WKFA 4WHBA 5G1TA 5FF3A 3U7VA 4NZ3A 1OC5A 1ZUAX 4PH6A 4IRDA 4U3CA 3AI0A 4HOXA 3STFA 1A5BA 2YL5A 2NVAA 3KVMA 4AEFA 2QKFA 1E1EA 1YQ2A 1V3IA 4LC8A 2VD8A 4C6KA 4Z2JA 2VA2A 3N6JA 4G5DA 3BAWA 5A8QA 2IA6A 3EB2A 3W2MA 4JNMA 2X7WA 4KKXA 2EPLX 1WDSA 3C8NA 4FK9A 1ICPA 2RDTA 5DG7A 3VKAA 1XXXA 1W3HA 5CGQA 3CYVA 1XH2A 3STCA 4GQRA 3PK7A 3PR4A 3CZKA 4OBSA 4ZSUA 1G6CA 5I3DA 3KBVA 1LDCA 3RYSA 1CB2A 1VYPX 1JEZA 3UZYA 2PWUA 4K68A 5JVLA 1Q2SA 4HBKA 3RB6A 2WB5A 1ZBVA 4EPBC 2OSXA 1N8IA 3R89A 3TFCA 4Q4KA 3N2MA 1H7NA 4K3ZA 3K1GA 3DG3A 3TJXA 1EEPA 4XZWA 1QBBA 3LLDA 1B57A 4ECRA 2VDGA 3DKLA 2Z24A 1FRBA 1YTEA 3VMOA 2PTZA 1S5WA 2XH4A 4KRUA 3WIJA 1TJ0A 3IGUA 4JV1A 1FWWA 4ZQNA 1XG4A 1XFBA 4HPHA 4GZJA 1TJ2A 4YTUA 1QI5A 1PWLA 4HTYA 3VOIA 4GE8A 3RCYA 5C6MA 3C4UA 4Z1CA 1EP2A 4WXYA 4V1YA 5D2XA 3A3HA 1P0NA 4GQQA 3GKFA 3OGSA 4MFDA 1YXDA 3VKCA 1EXBA 3TH6A 4ED8A 4BQ3A 2Z7GA 2NQ5A 3URNA 3AXXA 5AYBA 2G5WA 3G1VA 4S3GA 5RUBA 4J3SA 1D8CA 3EWWA 2G0WA 3TC6A 3BARA 3AXKA 1MI3A 3BG5A 1A3WA 3QFEA 3W70A 3HPXA 5KFKA 1QRQA 2NX1A 3AAMA 1UR1A 2PDKA 1SMDA 3PWGA 2J7BA 5KFCA 3AMKA 1E1CA 2YL6A 1SZGA 1IQ8A 4LEQA 3SFKA 3QZ8A 1F61A 1C8QA 2PDIA 1JZ8A 1TPVA 5AHNA 3IJ7A 4Z1BA 1FFQA 1XGDA 1CDGA 2OFJA 3KDOA 2BWGA 5CSRA 3VGEA 2XISA 4E3TA 3I10A 3NQ8A 4Y9AA 1PO9A 5IXEA 3LZ3A 2GVJA 1FWHC 5HQEA 3OA5A 3SR7A 4LALA 2JEPA 1GOQA 2YL9A 4JYFA 3V6HA 3M9YA 4DEFA 3OYXA 3GUGA 2Y61A 4MZ8A 4PTMA 1KFJA 4F4XA 4PA8A 3GQYA 2IQ0A 4YMZA 1RCXB 3S5ZA 4UTUA 3QMRA 1OFDA 4JAWA 2R8GA 5A2BA 1EJVC 4R7WA 3SRDA 3VILA 4ERGA 4GFIA 3SSJA 2ZADA 3APTA 1GVFA 1KRBC 1GOWA 3LPOA 3UGVA 1H2JA 1G7VA 2W91A 1QOXA 1GTEA 5HNNA 3I4EA 5SWUA 4MZYA 3P80A 1PTAA 2YDQA 4TV5A 1E71M 5CSYA 1R7AA 3N17A 4M29A 1DV7A 3S9ZA 3W9ZA 1XYAA 3GZ3A 1E15A 4Q4RA 5C5JA 2W62A 3HFTA 5D2TA 4DL7A 3ARUA 2RDXA 4H41A 1ZJHA 1EKOA 2VUYA 4KIEA 3GNNA 3NQBA 3T08A 3C0JA 2YXGA 1NWSA 4C7GA 1JJKA 4LT9A 3T78A 4UOQA 3MDWA 2HROA 2CKSA 1FXQA 2QT3A 2J66A 2D24A 2NUWA 2C91A 4AX6A 3KTXA 1S39A 3NYDA 3TW6A 5LNVA 1AA1B 4AWSA 4WQ6A 5M03A 5F9NA 4ZODA 3LBCA 1LTDA 5EMLA 1DOSA 5KFIA 2W9BA 3NPXA 2R8WA 1XKYA 2QGHA 4NL1A 1SZFA 4UTLA 3V1HA 2FZMA 1JZ4A 5AFDA 4P8XA 3RX3A 3W7KA 2EPHA 4PUEA 3L4UA 2LLEA 4GY7A 3TYAA 3L4ZA 1ZJBA 1ZZMA 3V3WA 1UW9A 4KGLA 4Q4SA 4F8XA 4UR9A 4PMOA 1ME8A 1GJPA 2NXHA 3K8MA 3CBWA 4E8CA 4LCRA 1H62A 2CU0A 2ASHA 3GIKA 4MWAE 4Q43A 3UNDA 4GO8A 2E09A 1KFLA 1V79A 4XZNX 3M0MA 3UZWA 4CGTA 3K1DA 2D3LA 1PHWA 2XZ7A 1PZ0A 4OU1A 5E70A 3BVJA 4NZCA 1GOXA 3H40A 1NIUA 4R9XA 2QJMA 3CZGA 1CXHA 4PCSA 4ZTYA 3LCXA 5GNZA 3B9AA 3VDCA 4OUIA 4PSPA 4N9EA 1M03A 1ONEA 1EDTA 4NZ5A 2I1OA 5DQPA 3GW0A 1MUWA 4J9PA 2IXUA 2FZ8A 2OEJA 1MXSA 2IUZA 4N4PA 4FNQA 1BVZA 4JN6A 2Z1KA 1FH9A 2BXVA 4RKAA 4RU9A 3W1RA 3CL6A 1GHRA 2JBMA 3CV1A 1W37A 3GQCA 1BSIA 2PDBA 1EP3A 1W9UA 1FQ0A 3O16A 4I5UA 1AQ0A 1LCOA 1DIEA 1P7TB 3H7RA 1HKIA 4BQ2A 3BSHA 3AZSA 2JK2A 3WQFA 3NWRA 4CN1A 1O4UA 2JIWA 3RUBL 2R24A 4ADSA 3U6WA 3C2VA 4UTMA 3WLJA 2NUXA 2W66A 4REQB 3RMJA 4RNJA 3QF0A 1JGMA 4F40A 1RPXA 3UJEA 3R79A 1Z41A 1KC7A 3GH5A 6A3HA 3MR5A 1XSKA 4QISA 4QW9A 4QW8A 4N02A 2PS2A 4RDYA 1QR7A 2J7HA 4B3LA 3P2VA 4XO6A 4LAUA 3QV8A 4GIRA 5EMYA 1M41A 1P1XA 3A4AA 2QNEA 1S97A 3N1AA 1E70M 1SFTA 1OX5A 2PRHA 4CCZA 5DY3A 2DZPA 1H11A 3MUZ1 3NO5A 1G0CA 2BASA 3ZVHA 5HJLA 3GZAA 2ZUSA 3EB4A 1XIHA 1TPEA 3FJLA 1KRAC 3STPA 4UTHA 1GYNA 4I9JA 4IMDA 3TX9A 2B7OA 1XBXA 1Z9AA 4JBRA 1JDEA 3GV7B 2J8GA 3NDZA 1GVQA 3MKVA 4C1LA 4IX2A 1JF5A 5EB8A 5H91A 3U3HA 1N48A 3O05A 4JIQA 1FP9A 1VS1A 2DUXA 3KRBA 1FWDC 4EP8C 1JRCA 2DGAA 1K1SA 3LN3A 2UVUA 3M5ZA 1BGGA 1SO4A 2G50A 1MEHA 3H2AA 3L2IA 4RNHA 1A0DA 1WXYA 4EAMA 4U3AA 2E5DA 4IIDA 1E6PA 1UMYA 3KRUA 4AIEA 3KL0A 3I6TA 5TD4A 8XIAA 1ICSA 1YW1A 3BOFA 3FV9A 2J9ZA 1S2AA 4CN4A 1XINA 2VT0A 2BY1A 5HNTA 3P14A 1PDYA 3H24A 1AW2A 1UWAA 3PULA 1XJBA 5FI8A 2MNRA 2VVSA 1V02E 3UXLA 3CZJA 3WDJA 4RNFA 3ZSTA 5IM51 4UNIA 1C8XA 3KHDA 5DBUA 2XCAA 3BQ0A 1A5OC 2XVLA 1D2KA 4L4LA 2P8BA 4NRSA 4KCUA 3WQ6A 4WDXA 4ZSTA 3GLCA 4K6AA 2JF6A 4HNCA 1MW1A 3E74A 3HGOA 3UZZA 4EANA 1PTGA 3W2UA 3TN6A 2G96A 3RPTA 3B04A 1EWEA 4AZGA 3LPGA 1MQQA 3P5ZA 4EXAA 4PMYA 1L6YA 4FLQA 2XCPA 4AMCA 3VZXA 3UP8A 2WWCA 4Y90A 2W9CB 3DZ1A 1E43A 4RLIA 5KSWA 3BQ1A 1DE5A 1O66A 1D3CA 2IKIA 3QYSA 3AMDA 3PZPA 1TJPA 3KXQA 4HYWA 2XIOA 3POHA 1FDYA 3GR7A 3H70A 4ACZA 1IWPA 4H2HA 3R8RA 4W8AA 2GWNA 2PMQA 4ZQPA 1KM0A 3WH7A 3H21A 5I00A 3L65A 2UVRA 1VR6A 3WD1A 3BGAA 1NTHA 2J7GA 1OG6A 2PB1A 3FN9A 4BWLC 3T44A 2VCAA 3L5MA 4AWTA 1U1HA 3W2NA 5KZ6A 2W67A 3EX1A 5CJNA 2CFFA 2V9WA 3RB0A 1ZFJA 3CS2A 4UTWC 4I9AA 2PBGA 3F4DA 4K8GA 4LCQA 3R6IA 4JTRA 4NJGA 4B5XA 4X22A 1SW7A 1HJVA 2NWRA 4XUYA 3P8JA 3ARZA 2AQ4A 1NF7A 4WD0A 4X2RA 1R2TA 1FHLA 4XWUA 1XYCA 4OHQA 3DFYA 3M6DA 2Z1WA 3PZQA 3R58A 1BF6A 2P10A 1V4YA 2BGSA 3RHGA 5KG1A 5M3WA 1C9DA 4MWAD 4PEKA 2XSAA 1QDSA 4NYYA 3SCRA 5LXEA 3MCNA 3CUIA 4HNUA 3B9OA 3O6YX 2C13A 2HQAA 2ZDSA 4CNNA 4HZ7A 4A22A 4BQ4A 1R9XA 1EPXA 4CLMA 1W5QA 4O3RA 1F4HA 4GPNA 3PNUA 3CIWA 1VGAA 4Q45A 4B5WA 3DUGA 3CPGA 1KXVA 3KAOA 3BE7A 1HL8A 4N0RA 6ALDA 5T14A 2X7VA 3TSMA 4RDZA 1PYMA 1KFWA 2XJ7A 3R11A 1VYSX 2E1DA 1DJXA 4FXRA 5KFHA 3A6OA 3WLSA 3AMGA 2WZMA 3MYOA 5EFFA 1K3UA 3TYEA 1S1RA 4NZ1A 5DX7A 1VLIA 3FA5A 1S0MA 1LOSA 3LCLA 3G0SA 3VFLA 3UETA 4LPCA 2Y4SA 1PKNA 1E4IA 2YL8A 3HQOA 1KR1A 1Z89A 1KWKA 3EZ4A 3F2DA 5L1IA 3KVJA 1ICQA 5DO8A 3FLUA 2OCZA 1RA0A 3DYMA 1YXCA 1XLIA 2XFRA 4JV0A 1YEYA 1JPMA 4M0XA 3O9NA 5IBXA 3T0TA 5M17A 2Z2UA 4KWVA 5HMDA 2HJPA 1RH9A 3VTRA 2VQUA 3W53A 3HPAA 1XSIA 4KQNA 1ZAHA 2ZWYA 3ZJ7A 1UIOA 5E1QA 2VDHA 4JUZA 4GK8A 1YTDA 2J13A 1DJYA 4MKNA 1UD2A 3FHQA 4EXBA 2TODA 3OODA 5DQIA 5ABFA 1VYRA 2C28A 4IFKA 3IJ9A 2BHYA 4D72A 4QAIA 4PTXA 4JICA 4UTTA 1OYAA 1UD4A 2E6AA 4OWGA 4XKMA 4YR0A 2QJJA 1KKRA 1CI1A 2W61A 4W89A 1QPQA 1DWJM 2YCKX 3EOUA 2PCEA 1ME7A 3DKJA 2GYIA 4GUIA 5HUOA 1U33A 1MWOA 5KFJA 5HNUA 1S2TA 5BNKA 4Q8EA 1QPKA 2J78A 3R0DA 2BLEA 3IPWA 2RDUA 5MKGB 4U33A 3W07A 4Z17A 4EPDC 2G3NA 1Q6RA 4Z2HA 1K9TA 5LHEA 3LHYA 3GHTA 3OSNA 3GV5B 1R8LA 4I6KA 4MWAA 3W1UA 1US0A 1N82A 5U4NA 5FJRA 2GJXA 1M04A 1KGWA 4AIUA 1J6PA 2DV0A 5HR6A 1QWGA 1DBTA 2NQ9A 3TYCA 3VNDA 3Q2DA 2FMOA 4XKYB 3QLDA 2Z26A 1QOPA 4NUWA 3Q4DA 4LVGA 3TYZA 2BB0A 4GBUA 3VDAA 2XIJA 4KCVA 3W82A 5F2LA 1QWKA 3BLEA 4DO5A 3SRFA 5JUMA 3AYTA 3RX4A 2DW7A 3W6MA 4MPQA 1W3JA 4XV0A 4DX3A 2X0HA 2W0UA 2E68A 4XTDA 1LWJA 3GIJA 1L2QA 4XIMA 4CUCA 3BW3A 4UNKA 3VNYA 2ZXDA 4Q33A 4LAMA 3VC5A 2HE8A 1J8VA 3GFXA 1S1PA 4Z42C 4OECA 1BYAA 3SQMA 1XIDA 2JALA 2ZICA 1B4EA 4HN4A 2PDJA 2WNNA 3M7WA 1M5WA 4GYPC 1YBQB 4HA4A 3BMXA 2C18A 2HEJA 4Z2LA 1A4MA 1ZL1A 3BAXA 3NZ1A 1N8WA 1ZPTA 3M44A 2OKOA 4DL2A 3L7RA 4R5EA 3ARSA 3WKZA 4FNSA 3EX4A 3TONA 5A6MA 4QDPA 1ITQA 2FVKA 3F5LA 2XH7A 5I3KA 1MNSA 2TAAA 2D3NA 1T8XA 4D71A 2Q01A 4E4UA 2JEQA 4HPGA 4D8ZA 2PUZA 4ZEPA 1ZY9A 2V5DA 1VLWA 2C16A 3A5FA 3LENA 1DHPA 2ZZ3A 2DUAA 3GAKA 3RCNA 4G2DA 2PFHA 3QHNA 4A3RA 1E0UA 5MF5A 3MUXA 3N18A 4M1RA 3QFWA 4YR3A 3N34A 2NVCA 3B0YA 2XN0A 3QV7A 4DXKA 5JQ9A 5I24A 2UVWA 2BQ3A 3SCWA 1S5NA 3AIVA 2V3EA 2YCEA 2BFGA 2GZXA 3P61A 4A3UA 1NARA 2PSNA 1XLCA 2PLMA 2C71A 1FX6A 2J7CA 4XSMA 1BGAA 4G6CA 3GKAA 1PE1A 1V8EA 3W02A 1IEIA 3INPA 4E2BA 3CWNA 3E5PA 1LBLA 1EF2A 4YTTA 3U2EA 4QROA 1DJNA 2GK1B 3QJAA 3GR4A 3T4WA 2PRMA 5DEZA 1HJQA 1U1JA 5I3GA 4Q8TA 4HD5A 4NF7A 5B7YA 2AKMA 4TQTA 3TIMA 5T8GA 3MR3A 1EPVA 4C1NA 1NOFA 2ADAA 3ARRA 1F8IA 1AUSL 3UXAA 1TPB1 3VD3A 3BV4A 3CIXA 1JAEA 3BCDA 3M0YA 5KFFA 3ABQA 2J7FA 1DP0A 2G37A 2GVLA 6REQB 4HMNA 2X41A 1NDYA 3WG6A 4ZZ9A 3IACA 3SB0A 2VI0A 3D3FA 5FKYA 3HPSA 2NSXA 3MWCA 3MW7A 3NOEA 1R3WA 4AF0A 4PRTA 1J0JA 1HO4A 1LUCB 2A5HA 3BJSA 1IV8A 2OEMA 2WNWA 1XYMA 3B8VA 3N04A 2QUMA 4YLWA 2XVGA 4GJIA 1ZS2A 3VNKA 1CGWA 1D9EA 4RL3A 2XGBA 3R0UA 3UR8A 1XC4A 3BMVA 2XYLA 4XAFA 2XINA 4MKSA 3UEQA 1KTBA 4JTJA 2WPGA 3T5JA 2XGQA 1PS9A 3PAOA 3VKKA 1C9WA 3CTLA 2PDMA 2ZIDA 2CC0A 4ECUA 2XH0A 4PMZA 1XLFA 4MDPA 1H41A 3TU9A 2PU1A 3WDIA 1PPIA 1VQTA 4GUFA 1IXOA 4DYKA 4TQSA 3SY5A 3BDKA 3O06A 4JQ1A 5K9DA 4RE3A 1KO0A 2ZZ2A 4OBTA 1R38A 4TIMA 3IUDA 4IGMA 4QWDA 3SI9A 3W1LA 1S2VA 3NTYA 2YBUA 1IE7C 3S2CA 3CV2A 3CL8A 1K7EA 4WRHA 3G6YA 3S3GA 2IQDA 4EF9A 3CV7A 4G56A 4EIVA 2BR0A 3EXRA 3PFRA 3VNMA 3C2YA 1U22A 4PTNA 4EX4A 4H04A 2E8YA 2X1UA 4E3VA 1YRRA 4CVUA 2Y6ZA 4FS9A 2VC9A 1G9HA 3OPSA 4L6OA 3ARQA 3GVQA 4Y2WA 4LUJA 2G95A 3W81A 3WL1A 4Y7EA 1TV2A 2DVUA 3HN3A 3U48A 3QW3A 4WVXA 4BCEA 4JIPA 5EWFA 4UR8A 5K3VA 1AZ2A 5AHFA 2WSYA 3MSDA 1EGMA 4HVXA 3VFCA 1QO5A 4XX6A 2QGYA 2IPJA 4CD7A 4F4RA 1K1QA 3E0LA 3NGDA 3NQ6A 2V3FA 1VJSA 3CQHA 1M9HA 4ERIA 4KS0A 3GVGA 2L5HA 4ZTXA 3HMJG 3O6DA 4JN8A 2I14A 4WSHA 1WV2A 1ZRQA 4YVPA 3W85A 1J0IA 5FCZA 5LNRA 4PSRA 1FA2A 2DVXA 4QHRA 2NSOA 3DFPA 4AXKA 3WDQA 4XKYA 3NFUA 1S0NA 1SR9A 2FFIA 3GS6A 3E2VA 3ZT6A 4IGNA 5BZAA 2AOSA 4L4OA 1HW6A 4W8LA 2WMJA 2YW3A 4JTDA 1O5QA 1Q6QA 1HUVA 1RR2A 3HJZA 2WKJA 3VD4A 1R6WA 1GWJA 1TREA 3A9IA 4B92A 1TO3A 2EHHA 3OQEA 3WZ0E 1TZ9A 1V77A 4FOUA 4QRNA 3KBJA 2P1FA 4C6JA 2FH6A 3GX9A 5DCDA 1KCKA 4ED0A 4ERAA 2DSVA 3LI0A 4AC7C 4RZ6A 4X0NA 2QMKA 2XH2A 1HXJA 3WBXA 4KRZA 1E0VA 1AD1A 4JEJA 3FFSA 1V6XA 1B5TA 1NEYA 4MY9A 4LB3A 4MAZA 2BODX 5EYWA 4WOQA 4AB4A 1HN1A 1DWIM 4HCHA 4XISA 1FWCC 3FVDA 3KHRA 4QXIA 2C0AA 2ZX7A 1XLLA 1EL3A 3G6MA 1DPMA 4CCEA 2OXNA 4PEEA 1VEMA 2GVEA 1ODZA 4DWSA 1UC5A 3DU0A 3KL5A 4IQEA 3F7JA 3S46A 2VCCA 1MO0A 4S3FA 1VIWA 2BHUA 4O57A 1EH9A 1WE5A 4WJXA 3UG8A 2ACQA 1TCMA 2C22A 1JDAA 2OLAA 2IPWA 1FHVA 5KZMA 5FJJA 1E0XA 5BYWA 1E6NA 3FJ6A 3WNPA 4WDTA 1B3XA 3W28A 3W7OA 3QH2A 6PTDA 4IZGA 3W76A 4IMEA 1XCWA 1QPRA 1I6NA 2PGFA 3EDDA 1XBVA 2E77A 1NELA 4RE0A 4K1GA 4ZQCA 5HAOA 2X0SA 4AYSA 3DERA 3N3TA 3SW6A 3NOYA 2CHRA 4M80A 1SU5A 2D0FA 3IJ6A 3PPCA 5M2FX 1VBRA 3G1YA 2FB3A 4Z0SA 2QDHA 3Q94A 4N6FA 1JXJA 1CX9A 3W1TA 5GVJA 3RDKA 3SI8A 3BV7A 1RPKA 2YCIX 2VGFA 5KFTA 4OUEA 2PDQA 4PBEA 5DMLA 3B0XA 3ES8A 5DT7A 1ITUA 4BF7A 9CGTA 3PBWA 3UD6A 4F2UA 1HGYA 3EPIA 2EG6A 1XICA 5DGBA 3WFAA 4AD5A 1X7IA 4GCAA 4GISA 1W3TA 2EBNA 5D9OA 4KERA 2R82A 2ZUTA 5A6JA 5FEPA 4BHYA 1F6KA 2I57A 3BPWA 1MRAA 1QTWA 1BWKA 1OCJA 3CJPA 1HKKA 4QGCA 3AYVA 1WA3A 3V5OA 6XIAA 3P8IA 1VHNA 5KEZA 3HBLA 3V4BA 4F48A 3NO3A 3JUGA 1WCGA 2PLKA 3MP4A 3M0VA 4CU7A 2ZBTA 4ZOAA 1QU4A 3LMZA 4H9MA 1K7XA 1PVNA 1Q7ZA 2EPOA 3RJXA 3DFQA 2D69A 3O15A 1JZ2A 1HNYA 1W5MA 1VAHA 4J2MA 5FF0A 3R8HA 3EWYA 3CLWA 3SFWA 1ONRA 1BYCA 2GJRA 2ZUNA 3UNTA 4CN6A 2Z29A 3LYEA 3KBSA 1FXPA 1XW8A 4OGZA 3DIPA 1SW0A 3T0AA 2VGGA 1K8XA 3P81A 2VQTA 1UA7A 5TAOA 4RUCA 4D1JA 5IRPA 4H8NA 2OZ3A 3HPFA 3H54A 4M56A 2DW6A 4DJEC 3NZQA 1QI3A 3B06A 4HNVA 4O3SA 3JRKA 1T99A 4UTJA 4GY0A 4UMAA 2B81A 2QAPA 5FSEC 4H6RA 4EPEC 3UPBA 3KBNA 2OO0A 2VEFA 1O1ZA 1P0BA 4JD4A 1Q6EA 1FWSA 3IUHA 3MPGA 1P0KA 1WDWA 4IJBA 5LA0A 4AY1A 1G7UA 2A3LA 4DYJA 2V4RA 3ABSA 4IIFA 4A35A 4DBSA 1SGJA 1J0HA 1KM5A 1TMQA 1J93A 1XLHA 3H2EA 2IKGA 4NZ4A 4DUXA 2DZSA 3R5EA 2RFGA 3BQ5A 5B80A 2EKCA 3QQ0A 4FF5A 3MUIA 3Q45A 1ODUA 3KOXA 2QEZA 2XSBA 1GQLA 1DXEA 1UROA 2TRSA 3R7MA 3VIKA 2OWWA 4PZVA 2FTPA 1UJQA 3PZMA 2YA0A 2ON3A 4BFAA 2OQHA 4B4FA 4JTQA 3KS6A 4QS5A 3TYUA 5D9MA 3W22A 1L2UA 4F4WA 2XFYA 3SCOA 4PYSA 4Y8FA 2GJXB 3CASA 1NY1A 2V2CA 4P7NA 4FB7A 1IGWA 1Z48A 5AC8A 2B7QA 4X9SA 2WHMA 4XAPA 5L6UA 2J7DA 2J8TA 3K2GA 4MLRA 1IZJA 4DYEA 1YNQA 3GHSA 1FWEC 3CHFA 2VC7A 2DT2A 4L6DA 3AIQA 1P1MA 1O7AA 1DJWA 1PIIA 5XIMA 3GXIA 1B9BA 3UESA 3V35A 3N4FA 1RJPA 5CLWA 3KDNA 3C61A 3DHDA 3CHDA 5D4YA 1EOMA 4QSHA 4Z2KA 3W84A 3XINA 1TYGA 2JKEA 5FL1A 3U57A 4H9ZA 3S42A 4EKJA 1QO2A 5DLCA 3VNLA 5LNUA 1R46A 5I5RA 3BURA 1GYLA 4LV4A 3L4VA 2WMIA 2YZ5A 4S1FA 3PBGA 3UR7A 5G4WA 3NVTA 1AW1A 4B90A 4JTTA 4LB4A 4ED2A 3EYPA 3PUGA 3IVSA 4EEYA 1V0LA 4A05A 5A95A 1D8WA 1NF0A 4XSLA 2ZA2A 2UBPC 3GFZA 4JIHA 4D1IA 3EA3A 2FTWA 1EEXA 1Y0EA 2W8KA 2I9UA 3KE0A 1J9YA 4REQA 4BF9A 3GNRA 4CEUC 1FH7A 4FNPA 4QDMA 1TWDA 3SCVA 2VRKA 4YXGA 4Q4OA 4EYIB 4LRSA 1SM9A 1O95A 2ONEA 5KT6A 4QITA 3ZVHB 2PZ0A 3F4NA 2GVGA 2CKRA 2Z1VA 4JTEA 3BJYA 1I45A 4AMAA 4C6FA 1G01A 5BU9A 2QIWA 5EFDA 1TMLA 1D3HA 2BOGX 4J40A 1VBHA 2W6RA 1V3MA 1PKMA 1CBGA 3ITOA 2VFDA 3VD9A 1EJXC 3NYZA 4XK2A 4LW7A 1PTDA 1US2A 5F2IA 4RK8A 3KOWA 3U2CA 4M6PA 2VEKA 3QW4B 4NJKA 4ZB0A 1EUAA 4O3OA 1EB3A 1BF2A 1R0MA 1NFGA 5F4SA 2VTFA 5CCZA 1QPNA 3XIMA 1OFRA 2A3AA 1XLMA 3APGA 4B5TA 1T8QA 1X38A 3W72A 4HU3A 1U1UA 5AYYA 4HNNA 4IT1A 1UB3A 5A6BA 4FLOA 4UIOA 3NR0A 1TUFA 2R9RA 3DX5A 3CMGA 1ZSXA 3UQNA 4F0RA 4IUGA 5CSUA 3RMEA 2QDGA 2J6SA 4HNOA 4QJ1A 1MNZA 3GVWA 3GTFA 3RM4A 1A0CA 3DOPA 1MFVA 5AHIA 4B16A 3URAA 3L9CA 1FKXA 3QTGA 1JUEA 1QFEA 3WLPA 1OYBA 1KFCA 1GG1A 4CNTA 2F2HA 4YU1A 3OJGA 4H6EA 3SUSA 4LBUA 1KQZA 3CQKA 3WSUA 1W9PA 4DLMA 4DY1A 1JYXA 4KFPA 1ENUA 3WLOA 1BTCA 3LQLA 3ARXA 3G1DA 5CJ5A 4GC7A 3RM8A 1W9BM 3WFLA 4EWJA 3ZLFA 4AG0A 1XCXA 3MR6A 5DRCA 2R8JA 3W1XA 1ZETA 4TR9A 5KG0A 1XYLA 3PP7A 2GQ3A 4PFHA 4PCPA 3PF3A 3S9YA 4FNRA 1H5VA 3H4XA 1CGVA 4ATWA 1LBFA 4V27A 2WHJA 2PGRA 4G7EB 2RHGA 1SZNA 1WNOA 1EC7A 2CLHA 3QHOA 1E0WA 3HOJA 5BRQA 3JZEA 1XRSA 3CLMA 1K9FA 3UWWA 1IT7A 3VABA 3QOKA 3RK8A 2H3DA 1TE1A 1NFBA 3WQWA 2ZKMX 2W5FA 4XZ9A 4B3ZA 4I7UA 3HQ1A 1UD3A 4UFMA 5EGRA 1MYRA 4DAFA 2DSUA 3DBNA 3KS5A 2Y2WA 3PSVA 2QCFA 1LG2A 4J1OA 1WXJA 1FWIC 3HG4A 3BANA 8XIMA 3GB6A 5AZ0A 1DXFA 1FH8A 1W3IA 2HNHA 4MNLA 1GVSA 1AMKA 3LRMA 4PGLA 3MA8A 1UH2A 3HGSA 2WBGA 5K4XA 3M0LA 1GKQA 1GEHA 5LGZA 3J7HA 4UCFA 4IR9A 5D8ZA 3A5VA 5CC7A 4ZE4A 3T4CA 3E2RA 1A5NC 1S0OA 4KWWA 3S2NA 4R34A 3A3XA 3W87A 5KG4A 4TU1A 3DGRA 4M8UA 3UA3A 4DI8A 1A0EA 1BQGA 4YVXA 2ALDA 3UT0A 4GJJA 4Q8OA 3UWZA 4ECYA 5CPSA 4IHCA 2VWSA 5JXQA 1QJWA 1XCFA 2ZX6A 4P8UA 1L6FA 3C3NA 1RK6A 4DL5A 5IHSA 3UFYA 3KTSA 2HVMA 3LCWA 3V16A 1GJWA 3V7PA 1OT2A 1W1YA 2W27A 1T5AA 3AWNA 4TO8A 4H8HA 2WMIB 1TRDA 4RE4A 5KFMA 1E40A 1MW3A 1W5NA 5CZTA 3NSMA 2AGOA 1UR0A 1HKWA 3W88A 1EO5A 4HMEA 2GOKA 5C55A 1CEOA 1M3UA 1UBSA 1Z6KA 1AK5A 3D3AA 1CYGA 3H2OA 1JI2A 1JPDX 1Q6LA 4H6QA 5JMUA 1KCLA 3TLLA 3MWAA 1Q6GA 5D9NA 2AGKA 3QEZA 1Z32X 5HMEA 2FKPA 1AFSA 4XBJA 6TAAA 1H1YA 3QPZA 5LNWA 4TVUA 4IRKA 3W37A 1FBAA 4BZYA 5LXXA 3ARPA 3AC0A 3PUEA 4G9PA 2Y8KA 1U2YA 5FEWA 3EKLA 2QCNA 2WSRA 3GC2A 1XWYA 3TW9A 1B3YA 4QP0A 4U2YA 4ZQRA 4ZO8A 5JBDA 5TQLA 1JD7A 1QUMA 2YDSA 2ZUVA 1OYCA 4CD6A 3W01A 3DFOA 5KFSA 1A3HA 4NXSA 3FW6A 4ACYA 2JQXA 2X0YA 3QVQA 3UZXA 3VIGA 3RPMA 3PHAA 4L65A 1KTNA 2WMHA 4XD3A 4K36A 3UR5A 2NV2A 3H2NA 3TMLA 4H8UA 4P8WA 2POZA 2C2DA 1GTHA 2WSKA 3I7RA 2QCHA 3SQLA 3FCPA 1QBAA 2DIKA 1Q65A 2BY3A 4DO4A 4LUYA 4JTSA 4WK9A 1TRIA 2E8ZA 4ED1A 3WN6A 5G1YA 2DZWA 3WD2A 1JUKA 2PBOA 4CQ9A 4MF4A 1X7FA 3IK2A 4O16A 1N7KA 5AC6A 3QKZA 4Q44A 3SY1A 3O1NA 3BLDA 4O1FA 1I9CB 4HHLA 4HJWA 1YHTA 2A7NA 4JX5A 4CNPA 1I75A 2ISSA 2C1HA 3KHHA 4U5KA 1JNEA 1UWRA 3LCHA 3EAUA 2OGYA 3VK5A 1RY0A 1U5HA 5K9XA 2DZXA 3W7DA 2C2EA 4RXGA 5DCBA 3HQPA 5AC7A 4O19A 3P82A 2WCGA 4M3PA 4DF2A 4CQDA 3CZEA 4IF2A 4JFUA 3VUSA 1K9EA 4J9QA 3BOLA 3LM7A 3WQGA 2DIEA 4BI7A 1UWTA 4AWEA 4RDVA 4JTKA 3OZPA 3WCZA 5KITA 4LYPA 4K8HA 2BV9A 2OG9A 3LB0A 3S5SA 4E8DA 3GH7A 3WMCA 3LBOA 4Q8NA 3WH5A 1F3EA 4FX6M 1J79A 1JD9A 1W54A 3SCSA 1E1FA 1OFOA 1PBGA 5E9XA 5CXPA 4AVFA 4D6JA 2E28A 1F76A 3RG6A 1ZHAA 2VXNA 3AHXA 6CGTA 3LSCA 1ITCA 3S5OA 3OP2A 2I17A 1UASA 1BRLB 2ACSA 1S5VA 3CYJA 3MTWA 2CBVA 3S1WA 2YSWA 1IEQA 4DVOA 4UFJA 2CWNA 3TQVA 4JTLA 3JU2A 3WBWA 2YB1A 3M0XA 5G2IA 3U5UA 4X2PA 1NP2A 4C60A 3EWXA 1ZTVA 1XDMA 4ZA0A 1A3XA 4URIA 3MMTA 3UY7A 1FHDA 2VZOA 1JGIA 1LL7A 4JYDA 2UWFA 5DGAA 2H6RA 1RCQA 2CITA 4UNLA 4ECSA 3G2GA 1UP3A 3FAXA 2X1SA 1O1HA 2P50A 1GUVA 2GUUA 3TWBA 4WX2A 1A49A 3Q8PB 4ADUA 1CXLA 5EWGA 4KW2A 3TKFA 2JKPA 5KFDA 2WZIA 2FVLA 1BG9A 4MKVA 3WLRA 2X1IA 3DH7A 1UH4A 1X6UA 1VPYA 4GX8A 4I3GA 4AY8A 2VUNA 4MPKA 2VELA 3RF9A 1B9ZA 1GT8A 1W3NA 2YBTA 3THUA 1L6GA 4MWAB 4ONVA 2XVPA 4FPSA 5CAKA 2RDJA 3CAKA 4FZIA 2NZLA 1JUBA 1A5KC 5DCEA 4LFYA 3UWUA 3OQ8A 3AQUA 3K8KA 5L9XA 3TLQA 2G4JA 4QG9A 4HU8A 2J6TA 5D2WA 3ITLA 4RX0A 3NEVA 3KP0A 1H60A 1X98A 2XC9A 2FZBA 3W27A 4TX9A 1TVPA 1K02A 3EOOA 1T41A 4FP1A 1CT5A 4L4MA 4Y9OA 5KT2A 3TCEA 2GGIA 4C6CA 1DEDA 3AXHA 1P4CA 2PC8A 1V7YA 3GXDA 3P60A 4RNMA 3WQEA 3HB9A 1LUCA 4V33A 4XIAA 3WQDA 4QEHA 3B9NA 4GC4A 3S1VA 3GRIA 3B97A 2DFAA 3PG9A 4EBCA 4S2CA 3RM9A 4XAZA 3W2LA 3NO1A 3WK3A 4HGXA 5C2XA 4FAMA 1C90A 4HHPA 2A6NA 3LPFA 1ZLPA 3LNMA 4E2DA 4E4PA 2YLLA 4DNMA 1OHLA 2XFWA 1TR1A 4H83A 1SPQA 4YIWA 1UWIA 4LY8A 3BWWA 1V0NA 2VFIA 5CZSA 3PJTA 5CAHA 1C8YA 1UH3A 2FLNA 2YJQA 2FH8A 4IP7A 3MHFA 2FPTA 3QSTA 2WM0A 4FHAA 3AHZA 2EGZA 3T9PA 3IVUA 2ISWA 1XV8A 1K9DA 3H53A 1FWFC 1JDDA 3W7RA 4W7UA 1FWGC 3BQ2A 2A0NA 1PCWA 1XP3A 1JYNA 1M01A 4D6DA 5K4ZA 5DQGA 3BZJA 3ERPA 3WEOA 2P88A 3U4AA 4M6QA 3OBAA 3I6RA 1TG7A 2WVUA 1P43A 3NL6A 1CXEA 2ZZ1A 4C7FA 1MW0A 3F4WA 3B0UX 4FBUA 2Z1XA 1RP8A 3QPEA 1XIGA 2PRLA 2BDQA 3C0QA 3PW7A 1FWAC 1BXNA 5AC5A 3UCQA 3PW2A 3QHMA 1P5BA 1XH1A 5ABEA 1XQKA 4H9TA 5IBXC 3U0HA 4YCOA 3IIXA 2NW0A 1W31A 4HN8A 2WSPA 2VZVA 4AD2A 2DT0A 3N9SA 4H00A 2VEGA 2Z2AA 1R87A 1VHCA 4GI4A 3KLLA 3MP3A 3GTIA 2OOFA 1J2WA 3GM8A 3BW2A 4FNUA 5CEWA 3NZGA 4H19A 4F3HA 3RLGA 3CHEA 1ZU8A 4IMFA 5BWAA 3M46A 1LRNA 2HXTA 1XISA 4IJRA 4CQ8A 1QK0A 3NL2A 4O14A 4TOQA 4JQAA 1JCLA 3UYCA 4DJDC 3AHVA 1W8GA 2PI6A 1OGSA 3PZIA 1WZKA 4UQBA 4GI8A 4UC5A 2NLIA 1EJ7L 2ZX9A 4MTVA 1XS2A 1VF8A 3BMWA 4AC1X 2G3MA 3GGMA 1XRTA 2OELA 4Q8FA 1MSSA 3I6EA 1SO3A 1O5XA 3TXVA 4UQEA 3W6YA 1PKYA 4D6EA 4WXZA 3ABOA 3DXIA 4L9YA 3H2FA 3OEXA 1RJQA 3PVXA 2F6KA 1V0KA 3CIVA 2PDLA 3DG7A 2NQZA 2OQYA 4N6EA 3PPFA 2AL1A 2VFHA 1U5JA 2ODOA 3ZXWA 1EF3A 4C6NA 1CLKA 4G1NA 4UWMA 5HUPA 2C2RA 4AISA 1O5KA 4L80A 2HPMA 3C2OA 3H12A 4H3DA 1A5UA 3WF4A 2GVYA 1CB7B 2CETA 5I07A 3U4FA 4LVAA 1Q6OA 3VC6A 1UIPA 4B2DA 3MR2A 1GKPA 2DT1A 1EDQA 2CZEA 3PW5A 2NT0A 1T96A 4UZSA 4A4AA 1RLDA 1EIXA 3TEVA 2Y89A 4PUMA 3SUVA 3VIIA 5C8BB 2W7OA 4X63A 3NQEA 1T40A 3VCRA 3SDOA 3W7MA 4FF7A 3BLIA 4FLSA 3SO7A 2OYMA 2VZUA 4BR1A 3N13A 5CPMA 3VGBA 1SUXA 1LL6A 1F73A 3CEUA 4NNBA 5LIWX 2G3JA 2ZRUA 1GVRA 2ZYFA 3TJ4A 1HZYA 4U10A 2VYOA 4M51A 4I9MA 4UFHA 4YWSA 1WQ5A 3E1F1 1SZEA 1VRDA 1F74A 1IR1A 4JFTA 3SSZA 3C2RA 5E9AA 3G6LA 4JY9A 2CXEA 1SSDA 1HO1A 4TTUA 3W7HA 3TAOA 2VMFA 3VNJA 1UC4A 3GNDA 1LROA 2FPVA 3GDKA 3LQGA 3LU2A 2XN2A 1G69A 2H3BA 1LT7A 3TROA 4C6MA 3T6CA 1JNDA 2PPGA 2NX3A 1XHGA 4O12A 1AVAA 2V30A 2ABBA 3MFHA 2DZAA 2WJZA 4RW3A 4ZE5A 4ECZA 4B2DD 2WOQA 3WQ4A 4DWSC 4NI3A 1W2PA 4GNKB 2FDSA 3W7LA 2YOCA 4MYXA 3KRSA 1YMYA 3GU9A 3T05A 4MJZA 4YHEA 2PEVA 2GFTA 3E38A 3TQ0A 3CPUA 2A21A 3A12A 4HA0A 5KFPA 3EDKA 5M5DA 1IXPA 3GIMA 3OYZA 4OE7A 2RAGA 2J6XA 2H90A 4J2PA 1BYBA 3TP4A 1IR2A 3WLKX 3D6NA 1PYFA 4BS0A 2J25A 4JHOA 4IQDA 4AZBA 4QTGA 3ZM8A 4ATDA 3ZR4A 1EC8A 4YHGA 4DXVA 2Y88A 1EA0A 1UD5A 1IXQA 2QJGA 1PL9A 4US5A 4V15A 3GTHA 3KWSA 2VVNA 5A6AA 2V5JA 3WD3A 1LT8A 3EMQA 1FWBC 3WK1A 1K8CA 2ZZ7A 1F3TA 4AUBA 3OLIA 2WWDA 3PS7A 3CB3A 1QPOA 2OX4A 4NT0A 1CWYA 3V0SA 2WV8A 1E4NA 3NSXA 3BC9A 3LHUA 3EX2A 4AHOA 1L0PA 3CUXA 2V8ZA 4ZOBA 3WYZA 2C19A 2PURA 2CBIA 3OGVA 3Q8QB 1GYMA 3N29A