1XRFA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
423
structure length
363
Chain Sequence
WMLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLDRLALIEGVKRGIIDCFATDHAPHQTMPGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotase
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 127
structure length 363
sequence length 423
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrfA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrfA02
2FTWA 3TN5A 1POJA 1P6BA 2DVTA 2YZ5A 2PGRA 1RK5A 4DIAA 4H9ZA 2P9BA 2Z2AA 4DNMA 1A5KC 5HMFA 4GY0A 3S2MA 3GGMA 1DPMA 3E0FA 1XGEA 4AC7C 3B0XA 3GRIA 1UBPC 3AU2A 3ORWA 3ITCA 2GWNA 4XD5A 2Z00A 3E74A 1WXZA 1FWGC 3S2LA 2PUZA 3UPMA 1M65A 4IFKB 3A3WA 4PE8A 4LCRA 4GXWA 3DUGA 1FWIC 4J5NA 4PBFA 3R0DA 3MKVA 4GZ7A 3A3XA 4P5UA 3RCMA 4WGXA 4B91A 3GIQA 3OOQA 3WMLA 3IPWA 2F6KA 4XD3A 3MTWA 4B90A 2IMRA 1YBQA 1YRRA 2EG8A 2OQLA 4H9MA 3C86A 2Z2BA 2R1NA 2BGNE 2Z28A 4LAMA 1KCXA 3LA4A 1R9ZA 3HM7A 2PLMA 2YB1A 4ZSUA 3PNZA 4LANA 2ADAA 4V1XA 3K5XA 1KRMA 3PBMA 3KM8A 3F2BA 2PGFA 3TN6A 4DO7A 3MSRA 2Q09A 3GUWA 4F0SA 3UR5A 4Z42C 4XAGA 4CQCA 2OODA 3MVIA 3E38A 3IV8A 4WHBA 4QSFA 1UMLA 2VUNA 4NG3A 4B92A 4G2DA 2OGJA 1RK6A 4QRNA 1R9XA 1E9ZB 3G77A 1R9YA 1V4YA 4KERA 3WYZA 3QGAC 4C6FA 2Z4GA 5CH9A 1RAKA 3N2CA 2GWGA 1FKWA 3E3HA 2CZVA 4DZIA 5LXXA 4V1YA 2Z7GA 4H9XA 3F2DA 4IF2A 3URNA 4XAYA 1E9YB 3OQEA 4DLFA 1PB0A 4C6KA 4L9XA 1A4LA 1HZYA 4RE0A 4R7WA 2VR2A 2QT3A 4C6QA 4CEXC 2P50A 1EJWC 4C6PA 5FSEC 2WM1A 1M68A 2FFIA 4IFKA 4E3TA 2FVKA 1P1MA 2ANUA 1EJXC 1NDWA 1ADDA 2R1KA 5HMEA 2I9UA 4H9VA 4C65A 1JGMA 4C6IA 2WJFA 1PSCA 2HNHA 3O7UA 2WJEA 3GTFA 3D6NA 3MDUA 1A5LC 3MPGA 4CQBA 1NDYA 4ERAA 3CAKA 1ZZMA 1EF2A 4IGMA 4INFA 2PAJA 3HPAA 3QY8A 2HPIA 1BF6A 2Z27A 4GY1A 1A5MC 2QVNA 1K70A 4EPDC 4GX8A 3MDWA 4QS5A 1ONXA 4NI8A 1FWEC 1EZ2A 2A3LA 2GOKA 1QXLA 2UZ9A 1K6WA 3NURA 3EWCA 3K2GA 4CEUC 3F2CA 1EJTC 2DVUA 3URQA 5E5CA 3IJ6A 2Z25A 2VM8A 4RDVA 5HMDA 1FWJC 4QTGA 4GY7A 4EPKA 1O12A 1RJRA 4OFCA 2D2JA 2VHLA 3AU6A 4ICMA 4CNUA 4C6LA 3UBPC 1IE7C 3TNBA 4LCQA 4ERIA 2VC7A 3K4WA 4XAFA 3F4DA 4KIRA 3DC8A 1A5NC 2P53A 3UF9A 4C6CA 4R88A 4C6BA 4KF1A 5A6TC 5FSDC 4ZSTA 4IFRA 3FDKA 2RAGA 2YB4A 3GTHA 4GYFA 3LGGA 4JOMA 4NP7A 4C6JA 3LGDA 3B40A 4J35A 4XD4A 4IFOA 4C5YA 3GU2A 3QY6A 4EPEC 2R1LA 3NEHA 1FWHC 3F4CA 3CJPA 3GG7A 4HK6A 3S4TA 4UB9A 3GU1A 2YXOA 1S3TC 3ID7A 4L6DA 3EWDA 4DLMA 2HBVA 4RDYA 1XRTA 3LSCA 3FEQA 4GOAA 3CS2A 4H00A 2OB3A 3LU2A 3O0FA 1EYWA 1GKQA 3SFWA 2HQAA 1O5RA 4IG2B 2BB0A 4KESA 1V79A 1PO9A 4I6KA 3OVGA 2DVXA 3T8LA 4D8LA 2VC5A 3GTIA 4ERGA 1FWFC 1WXYA 3LSBA 1FWDC 4LCSA 1J6OA 3OODA 4C60A 3URBA 3NQBA 2AQOA 3MVTA 3RN6A 2W9MA 1KRCC 3A4JA 4KEVA 4EPBC 3PAOA 4C6OA 2GZXA 3T1GA 2O4QA 2R1MA 5G4HC 2Y1HA 3BE7A 1FWBC 1NDVA 4C6EA 2GSEA 4H9TA 2ZC1A 4KEUA 2I5GA 1RJQA 4TQTA 2WJDA 1I0DA 1I0BA 4IQJA 1FWCC 4CNSA 3GU9A 1EJVC 4BY3A 4EP8C 4I6VA 1A4MA 1ITQA 2G3FA 1M7JA 1XRFA 4B3ZA 3GIPA 4BKNA 3ICJA 4PCNA 3S2NA 1YMYA 2AMXA 4GBDA 2E25A 3URAA 1J79A 3GTXA 2FVMA 3QGKC 3PANA 2HPMA 3WZ0E 1A5OC 2OOFA 4XD6A 4G7EB 4LH8A 4HK7A 2D2HA 1V77A 3AUOA 4C6DA 2D2GA 1NDZA 3E0LA 3TN3A 2Z26A 4HK5A 2HBXA 4PBEA 1POKA 3RHGA 3OU8A 2UBPC 4DI9A 1EJUC 5AKQA 3ISIX 3IACA 1EJRC 3V7PA 1K1DA 4IG2A 1FWAC 4GX9A 4J2MA 1EJSC 1RA5A 2QS8A 3S2JA 4KEZA 1PTAA 4RDWA 4KQNA 4H01A 1GKPA 4UBPC 4LAKA 3HTWA 4F0RA 1J6PA 4WVXA 2E1WA 3QY7A 1FKXA 4LEFA 1ONWA 1VFLA 4C6MA 1UIPA 1RJPA 4HJWA 3OJGA 3MJMA 3RYSA 2AQVA 4R85A 3JZEA 3IGHX 3E2VA 2QPXA 4IGNA 4LFYA 2Z29A 3B0YA 1V51A 4DZHA 4KETA 4CNTA 4M51A 4CQDA 4YIWA 4DI8A 4QS6A 1XWYA 4QROA 1YBQB 3LNPA 4H9UA 2R1PA 3UR2A 4GC3A 4C6NA 4RZBA 4H9YA 1P6CA 4GK8A 2XIOA 4BJHA 1KRAC 1KRBC 2Z24A 1YIXA 1V7AA 1ITUA 2O4MA 4XAZA 2FTYA 3FDGA 4PCPA 2ICSA 4C5ZA 3PNUA 4HA0A 1QW7A 3DCPA 1YNYA 3IARA 1UIOA 4LALA 4G7EA 4DYKA 4LAOA 4MUPA 2EG7A 4IH3A 1GKRA 3EGJA 3LS9A 3SO7A 2EG6A 4F0LA 2KAUC 3LY0A 3T81A 1NFGA 3TN4A 1W1IE 2Q01A 4AQLA 1RA0A 1J5SA 3IRSA 4RDZA
chains in the Genus database with same CATH superfamily
2QJGA 5BW6A 3ITTA 4CU8A 2B31A 4CQ9A 1S3HA 3PBYA 2GDVA 2QR6A 4HSNA 3FFSA 3QTGA 7PTDA 3M0IA 4GY0A 4L64A 1RVKA 4J9OA 3BSGA 2WC3A 1L6WA 3LTYA 1OCNA 3MMWA 3VKAA 4MMWA 4UTKA 3HV9A 3W86A 2MUCA 3C52A 3M9YA 5F4SA 1ME9A 4DHGA 1V6UA 4MYAA 2PS2A 3QZAA 3ZLGA 5BRBA 2D3LA 4V33A 4NX5A 5DY2A 3MKKA 1QWGA 4JTRA 4P5UA 4LV9A 5E93A 1KFEA 3FEMA 1PPIA 3N25A 3WJXA 1U33A 3CM4A 3MTWA 1JPDX 4PODA 1HNYA 1TIWA 3KVLA 1Q7ZA 2ACSA 5C2GA 1TV7A 5LIUX 4Q6JA 3IVTA 4H6EA 4MWAC 4PBGA 3PTQA 1XLMA 5SWUA 1OK4A 3U57A 4B9YA 4DO7A 6XIAA 1XYMA 3OVRA 2J75A 3BJTA 3B8IA 1QI5A 2VUNA 1VEPA 4NZ1A 3M0VA 4G2DA 4GUGA 3P84A 4UQDA 1VBUA 1GTHA 1FQ0A 1R9XA 3G77A 3AAMA 2PWGA 4Q4SA 4XTDA 1DWGM 3R8GA 3PZGA 5HUPA 1B3OA 2V63A 3HG2A 2YFNA 1GYLA 4K37A 4FOKA 4PTNA 2A2IA 4HD5A 2BHUA 2GGJA 4WDXA 2R8KA 1YXDA 1EP1A 4RPPA 4JIPA 3HG3A 1PX8A 3EEZA 4C6PA 1HUVA 5GQBA 1IM4A 3KVJA 3BLPX 1XYFA 2FZDA 5ENLA 3CASA 2FVKA 2PDYA 4LC6A 4GJJA 1XIGA 1ADDA 4EBDA 2J9ZA 4WDTA 4FIQA 1TPEA 3LV5A 3OEXA 4Y2WA 1CGXA 4C65A 2XSXA 5J5DA 1GG0A 4ASTA 4AG0A 4W8LA 3BSHA 4W5UA 3VGHA 1R3WA 1HX0A 5G1YA 2HVMA 4H7VA 3GNRA 1IZJA 1XRSA 5EMMA 4NT0A 4ICNA 1AJ2A 4JNZA 2GOKA 3L5MA 3NURA 1H60A 3QR3A 1ADSA 3ARZA 1Q6CA 3W7EA 1US3A 1ZUAX 3M47A 4YP3A 4RDVA 3CZEA 1UZ1A 2VWTA 4GY7A 4EPKA 3BQ5A 2V4QA 4E2BA 3R1ZA 4J7RA 1R87A 1TPUA 1OC6A 4XAFA 4UTFA 3WK1A 2VT0A 4KIRA 3GXNA 1R6WA 1VIWA 4ML9A 2P53A 3GC2A 2VFIA 3B04A 3NM3A 2GVYA 3DESA 4QE1A 4R33A 5EMKA 4JFSA 1XS2A 5A6TC 2VOTA 1GQNA 4QEHA 3TQVA 1E56A 3N4EA 3P0WA 2W9CB 1C90A 3L5AA 5BWFA 4NJHA 4YVXA 1AVAA 1F61A 2O7QA 4IFOA 3A4WA 4AZGA 2NXGA 4OZOA 2BTMA 2ZE0A 5EY5A 1H4PA 3MHGA 4DLMA 4IMDA 3IWPA 3FEQA 1UJPA 3CS2A 1I2NA 5GJNA 1KXVA 1FBAA 4JUZA 3FAXA 4AZ7A 2DEPA 2BMBA 3COTA 1MO0A 1P0KA 2EO7A 1ZBCA 3AS0A 3QOMA 2G37A 2J6UA 3KCJA 1J6OA 3G8EA 5BXTA 4HNUA 3OLIA 3VYLA 3UJ2A 4EPBC 2WMJA 2ASJA 3WO8A 4HKPA 3WQWA 1LDCA 4GNVA 4NNAA 5BCAA 5I07A 2IMWP 4K2SA 3VKKA 1X6LA 4CNOA 2Y89A 5KFKA 2ACRA 2E1DA 1V3HA 4R5EA 2HZGA 3GU9A 4S3FA 1EBGA 2Z6JA 5HUOA 3E49A 1EOMA 1KKRA 4LB4A 2XISA 4HNNA 3PS7A 1QNVA 2HNEA 1TCMA 1T8QA 1Y65A 1C3FA 5CPNA 4D6HA 4ZOAA 1T40A 3OTRA 1V3LA 3WK2A 2QDDA 5J8LA 2BY0A 3TV8A 3RHGA 3VCRA 3PR5B 1JZ5A 4NRSA 3UWQA 5M3WA 3WEOA 1MYRA 4IQEA 4N9BA 1HL9A 2GFTA 2NUXA 1EJSC 1BPLB 3KOWA 4DEZA 3I4EA 3WF4A 1WDRA 2X40A 1DYSA 2YBVA 3ARQA 4K38A 1B3VA 3BGJA 4ZEPA 1GKPA 1KFLA 4DO6A 1I2QA 4GUHA 2G96A 5C71A 4C6MA 4R34A 3KHJA 5I3GA 3LTPA 2OVLA 3VE9A 3WNMA 2PWDA 5DF0A 5EMUA 5JH2A 4M51A 1PDZA 3W73A 4DI8A 1GHRA 4PL1A 3EPGA 5A6LA 3GXDA 3QW4B 4J1OA 4IMAA 4E0CA 5FL0A 2BY3A 2QCDB 4GG9A 2I14A 1UZDA 3M0XA 1NP2A 2CHNA 2Y5EA 3TXVA 2WBGA 3C2RA 2V5KA 3W76A 3OP2A 3EA1A 3W7DA 3OVPA 3RMEA 3VNYA 5LNWA 1L6SA 2DZTA 1E1FA 4DNHA 3RUBL 2OWWA 1IXQA 4M6PA 3WEZA 1W17A 2Q01A 5CC5A 1NARA 4ZODA 3QQWA 1TKKA 3VDBA 1DIKA 3S1WA 3CNYA 1LROA 1RK5A 4CGTA 1K1SA 4MWAA 2FH8A 4DNMA 1DPMA 1LWJA 3WL1A 3VD7A 3VDGA 4IJBA 2OX1A 5KZ6A 1LYXA 1PTDA 1E55A 1GVSA 3ENLA 1LUCB 1XCWA 1YDYA 3C2YA 2Z00A 2C28A 2A7PA 4ZQPA 4GIAA 5DCBA 3QMTA 4OV9A 2GGHA 4PEEA 4IP4A 1XXXA 2P8CA 3MKVA 2VRKA 1TELA 1AG1O 1SJAA 4M80A 3GH7A 3GIQA 1OFRA 3R0UA 3FYPA 3PM6A 3SY8A 5DRCA 1WDWA 4F9JA 4L9YA 4W89A 2VZOA 5AECA 3I10A 3B8SA 3MBFA 1HVXA 4LVGA 4RV8A 1W1ZA 4PB3A 3R94A 2YZRA 5DG7A 3LA4A 2VQTA 4GXPA 5IDZA 1VKFA 3W2NA 2X16A 2PLJA 3MSRA 1EXBA 7CGTA 3KHHA 1HN1A 2QUNA 4AHPA 2CXGA 3AXKA 4QSFA 4JIRA 4KS0A 4A35A 2GQ8A 2ZA1A 4GGBA 4UQCA 4ACYA 1PKYA 2J7CA 1AQFA 3WYZA 4ONVA 5I03A 2HDJA 2Z4GA 5KG3A 3HG5A 4JQ1A 3JVAA 1V3MA 1CLVA 2W9AA 4DZIA 1VS1A 4AHOA 4EANA 1DHPA 3F2DA 4IF2A 1LRTA 4GRSA 2RDTA 3CAQA 4RE0A 2VR2A 3IS4A 3VFCA 3MO7A 4LVFA 4XZMX 1R3RA 4W7UA 4QJ5B 3TFCA 3LXBA 5L1JA 5D30A 4E3TA 4J2PA 2Y61A 3N19B 2Y7EA 3EA2A 1KGWA 3TROA 5E09A 2DH2A 2OKTA 3H4WA 1BVWA 1JGMA 2XGIA 2E68A 5C9UA 4X61A 1PSCA 3SRKA 1CNVA 1E0VA 4HU4A 2QJNA 4JHOA 2Z1BA 5FJJA 3PW5A 1J4EA 4F4WA 1J0KA 4BS0A 4DL4A 1S1RA 3BURA 1VPQA 3IJLA 1GVEA 4EAMA 1BF6A 3PFMA 4N4QA 3MDWA 4JQ2A 4LF1A 1ONXA 3GSMA 3QN3A 1QBBA 4L9ZA 4WRHA 1EEPA 5LA1A 2PB1A 3K4DA 4Z1CA 3WFAA 3MW7A 2OWXA 3MT1A 4CEUC 3F2CA 3GC5A 2FB3A 4IRCA 1MQPA 3CMFA 2JEIA 3HPFA 3SUTA 5I06A 4GCAA 4IJCA 4FBTA 2E28A 4S3JA 3LHYA 2XH4A 3PSVA 3DFNA 1M04A 3RG6A 3VD9A 3BWWA 2YLAA 4JN6A 3PPFA 4WDWA 4AXNA 2W91A 1S2VA 3WF2A 3QQ1A 3E1F1 3NQ2A 3ZQ9A 5CXPA 5F4XA 1PX4A 4RE2A 4ROQA 1DJWA 5KFPA 3U3HA 5I6SA 1NWRA 2FLLA 5ABTA 3F4CA 3VFLA 3DERA 1ZB5A 2ALRA 2X7WA 1NF0A 3PAJA 1DXEA 7ENLA 2KZHA 4IG2B 4AZCB 5BMXA 4UTTC 1TWIA 3GKAA 4PSRA 3ZVHA 1E3ZA 1BYDA 3E5PA 1RSCA 1HQTA 4EF9A 2ZUVA 1LWIA 2Z1SA 3C6CA 1UD3A 1K3UA 3BGGA 2XSBA 1A53A 5ABEA 1EFZA 3I3DA 3I7SA 1Y0EA 3AYVA 4OVXA 5A2AA 3GFZA 1JRBA 4Q8EA 4ECQA 5CCZA 2YCJA 2YXGA 1AODA 3SAZA 2DZBA 5CKSA 2VZVA 5FAGA 4XTIA 1QOXA 1FXQA 2DIEA 3FHAA 1FWCC 5JU6A 4BY3A 4AW7A 7TAAA 1ITQA 4MKSA 1U1JA 3NQEA 4JTJA 3V0UA 4GBDA 1JXLA 3KLKA 4HU3A 2IPFA 1LT7A 4Y9OA 3NL6A 2ZWZA 4RXFA 2D2HA 3L4ZA 1FVPA 3EB3A 2JEGA 4L1WA 3LMZA 5LKYA 4FNTA 1I45A 4UFLA 1P0BA 4ADUA 1EJRC 1UPPA 3NO5A 4XIAA 1DTNA 3MJYA 4PTVA 3ZLHA 4NAEA 2B7NA 1IHIA 1PTGA 4H01A 5D2WA 4AD4A 2V2DA 3WLMA 3QY7A 1DL3A 1KLZA 3O9NA 3C2OA 3KCLA 3LLDA 4DBWA 3LD5A 1BTCA 1HKKA 1WV2A 3MJMA 4EEYA 1C8XA 5XIAA 2QEZA 1E6PA 3LNMA 4R3UA 4PMRA 3TTSA 3ELFA 4IPIA 2YIHA 4N42A 5CPQA 1YBQB 2EPLX 4OBTA 3WLRA 3SRFA 3WQCA 4JTGA 4RZBA 1KO0A 5KT5A 3WNLA 1EX5A 5KFVA 3KHRA 1CGTA 2F8QA 2YA2A 1K9TA 4G7EA 3V6JA 3N73A 1V02A 1IXPA 3KP1A 5LGZA 1HXJA 2VP8A 5FEWA 1ADOA 3LI1A 2UVUA 3N2OA 4KIEA 5KFFA 3EWBX 3SUUA 4WCJA 2D23A 4L56A 3GK0A 3C61A 2OLSA 1GPFA 1TPFA 2XUCA 3NFUA 2GJRA 5HNTA 2V38A 1NU5A 3QEZA 2A79A 5FF0A 3UU0A 1VHNA 1JFXA 4GI6A 4PMOA 1CECA 2W61A 3TTEA 3W71A 2A3HA 5JVLA 2JEPA 3BLDA 1W5OA 3WIJA 2DZAA 1X1NA 4PBFA 1IR2A 4IPJA 3UXDA 4GZ7A 3UFYA 3UERA 3IJ9A 4Z17A 1VF8A 4F0HA 1X98A 1AQ0A 2F6KA 4QLKA 4TTGA 3PULA 2Y88A 2WWCA 4M1RA 4QQUA 3VZZA 2EG8A 1W6TA 4JGDA 1RLCL 1K9FA 2VURA 3FGCA 4JL1A 1PWMA 4KCTA 3C3NA 2NUWA 2AQ4A 1V0NA 1XV8A 3CV7A 3QZ7A 4Y9NA 1R38A 3NQCA 1Y5WA 3VO0A 3TN6A 4D8AA 2Q09A 1QU4A 3GUWA 3UD6A 4PTMA 3UR5A 1W37A 1YDOA 3PZNA 3B8UA 2QJHA 1V3IA 4O54A 2PC4A 1MUMA 3IUHA 1UMLA 1JPKA 3GDMA 4MY1A 1RK6A 3XINA 3V1PA 4HU0A 5A8GA 5A2BA 1C7SA 4J3TA 1E9ZB 1V4YA 1A0EA 3NM1A 3KL0A 1G7VA 1UOZA 1ZPTA 2GVJA 2VFHA 3SIMA 2HRWA 1UWQA 4H9XA 3BW4A 4F4XA 2VGGA 2ZFAA 4A3UA 3ABOA 4WKHA 3A4AA 3EB2A 1LOSA 2OTDA 3T4WA 4NJKA 4OJYA 3T78A 4LXFA 4HHMA 3ARPA 2XZ9A 3ZT6A 3GG0A 3M7SA 1ZBKA 4YNGA 1G7UA 2OYLA 1PYMA 3UCCA 4DX3A 5FJOA 4I3GA 4NF7A 1S97A 4CCDA 1E40A 1L6YA 1JXKA 2XH2A 3VIMA 3MPGA 3IGUA 1TTQA 3DZ1A 2DSUA 5HQLA 4HMCA 1RLDA 2Z27A 4UWMA 3MP5A 4GY1A 5TIMA 5HR6A 3M5VA 5AC8A 5AHLA 4A3QA 4HT3A 1FWEC 1R2SA 1TWSA 2UZ9A 1XFCA 4BCEA 1IYXA 3W29A 5CGQA 4Z0JA 1JAKA 1W1PA 1KM5A 1M7XA 5E5CA 3V3WA 3CZJA 3H2CA 3UVAA 3S9IA 1OF6A 4F66A 1RJRA 2J6XA 5LIYX 3UZJA 2V5CA 3AU6A 2ZADA 1FHVA 4FO4A 1L2QA 5LIWX 2NLIA 3H23A 1JFHA 1S5NA 3WCZA 2JGYA 4JAWA 4UTTA 4AEEA 3DC8A 3W6YA 4YS1A 4JQ3A 2IPJA 3TQKA 5XIMA 2Y70A 3AS2A 3NZRA 4RR4A 1RQEA 2Z1WA 5D03A 5K4XA 1F3EA 1R2TA 3KBJA 3C4UA 4J9JA 4PA8A 1UB3A 4C5YA 3CB8A 4U4MA 3T0BA 1LT8A 3GG7A 1UQZA 8RUCA 1E6NA 3LQLA 5KG0A 1O5QA 3AZSA 1SVDA 4H00A 3VABA 1J9YA 2W4XA 1EYWA 4L80A 1JCMP 4GISA 3M0JA 4KESA 4MZ8A 3BAJA 1SJCA 1WDQA 1VIZA 4DF1A 1KBBA 4PUNA 4F2UA 4A3HA 4YTUA 1DIEA 3JUGA 2Y8VA 4AD1A 3TZFA 4CCEA 2FJUB 1ZETA 3B8WA 3RN6A 5IFPA 3VE7A 3PAOA 3VCCA 3T1GA 3GXIA 4UTMA 2CYGA 3OYXA 3RM4A 3AHYA 1IIGA 2G3MA 1KQZA 4KRUA 1EIXA 1NDVA 4Q7BA 5FJTA 2GSEA 1TWDA 1WZKA 2OO6A 1VFFA 2YJQA 3CB3A 3UJSA 1DHKA 1EHAA 3B9AA 4CU6A 4JYEA 2FDMA 4W7VA 1MW3A 4D6FA 3N15A 3LBOA 1E43A 3PR2A 4MJZA 3MC5A 4BKNA 4JV2A 3AZRA 3WUFA 1OZQA 1QRQA 1F4HA 2Y4SA 3CIVA 2GL5A 1OX6A 2OGYA 3I3EA 4QCEA 4LY4A 4WJXA 3OG3A 4XBJA 2QKFA 4EE9A 2DIKA 4KPLA 1MXGA 1O66A 1H11A 4Q7NA 5JMUA 1V7YA 2C8NA 2UBPC 1C8QA 4BA0A 1J0IA 4G8TA 3A6OA 2E3ZA 3LCIA 4ECYA 3UG8A 3TW7A 4O3OA 4H7CA 3GHUA 3LCLA 1OZMA 2GJXB 4KCWA 2WHMA 4FMVA 3PG9A 4O15A 4HYVA 1JZ2A 4QDWA 4RDWA 2BS9A 4TVCA 1X1ZA 4F0RA 4Q4RA 5E6ZA 1D3GA 4A2RA 1RBAA 3PBWA 3ARTA 1JIHA 1RJPA 5KFSA 3GIYA 1TV8A 4O3PA 5KT3A 3AISA 1D7FA 1YEYA 1JCYA 2H8ZA 2X1IA 1NFPA 1S2AA 3TTOA 2EPMX 2W66A 2XN1A 1EX1A 3ES7A 1GOXA 2NQ5A 3VM5A 2HV5A 2QDEA 3CPUA 4K36A 3DH7A 3ABXA 1OCJA 3PUEA 2UY5A 4H9UA 1O1ZA 2XWDA 4KWSA 5EFDA 4QNWA 1Q6RA 2Z24A 3UCDA 2WNZA 2F61A 4GVHA 3DCPA 1JDFA 1LQ0A 1YNYA 5EPDA 3DHDA 1SO4A 4IQDA 3DENA 4QWCA 1H51A 3QMSA 3QTPA 2VZUA 3H26A 1YKWA 3IRDA 1J5SA 2IKGA 2DV0A 3REQB 2W8LA 2DJLA 4LAZA 4YTQA 5T9CE 5BXRA 4UNIA 1IF2A 3T0CA 1G1YA 4F40A 5AC4A 2VD8A 4AVFA 1LLZA 1I1XA 5CAHA 3QKZA 4RUBA 2CW6A 5EFFA 4YCOA 1ZP4A 1U1HA 1TMLA 4B5VA 4TR9A 3N6JA 3ITCA 4PTXA 4Q8VA 2PDFA 2OZ3A 5LSMA 3UZXA 5HJXA 2BHZA 3EOSA 5EBUA 2UY2A 4MHBA 4Q8FA 5EB8A 2DUXA 4ATLA 2PWVA 1XUUA 4V15A 2HCVA 4AIBA 1CWYA 2ZTJA 3F1QA 3IPWA 5C2CA 3L67A 4UZUA 3S5NA 5T26A 5DELA 5DY3A 1YXYA 1OFBA 4E8DA 1Z8AA 3GM8A 1RP9A 2R1NA 1FWSA 1SJDA 4JR5A 2FGBA 3AJXA 2PDCA 3M41A 2FFCA 4CKQA 3R4IA 3PBMA 3KM8A 2CLKA 2RGMA 3WLOA 3NSMA 3FCPA 4CNNA 2OODA 1QK2A 2GVLA 3NQMA 2WCAA 5JUMA 1KNWA 3WQPA 5F4WA 3MI3A 5CLTA 2A7RA 1X8CA 3O16A 1RPXA 4W88A 1C8YA 1RCXB 1CLKA 3GNOA 2DT2A 3TW6A 5D9PA 3N2CA 2PP1A 2DY3A 5G1MA 4LF2A 1FKWA 4GVGA 1WUEA 4JTEA 4GJIA 3ABSA 4OQVA 3R10A 4V1YA 2QAFA 3Q8PB 2J8GA 1J10A 2AGTA 4M3PA 1TE1A 1YNQA 1QTWA 4CEXC 1B3ZA 2PTXA 2V82A 1DXFA 3FIGA 4BFAA 3PWIA 1ZLPA 4MDOA 2FZBA 4Z1DA 1JX4A 4WZHA 2I5QA 1NTHA 4A6GA 3NQVA 3B8DA 1CTNA 2I9UA 2Y2WA 4MG4A 5AFDA 1N8FA 3N34A 1UH3A 2DZUA 1LWHA 3QPEA 4PC8A 1BF2A 1QBAA 4EACA 3TTQA 1SFSA 3GQCA 2CEQA 4B5WA 3PJUA 3P5ZA 2HPIA 2BOEX 1SSDA 4QE5A 5C5JA 1QWKA 3E2RA 5KG7A 1AD4A 3CUZA 4QS5A 3PR4A 1NY1A 1VBGA 3OZOA 2V68A 2A3BA 3EX3A 2X2YA 4WF7A 3LHTA 3T2PA 2FDSA 4YJ5A 3KL3A 3O1NA 3Q65A 2YFOA 1H3GA 4L61A 1V6VA 2QZRA 5HMDA 3T5LA 3MI6A 4K1WA 4YWSA 2VHLA 1SSGA 1TMQA 4GIRA 2XG9A 4AEFA 3QLLA 1QDSA 4RL3A 3I7RA 2Y7GA 2OSWA 3RM8A 3BTNA 5B7YA 3FA4A 5CGTA 2OT1A 4H1ZA 5H2ZA 4U2ZA 4WOQA 3POHA 1UA3A 4R88A 2PSNA 3OSPA 4F50A 3OZMA 1QI3A 2PDPA 2J9YA 5AOUA 1XPYA 2HWGA 2AOSA 5MKGB 2PDMA 1GQKA 4PRTA 4GNJA 1A5SA 3H2AA 3UY8A 2DZXA 1SQ7A 3NEHA 2PDLA 3CJPA 3M9MB 4S3BA 5KZEA 5KZDA 4ROPA 1EXPA 3TC7A 1BQCA 3M0KA 3N3MA 2TYSA 3CPRA 3WD2A 1KCLA 3P3BA 1FFQA 5A6KA 5KFLA 4R27A 4WY0A 2G95A 4YU1A 3E12A 1KFKA 3NQBA 1OF8A 1KRCC 4QNEA 1HP4A 5AYXA 3L9CA 2ATSA 4ORMA 3UQNA 3R8RA 3NQFA 4HP5A 1I2PA 1B1YA 5K9DA 3W7PA 4UMAA 3A9IA 4OOUA 1NSJA 1ITCA 2YA0A 3W2LA 3GW3A 3IIZA 1XR2A 1J5TA 3QV9A 1XINA 3WELA 1NM9A 4J9LA 3M9NB 4D9PA 2VKZG 3VDCA 4JTSA 1YE4A 3WUEA 2C15A 4DJDC 2ZX7A 1TB3A 3UWZA 2E25A 2VENA 4FX8A 4YQWA 2ISSA 2YOCA 5CBIA 4MNJA 4O10A 3UGVA 3E6EA 4HK7A 4MGGA 3GC4A 1SZFA 1V77A 2XFYA 2IQ0A 1XJBA 1ONRA 2QIIA 2OZTA 3WDHA 4W5ZA 2GVEA 1IQ8A 1POKA 2OCZA 1KTCA 1HO1A 3BG3A 4UIOA 4PUMA 2OWCA 2GDUA 1HTIA 5HINA 5CBJA 4QIUA 1PS9A 2GDQA 3BCDA 3W25A 3BQ6A 3RILA 4BQ4A 5GVJA 3GV7B 4HBKA 4ZOBA 5D2YA 2HMCA 2PP0A 2ZUSA 2ZRUA 3BOLA 4DM2A 2GGEA 1MEIA 7A3HA 3SCWA 1E6RA 4D71A 4FOUA 3BW2A 3H55A 3SCSA 5LGXA 5K3VA 2PI6A 1ONEA 3B0YA 1CB7B 4Q4KA 5HNRA 3QJAA 1VB9A 2EXOA 3KLLA 5LHEA 2XM2A 1ME7A 3WH7A 1W3NA 2NWSA 4KCUA 3XIMA 3VNIA 1CLXA 3IN5A 1H7RA 5MHBA 2HK0A 3GNNA 3WFZA 4OUEA 2EKCA 3GW0A 4PTWA 5CBBA 3MANA 4DWSC 2DSVA 4M6QA 3R11A 4NIRA 1DWHM 1FH9A 3O6AA 3TOYA 3BQ2A 2NQJA 3T81A 3ITXA 5A5WA 3AROA 2YBTA 4Q8UA 3W7HA 3QZ8A 3K13A 2P3EA 1POJA 1UJQA 3C2EA 2V8ZA 5L1KA 2ZYFA 1Q4WA 1MWOA 4QLLA 4U6PA 1M41A 2Z2AA 1JUKA 2A21A 2TMDA 4P7QA 4OTKA 1HJVA 1F9CA 1XGEA 1QNRA 5ECUA 2J79A 4MTVA 4MOZA 4ZB0A 5I09A 4IWWA 5F1VA 4XZHA 3GBEA 4HPHA 5H91A 3LTSA 4XKMA 4PE8A 2PZ0A 3OA3A 4J5NA 3UP8A 1TA3B 2A4AA 1BXNA 4WGXA 2WNNA 4Q8NA 2YXXA 1LORA 4DPPA 1PV8A 1DV7A 3N2XA 3C86A 3B3DA 4U10A 1KCXA 4LBUA 2YB1A 3KOZA 5DXYA 2OEKA 2W62A 4HPXA 4US5A 4LANA 1PVNA 3BLOA 4O50A 4RNMA 3OLDA 3OLEA 1W5MA 5HNNA 2WC7A 3QR1A 5D33A 4PR4A 1ZL1A 4GI8A 1J18A 3GNPA 4PEKA 3NGJA 4B92A 3EX6A 2J6SA 3MUCA 1CB2A 2E40A 4GQQA 5FF2A 1E1CB 4KERA 1VYPX 2OOGA 1O1HA 3BJYA 2FHBA 3PFRA 4LRTA 3Q58A 3OBAA 1JAEA 2PRLA 4GQGA 4URIA 4E2VA 4DBUA 4ZOCA 3T0DA 3PPHA 3I7QA 3A5VA 3UWYA 3CXOA 9RUBA 4L5ZA 3S6OA 4RZ4A 1PZ0A 2CLFA 1V08A 3SSJA 1S5VA 3ZYZA 3BSMA 1MZHA 3MDUA 5FIPA 4CQBA 1UYQA 2JK2A 2JBMA 4TV6A 2O55A 2QNEA 3WDQA 1BG4A 2ZZ2A 2E9BA 5HATA 2BXYA 1D8WA 4NI8A 2BOGX 3GX9A 3GG1A 3PVXA 1TUFA 1H1NA 2BGSA 4GYPC 1TWWA 5KG6A 3DYMA 2BVYA 1XQLA 4QTGA 4HHLA 3EZ4A 3GIKA 1H5VA 1QUMA 3WLKX 3UBPC 3EOLA 3GR7A 2ZOXA 1PIFA 9XIMA 3FX4A 4GQBA 3LRKA 3CLWA 4JX6A 1LOQA 3W2MA 1F05A 4P7LA 1BAGA 2WLZA 4JNMA 3GE7A 3GS6A 3LGGA 4FF5A 5KT6A 4UFIA 1MXSA 5C7HA 4R7JA 4NJGA 3POCA 4IOTA 4EPEC 5AN7A 4NX0A 2MNRA 1XSKA 1M5WA 4U7CA 2YXOA 2YCIX 2J74A 4PMUA 1UR2A 1PHWA 4L1GA 4GOAA 3HF3A 4AWEA 3O0FA 2RFGA 1XKYA 3O2LA 4N0RA 3MY9A 4DXXA 1DBTA 2DVXA 1PWLA 4HSOA 1EPVA 4DJDA 3RGTA 1U1UA 3GDKA 3EKZA 3CL8A 1QPRA 1HP5A 1IT7A 3S0CA 2J6TA 4C7FA 5G2IA 1BYAA 2WW5A 3VAVA 1W1YA 4W8AA 1TJRA 1HFBA 3WDJA 2R1MA 4A2SA 1B2YA 3GB6A 3QZ6A 1UA7A 4HA4A 4RNNA 2XH0A 3WSUA 2I5GA 1QFEA 1OG6A 1JXJA 3UWUA 3TUUA 2C18A 2X1UA 1L6FA 1QO2A 1GOWA 1CXEA 3NL2A 2Y7FA 3H8AA 4S23A 1JCLA 3ICJA 4EBEA 2JFEX 3B8TA 1R86A 1WUFA 2OPJA 4ECSA 3KCOA 1W3JA 5IBXC 2P10A 4RZRA 3T9PA 3GDTA 8TIMA 1UOKA 3AUOA 3RB6A 3M0HA 3NQ6A 2IKHA 3BAYA 4KFPA 4S1FA 2OH2A 1DWIM 1FHDA 2XYLA 1VBHA 6REQA 3GR8A 4HPNA 2D2OA 1FWAC 2Z0IA 5KFQA 2OMAA 2QLYA 5CLWA 4PFHA 4ZZ9A 3EX4A 1NVMA 3SRDA 1JYNA 3H2EA 3QFEA 4X22A 2QUTA 1L6GA 4H8HA 3IAQA 2ZCGA 3OGVA 3N3TA 4G7FA 2AMGA 2NUYA 3CT7A 4HSHA 4DWSA 1MFVA 2F2KA 4CCCA 3I3BA 4B4FA 1GWJA 4PUEA 4O4VA 1EP3A 4HZ8A 4AISA 5KFOA 4LS0A 5AB3A 4K8EA 5EWFA 4IGNA 1MW1A 2DZWA 5M2FX 2VCCA 3DU0A 4WX2A 4XZNX 1G67A 5LNUA 1S5MA 3P7YA 4MWAE 1W3LA 4IUOA 1Q2SA 4MPQA 2PDWA 1TWZA 3WQGA 4H9YA 3UY7A 4Q3MA 3K46A 4BJHA 1JF5A 5TAOA 1W1A1 2ASLA 2XTKA 4P8VA 4Z1AA 2PGEA 3FYOA 4BF5A 4LAOA 3GBDA 5I0DA 3M6DA 2NW0A 4EVZA 5AY7A 3RJXA 4MYXA 4AWSA 3EGJA 3LS9A 3PG8A 1RY8A 3SADA 4XZLX 5I78A 1W91A 4KGLA 4FS9A 3L2IA 3L66A 3WDIA 2V9WA 4PMVA 5KINA 1GJPA 1ZQ5A 2DVTA 2AQWA 5KFXA 4DIAA 4NUWA 2I1OA 1A5KC 3EPOA 3S2MA 3GGMA 3RLHA 3RRAA 2FLPA 3SN0A 3AU2A 5E0CA 1WXZA 2JEFA 3BV4A 2GSHA 1C8VA 2O9PA 3L4TA 1DWAM 1I9CB 3R89A 1U83A 1WX0A 1O95A 4B91A 1JPHA 1WA3A 3ZR4A 1DQXA 1QK0A 3TZNA 3KE0A 1F7BA 1BD0A 1VD6A 2NX3A 1P0EA 2IMRA 1WZAA 3CHEA 4H9MA 3OLGA 2R91A 2A5HA 4C1NA 1C93A 4FXSA 2V3FA 3QV6A 4NVTA 4JKLA 3T7VA 1K8XA 3NAVA 4IIBA 4V1XA 3SURA 1EYEA 2QQ6A 3N29A 1W1TA 1KFWA 2PDXA 2BZNA 3ZMRA 3UESA 4DZAA 1RV8A 3UWVA 3H22A 1ZY9A 3UG5A 4GLEA 1XG3A 5FI8A 4RJEA 5B80A 2EGZA 5FJRA 5HK4A 1THFD 3LLFA 2Z7GA 1XLEA 3L4WA 3MB9A 2QV5A 4XAYA 4L9XA 3R79A 1V93A 4O3QA 2JEJA 4OECA 1MNSA 4GYPA 1KM2A 1K77A 4BI7A 2FFIA 4B4HA 4XK2A 1VP5A 3CO8A 2W6RA 5L9FA 4GCXA 5BZAA 2ISFA 1FCBA 2PDJA 2H3BA 4C7DA 3L0GA 5HMEA 1JDCA 3WLJA 2B81A 3Q45A 2WSRA 4E8CA 1EC8A 3ARRA 5A6JA 4NYYA 2WPBA 3KFTA 2DU2A 2WMIA 1EF2A 4JYDA 4INFA 3KDOA 3QHOA 1VRDA 4RCXA 3UETA 3ZVHB 3LK6A 3MV11 3HMCA 1XIJA 2DVUA 2WB5A 3TQPA 1I60A 2BY2A 4M29A 2Z25A 2X2GA 4DB7A 3LCFA 5IXEA 3MR2A 1CW2A 4IIFA 2D24A 4QHRA 1QOPA 2Y7DA 3EX1A 2UVWA 3TNBA 2WBKA 3KTXA 2WCSA 4XVDA 3W1RA 4QBXA 5U7SA 2ASDA 4ACZA 3A21A 4AMCA 4WOZA 2FZ8A 3QF0A 1FDJA 1GEQA 4X2RA 1XIEA 4OT7A 1SGJA 1NOFA 4F8XA 5DG9A 1GW9A 2CZEA 1GYNA 4QAWA 2O9OA 1F07A 5HNUA 2C2RA 1X39A 1XFBA 1XLCA 2IXVA 4XD4A 2Y0FA 3GU2A 1P6WA 3DBPA 4TVDA 4FXFA 2WLYA 4UB9A 5DLCA 3QRHA 4DPQA 3EWDA 3V4BA 1J12A 1KD0A 3PJWA 4GWEA 4KKXA 2OB3A 5F1UA 3DFTA 2NV2A 4BF7A 3VDHA 1WOAA 4XZWA 3CQKA 4NAEB 3T8LA 1KC7A 1J11A 2E09A 3STEA 3S8HA 1FWDC 1R46A 4LWWA 2RHGA 2DZVA 5IBXA 4N9DA 3BZGA 3B0PA 1PHQA 3PW2A 2H90A 2CLLA 5KFBA 2V5BA 3W24A 2ZWYA 2O4QA 1BKSA 7TIMA 2X8RA 5G4HC 4HCHA 3S1VA 3CAVA 3W7RA 4C6EA 1AL8A 4H9TA 1KM3A 2CWNA 3KBNA 3TDFA 4E2OA 5K9XA 1ZCCA 2IQDA 4W8BA 2QCCA 3T55A 4B2DA 1H7NA 4EP8C 4O3RA 2GYIA 1A4MA 3BAXA 2XHYA 1W2PA 1JCJA 3PANA 2HPMA 4XD6A 4G7EB 2QF7A 3AHXA 4ZFMA 5CAKA 1H61A 1HJWA 1NFBA 4HZ6A 1H63A 1DWJM 5E1QA 3QHNA 3TN3A 2D3NA 2HBXA 3P93A 1MRAA 1W5PA 1GVIA 2CXEA 1VR6A 3NPUA 3RU6A 1K9DA 4X0VA 3QPYA 4GQ0A 1RA5A 2PC8A 3UPBA 3WF3A 1YPXA 3S2JA 4KEZA 4I7WA 1F2JA 3PW7A 3Q8RB 1XD1A 1CDGA 4LTSA 3INPA 1J6PA 4W7WA 4Q44A 2YCEA 1CXHA 5BMWA 1ONWA 2WSPA 3GVGA 1YXCA 3KHLA 2BQ3A 3SCNA 1V02E 3CT2A 3F7JA 2W7OA 3DYOA 3GAKA 1WZLA 4M19A 2R8IA 3SY5A 2ZUUA 4O3SA 5K7JA 4I5RA 2A0NA 4MKVA 2JF7A 4AEOA 4GINA 2PWEA 3W26A 1Q6DA 3UJEA 1F4AA 3W53A 5GNXA 1GYMA 1Q65A 4RNIA 2CBJA 3UR2A 4GC3A 2X30A 3H7UA 3GQYA 3NVDA 4C6NA 2Y5SA 3GHRA 2DPJA 3FGCB 4ZO7A 2XIOA 2ZXBA 1JYVA 1KRBC 1I2RA 4H41A 5CC7A 3NZPA 2PP3A 4PCPA 4C5ZA 4UMBA 3S1GA 2UY4A 2P5NA 3VX1A 1F3WA 3IARA 3OA5A 4I5XA 3GYCA 3NCOA 8XIMA 4D6DA 2FTPA 2C79A 3LY0A 1IEXA 2VX4A 3BLLA 5D04C 2V67A 3M0MA 1J93A 1Z48A 5DT5A 4J3XA 1PL9A 2QUVA 1P0DA 2WSKA 3L5LA 3W02A 4F4RA 4L6HA 2XFRA 1Z7AA 1UUOA 1BYCA 3TE9A 5CJ5A 2W9CA 3N6QA 1MRQA 1ZBWA 3D0CA 3B0XA 3RPTA 1C91A 1H2JA 1VPXA 2GWNA 5PTDA 4CD7A 3KVMA 3TYEA 2OU4A 3HIJA 2BNJA 4E4FA 4LCRA 3IV3A 3TR2A 1PZ2A 2CWXA 2XZ7A 1ZCOA 2CZ5A 4J4KA 3AXMA 1XDMA 1XGZA 5E6YA 5AYYA 3OOQA 4B3KA 1EGZA 3V36A 2PTYA 4MAVA 4P61A 2DT3A 1TV5A 4XAPA 4H2CA 4AY1A 1MDRA 1ML1A 3GTNA 5DXXA 2W7PA 2VRQA 5D9OA 1DJQA 1F3XA 4IUGA 4LAMA 3HGRA 1WKDA 3TWAA 3AXHA 3WJWA 1WAWA 3UZWA 4J3SA 2ADAA 3GXMA 3NQ7A 2WHLA 5HWJA 1B4EA 2VEFA 1G94A 1EA9C 3E9AA 3E38A 4HYRA 3S47A 3P0XA 3VKBA 2BOFX 4LVBA 4AYSA 1AW5A 2YL9A 3M44A 5CH9A 3W28A 1LBFA 2YW4A 4S3AA 4CLMA 1M6JA 4M1BA 5FESA 3FW6A 3YPIA 2DT1A 4AVNA 1U5JA 1XM3A 1OADA 3UYIA 3MO4A 3N9SA 4EAYA 4UQAA 2FHCA 5J5RA 1ESWA 3THQA 4JN8A 3OHMB 2GJPA 3K4AA 3PUDA 1S5TA 4ED3A 4NYUA 1CYGA 5KT4A 4K8HA 2ZUNA 3WJYA 3S83A 4EWND 3HQOA 1RZMA 3UXKA 3M7WA 3E2QA 2HNHA 1GTEA 3IUIA 4FA3A 4ZB2A 2E6AA 5A3HA 3N04A 3APYA 3ZT7A 3FKKA 5HWNA 3DI0A 1FDZA 3VGDA 2DFAA 4ZE4A 5LZLA 4WSHA 3OSNA 4IMCA 1JJKA 1DJNA 1XSJA 5M1TA 1QOQA 5H1WA 3KAOA 4LB3A 2W67A 1XYZA 1P7TA 4U3CA 2HVOA 4CNUA 3OYZA 2J7EA 2QCDA 5AHMA 2ZXDA 2XGZA 4S3KA 3K4WA 2V5LA 3SI8A 1A3WA 4W85A 3ABQA 4O0QA 1VHCA 4RUCA 1F3TA 3NWRA 2CLOA 1GZGA 2HROA 2AAAA 2X42A 3IIXA 3AALA 2G3IA 4GYFA 3PWAA 3B40A 1DE5A 2PRMA 3QY6A 3CZ8A 3G5EA 2Y8KA 4A3RA 2ZZ4A 3VZYA 3LHZA 4ZQMA 1AH0A 3ZO9A 1UC5A 4J9NA 2A3AA 1GKQA 1JCTA 1BQGA 1JI2A 4L4LA 3GHTA 4RNHA 5IM51 1LUCA 1TJPA 2DDXA 3BQ0A 1GHSA 1ZJIA 1FWFC 1WXYA 2XVKA 1S0MA 3A9BA 3OODA 4IMEA 4POCA 3FVDA 3WBEA 4KBXA 4V2XA 3BANA 3P5YA 4M6VA 3W1NA 4W84A 4C6OA 4YXGA 5AYBA 1NEYA 4DUVA 3HG4A 3KDNA 2DUAA 2I9EA 2ZRWA 1UWUA 1F5ZA 2WM0A 2ZC1A 1N48A 4KEUA 1VFUA 4TQTA 3RJYA 3W2KA 4XSMA 3CQJA 1O5XA 2L5HA 4FHAA 3TYAA 4YR3A 1WKFA 3TQ0A 1S38A 3T2OA 1B30A 4MY9A 3J7HA 3RMJA 3S2NA 1AQMA 2ZKMX 4MLJA 4UNLA 1KFBA 1HKWA 1OIMA 3WZ0E 5E9XA 4LT9A 4NAFB 5A69A 4UZSA 4F3HA 3W1PA 4O1FA 5BROA 3ZOAA 1QO5A 1E0TA 3DGRA 2X0SA 1VYSX 2Z26A 3AMLA 4LYKA 3EWZA 4J9RA 3UEQA 4OWGA 4HN8A 3TU9A 1EIBA 3FJ4A 3M5ZA 1LM1A 3BCFA 2C2EA 2X0YA 1V6YA 3LV6A 1REQB 3CHCA 1YQ2A 1XG4A 3SECA 3CIXA 2PEVA 4AF0B 3HTWA 4MM1A 1QATA 3ZJ6A 2JIEA 2E1WA 1MUWA 5D9NA 3GD6A 4HHHA 2J24A 1NQ6A 1EZWA 4PZVA 1VFLA 3BJFA 1LQAA 1JZ7A 3MKCA 3OJGA 3QQ0A 3DFPA 5JBFA 3VOGA 2ZRZA 3IGHX 3E2VA 2YR1A 4F2BA 5D38A 4ZGYA 1P43A 1V51A 1ISXA 3TJLA 1UCWA 3H2MA 3SJNA 2FIQA 3WX7A 2FQIA 1JIBA 3RO8A 4YTSA 1UWIA 1WYIA 3U4FA 4O12A 1TE6A 2E5CA 3II1A 3LX9A 2W79A 2A7NA 2QGHA 4IH3A 5L1LA 5ABHA 1KGXA 4JDYA 3VNKA 3IGSA 1F6KA 3WUGA 3SCRA 4U28A 4W93A 1G4PA 2VCBA 4I8YA 3DC0A 4JNYA 3ZLFA 1EGMA 3NYZA 3DIPA 3NTYA 4HNOA 1YHTA 3N11A 2YZ5A 2PGRA 3D46A 3SR7A 4H7ZA 4S3DA 5KG5A 3WDRA 4QWDA 4HMNA 5EMJA 4FEZA 3MR3A 3MBDA 1QNPA 4AC7C 4K68A 3VOCA 4DAFA 5A8OA 1UBPC 2WMGA 1F6YA 3ERPA 2AGOA 1EDGA 4O18A 3IIVA 3S2LA 4HCLA 2W9BB 3QLDA 3A12A 4NZ4A 4GXMA 4B5SA 4BEUA 3AS1A 4H8VA 4LQ1A 4BWLC 5LXEA 3G6YA 2RJGA 1S2UA 3N9KA 1W0MA 2VWSA 2CLMA 3FV9A 2PCEA 4YYCA 1R0MA 4IISA 1JI1A 1ZNNA 2NQ9A 3L2LA 4I9TA 4MZYA 1T0OA 4GJ1A 3AMDA 3RX2A 2OEJA 1XYLA 4BQ2A 1TYGA 1YADA 2INZA 6CGTA 3APTA 4GFIA 3ITOA 2XVGA 4LS1A 3KZPA 3QGVA 5KT2A 2QGYA 1JGIA 4R7OA 1XLAA 3MCMA 3EMCA 5DBTA 1KV8A 1ZALA 1A3HA 4IHCA 3ZWSA 4DZ5A 4O16A 5G1TA 3V5OA 4R8UA 1XRVA 4UOZA 4UR9A 2VFEA 3IUDA 2WK2A 3C3UA 4PUWA 4B5NA 1R7AA 1SJBA 2ABAA 2FJKA 3E3HA 5FJPA 5LXXA 1R3VA 2HSAA 1XC4A 3L7RA 1E6SM 3VD5A 4HNVA 4C6QA 3MU7A 1O94A 4O17A 4BI5A 2J7DA 2CC0A 4UTIA 1UR4A 4AX7A 3SCQA 5LNVA 3PZTA 4Q8OA 1ZRQA 1JZ6A 2V81A 4DJFC 1BEUA 1MI3A 5DGBA 4G6CA 2ZIDA 2PBOA 1TVNA 3PY2A 5TQLA 3SZ8A 1H7WA 3PHAA 1IIHA 5D9MA 1NDYA 4L6OA 4M5PA 3HPAA 4F79A 3MUAA 1XIHA 4RUAA 2WAGA 2HS8A 3EWWA 4WY0B 2A3LA 4CUCA 2X1TA 1E51A 1KR1A 3HGSA 5CZTA 3KBVA 5A6SA 3U2ZA 4TXEA 4X60A 3M4HA 1Q85A 3URQA 4JZ5A 4IPPA 3P60A 1U22A 4DXKA 3MMTA 3FA5A 3F5KA 2H9AB 2F6UA 2QDHA 5DANA 3VX0A 1KLYA 1H49A 1MMFA 2FLNA 1K03A 5D8WA 4N9CA 4O1EA 1LJYA 3G0XA 2JF6A 4LCQA 4ERIA 3VOIA 2VL4A 2R14A 3PPCA 3ZSSA 3EA3A 4IX0A 1EUNA 3GDLA 1TRDA 3UF9A 3VOHA 3F4NA 2G3NA 3QW3A 2WCGA 4N7QA 2YB4A 2C0AA 3NOYA 1PYFA 3MWAA 4OU1A 3EOEA 2XC9A 2VGBA 4EF8A 1A5AA 2VFFA 3CPGA 3I68A 1LTDA 3S6DA 2FZ9A 1GQJA 2V30A 3I6EA 2NV9A 3G0SA 3BQ1A 1FY6A 4L6DA 5CZKA 3THCA 1H09A 1E70M 1XRTA 3CWOX 4X2PA 1GVOA 3PVFA 2PZNA 2CNCA 4WUIA 5GNZA 3L4VA 4IPNB 1PKMA 1WP6A 4B9ZA 5I5RA 3LLXA 5BOEA 3O63A 5FD0A 5HDRA 2J7GA 4I9AA 1JNDA 2GZXA 5RUBA 4HYWA 1K8YA 1UWTA 2ISWA 1GEHA 1XIDA 2EF9A 1G4EA 3PUOA 4QR6A 2X09A 3RPMA 3KWSA 4O0KA 4DQWA 1KBJA 4U5IA 2XIMA 3OQ8A 3WLNA 4ECXA 2E77A 3T6CA 5JIWA 4MDPA 4ED8A 4OBRA 2XN0A 3TA6A 3P81A 8A3HA 2WMKA 3BMWA 3TYDA 1HJSA 3V0TA 3TLLA 2NT0A 1GOMA 3S3GA 3Q94A 4QWEA 1HKMA 5G4EA 3ZZ1A 3Q8QB 3PUGA 1K8CA 2Q8ZA 3TSMA 4FB7A 4LUSB 4DJEC 3GKFA 1VQTA 2NQZA 3N2MA 1T41A 1XCXA 4JTCA 4IR1A 4BZYA 5I3FA 5IOBA 4X9YA 6PTDA 1EWDA 2CKSA 4R53A 4G5DA 1XW8A 3F4VA 1XIMA 3PBUA 1IWPA 3SBFA 3EMQA 1DORA 3NZQA 3UNTA 3AUJA 2J4GA 1J0JA 5HQEA 5C5YA 4V28A 2ZRVA 1J0ZA 3W9ZA 2EPOA 1ZFJA 3EDDA 1RXOB 3MUY1 4H83A 4W86A 4WR3A 3LM3A 2CU0A 1KBLA 3N2BA 1X6UA 1HO4A 1SM9A 3GG8A 1XLIA 4R85A 3H54A 1H7XA 3FJNA 2DQXA 4I9MA 4AYGA 2Z29A 4Z2HA 1HL8A 4DO5A 3G22A 3CIWA 4RXGA 4YIWA 2J8TA 1R47A 2XGPA 3M9OB 3A47A 2R1PA 5KFHA 4UUIA 4YYFA 5KFMA 3SCPA 3GDRA 1W1B1 4JTAA 1S39A 3UZZA 1KQYA 4ZO6A 1EKOA 1SZGA 3TSBA 4BWLA 2PA6A 5H8UA 1F73A 3TN4A 3KRUA 2WMFA 4XQ6A 4AQLA 2UY3A 3HA1A 1X7FA 5KZMA 1EDTA 3RCNA 3W37A 3CHDA 3TA9A 4M81A 3VPLA 1XISA 4QW9A 4FF7A 4HU8A 3CUHA 1CGWA 3WK0A 1C29A 3N6HA 3WD1A 1XX1A 2XIQA 3NEVA 1FP8A 2E6YA 3E74A 1SO6A 1AD1A 2ZVIA 3DUGA 3PB0A 4FP1A 3EWXA 1GQLA 2JQXA 2J78A 4AD5A 4GE8A 4XKYA 1ALDA 1OFOA 4XSLA 3KWXA 2DZSA 3DAQA 3WLTA 1L8PA 5H8MA 2QYGA 4LX4A 3TYUA 1OFDA 2D73A 2O7SA 4OGZA 3KOFA 2X7VA 1ZP3A 1W32A 1WOBA 1KRMA 3W84A 4F4YA 3F2BA 2PGFA 1VPYA 1W54A 4QDMA 1CZ1A 4M7TA 1NIUA 4F4ZA 5KG4A 2PD5A 3UYCA 3NGFA 1B9ZA 3CL7A 1MEHA 4MZ1A 4DJFA 3I4KA 3WQ4A 5TBOA 2OGJA 1C7TA 1TPB1 1A5UA 3LN3A 3M64A 1RUSA 3NZGA 3C2FA 1QVBA 1DP0A 3OIXA 1A49A 2OXNA 2QW5A 2UVRA 4NL1A 5AC6A 3T08A 3DN5A 4QXIA 3CZLA 4V27A 4IICA 3OQEA 2GQ3A 1DQUA 3QM3A 1JUBA 5DMLA 1R2RA 1XBVA 3QV8A 4TIMA 5DG8A 1M68A 1MQRA 3CUIA 3HQPA 1Q6OA 1V3JA 1Z9AA 4NY2A 2P1FA 5D8ZA 3AYTA 4GZIA 1EUAA 3AOFA 4NNBA 3EDFA 5KFZA 2FGLA 2GQ9A 1S5WA 1D8CA 3DXIA 3PW4A 4JEJA 2Z1XA 2GJXA 4O52A 1W56A 1DIOA 5AVNA 1DKWA 3O07A 3N4AA 4GIEA 1DJYA 9XIAA 4MIMA 4H04A 2QCFA 3PB2A 3PZVA 4QE4A 3P14A 4CN4A 3TYBA 2BODX 4QP0A 1EA0A 3W1QA 4OHQA 3WNKA 3EPNA 5L1IA 1JPMA 2EAWA 3NPXA 1KFCA 1H1YA 3DDMA 1N55A 4M8UA 4N4PA 1B3XA 1CIUA 3NSNA 3JU2A 3GVVA 1SW7A 5C9XA 1OWQA 3WKZA 3U6WA 4IPLA 2FLIA 3BC9A 3M43A 1KFJA 1TJ1A 4G1NA 3JS3A 3NSXA 2E0PA 5DQIA 3L4UA 2NT1A 4JDBA 3G1FA 1IE7C 5D05A 4Z2JA 3EX2A 4M82A 3OBKA 1A5NC 3BO9A 4BK9A 2NQHA 3AC0A 2VFDA 3BLKA 5DCEA 4WSJA 4O0ZA 4O14A 4UTLA 1LOLA 1R85A 3KEHA 4C1LA 1JQVA 1HJUA 3GTHA 4LOCA 3W7LA 1Q2RA 1ZJBA 1XUZA 5I23A 3DOPA 2BQRA 5DMNA 1FWHC 1W9XA 4QG6A 4O13A 1S10A 5LNSA 1MFUA 4D6JA 1FA2A 1YDVA 2D0FA 4RW5A 6REQB 2POTA 1DJXA 5AC5A 4KWVA 2DT0A 2XCAA 1RCOB 2J7BA 2C7FA 5HXMA 3W87A 3AIEA 4CU7A 3BXWA 2VVNA 3CUXA 5E0KA 1CCWB 1ISWA 3QVQA 3G3DA 2OLHA 1WB0A 3CQ0A 2W9MA 3BZJA 4BQ5A 4DJEA 1OC7A 4AAJA 3DYPA 3LHUA 1GUVA 3N13A 3KOYA 5HPCA 2WQPA 3JW7A 4YHEA 4U5KA 3GH4A 4DAIA 3BE7A 1J8VA 3ARUA 3PF3A 4Q4MA 3SQLA 5KMYA 2AAMA 3BLEA 4TX6A 3IJQA 4JFVA 3W1LA 3AI0A 3L23A 4AIEA 2WANA 1A80A 1S1PA 3BAIA 3VGEA 4I6VA 1W5NA 3QR0A 3RFAA 1UW9A 2PPGA 1DWFM 3KL5A 2HS6A 4PCNA 1O7AA 4DUOA 4O1DA 1J79A 3VU2A 3TH6A 4CD6A 4YVPA 4XO7A 4ZMGA 2FH6A 3AJ7A 1Z6KA 3WG6A 1VCVA 3HFYA 3CYJA 3MSDA 3QOKA 1Q6QA 4PBEA 1OY0A 3H4GA 1EJUC 3OZPA 3G6VA 5AKQA 1GOQA 1YTEA 1IT0A 3V7PA 3I6RA 4UFKA 2I17A 3CBWA 1E6QM 2VC9A 4WY0F 5ABGA 1EWEA 4FI4A 3UPWA 2EPKX 5FA5A 3OHAA 4ED2A 3B0VC 3U5UA 2FYMA 3GILA 1ZTVA 3IANA 4HA1A 5G2HA 4I9JA 1ZAHA 4FX6M 3BLFA 5DRIA 4LAKA 3V1HA 1BSIA 4IL0A 3K8MA 3B06A 1W8SA 2ZDSA 3TVAA 1T99A 1OFQA 4HJFA 4MB1A 3Q2DA 2E67A 3L4XA 1ICQA 1FXPA 1W9PA 1EO5A 3KHGA 5HMSA 4AH7A 2BR0A 5KSWA 2WNQA 3GVWA 1QI4A 4KETA 4PRWA 4CNTA 4I8DA 4FS2A 4KH2A 3H2OA 4CQDA 2V3EA 4K7VA 3QC0A 3APGA 3UG3A 1XWYA 4QROA 4J9SA 4GI9A 1BGGA 4P7RA 4ED0A 4PMZA 1BYBA 2PFHA 4DM1A 4H4IA 3WH9A 4NJIA 1IEQA 2FTYA 2QAPA 3FDGA 3FLUA 2WVVB 3O0KA 3W4RA 4QG8A 3WBWA 5A6MA 3NNTA 1XF0A 1GG1A 3G6LA 1TREA 4ECLA 1CXIA 1VJSA 3L12A 3TONA 4DRSA 5KFCA 2Z1VA 4PMYA 5F9NA 4ECTA 2YGYA 3CV6A 4ZQOA 1XLBA 5AHIA 4P8XA 4AHQA 1GNXA 4AWTA 4DF2A 3HGJA 4LY8A 4ZQRA 1OB0A 4TMBA 2Y8UA 2BWGA 4LW7A 7REQB 2YSWA 4HZ7A 5HMFA 3U4AA 1PCWA 4UFJA 3V18A 1Q5MA 3MUIA 3BV7A 3KZSA 3NPVA 4AZIA 2XVPA 2QDGA 4ED6A 3C0LA 1PAMA 3B97A 3N1AA 3S5SA 3C0JA 2PODA 3S1UA 4YHGA 3SDOA 2W0UA 5HWMA 3LCWA 2BQUA 3EDEA 3WMLA 4O28A 5REQA 3ZJ8A 3H6OA 3QPZA 5KFDA 4M24A 2YL5A 1Z42A 3GYEA 1GQIA 1RALA 4YCPA 2XIBA 4KGJA 2W92A 1KBIA 2ZUWA 3PTDA 3VC6A 2C3ZA 3TIMA 1L2UA 3NXLA 2IA6A 1R9ZA 1XLDA 1R8LA 1EO7A 5A6BA 2BG5A 3NQAA 2DP3A 1JG9A 2ZBTA 2J25A 4N02A 1LL7A 4M6UA 4CN1A 1ISYA 1QNSA 4JV1A 1E4IA 4CD5A 2FGZA 1EPXA 2CIPA 4AZHA 1J96A 5I00A 2F2HA 1UWAA 1GZ1A 3W74A 4RNOA 3T5HA 6A3HA 3THAA 4E6MA 3ALGA 4HGXA 4I7UA 2ISDA 4UFMA 3NJ3A 4J3VA 5EMLA 1T96A 4UQ9A 3B9EA 5F7UA 4PB4A 2XIIA 4ACZB 1E9YB 2QT3A 4H8NA 2B7OA 5FKYA 3AHVA 3PZUA 4YTTA 5KFIA 3RLVA 2QIWA 3TFXA 3FVMA 1UD4A 3SFKA 3H21A 3G3MA 1XH2A 4ZVJA 4EXAA 1H0GA 1L0PA 2DPIA 3BAKA 4S2BA 4DBDA 5FCZA 3VIIA 1Z44A 3UR8A 1HT6A 4E38A 3O7UA 3FYYA 3VKCA 3CWHA 1H7PA 2E7FA 2ATLA 3RLGA 3IJDA 1E9IA 4L65A 4WGHA 3AWOA 3W1TA 2QVNA 3NGDA 5EWGA 1PUDA 3LCHA 1R7OA 4GABA 5HJLA 2Y24A 3FY1A 2H3DA 3F4WA 3H2FA 1DJGA 3AIVA 3D47A 2IPGA 3CZGA 2ZICA 1CPUA 1VFSA 4XBKA 3W22A 2VDGA 3OGSA 1FH7A 3OPSA 3WK3A 2D2JA 3K1DA 4FIRA 2YDRA 3WJSA 1XLGA 3G8RA 3TR9A 2PF0A 3NQDA 4MJ2A 3AQUA 2D69A 5C70A 2FPVA 1E6XM 2DUZA 3WNOA 3OIHA 1I75A 1TR9A 3LUTA 1HG3A 2EPHA 2SFPA 4TX9A 3SSZA 3CV1A 5KT7A 3CUJA 3P8IA 4KF1A 3TEVA 5FSDC 1TQXA 3D3AA 4ZSTA 4ZXOA 2B4GA 3QYQA 1Z3NA 3O15A 3ITGA 1TMHA 5KFJA 2ZUMA 4GPNA 3W00A 4JOMA 1JYWA 3P82A 1ISVA 1DXIA 4IGHA 3S2CA 4HK6A 4BEQA 3WN6A 1S3TC 3NDYA 4A8RA 3O06A 4JTIA 4Z2GA 2YBUA 1UG6A 3BICA 4FOJA 2ASHA 2VGIA 3SUSA 1PO9A 3P6LA 1BVZA 1UASA 5BWAA 1G69A 2D0HA 2WZMA 3BK0A 4TX8A 3PZPA 1OT1A 1RYRA 1VRXA 3CH0A 3MCNA 4AMAA 3VTRA 1OIFA 1TA3A 4B2DD 1SZRA 1E1EA 1X6NA 2WVUA 3B03A 2EBNA 1HF6A 2C1HA 3WL0A 1EL3A 1AZ2A 3ITVA 2I7GA 3AMGA 3IEBA 1U2YA 1NOUA 4FXJA 1WXJA 3DG6A 2IUZA 3R0KA 5DMMA 1UP3A 4TU1A 4AZ5A 3ZM8A 3MSYA 4K8GA 1RJQA 1YNPA 4RZ5A 2WJDA 1I0DA 3NVTA 2OR2A 1EH9A 5EU9A 4GZEA 4J3ZA 3SUVA 4FXRA 3TP4A 5FEPA 2G3FA 1PZ1A 1M7JA 2HVNA 5G4WA 5AC7A 1XLHA 3KRSA 3MA8A 5I79A 1FWNA 1I8JA 1V6XA 1R3TA 1O60A 1W9VA 4DXVA 1FHUA 1XYCA 3R13A 5MF5A 2J6VA 4ZENA 3LENA 3R2GA 2OOFA 2WQDA 1E1CA 2FVLA 3JZUA 4WLCA 4C6DA 4IGSA 3EKGA 4AD2A 3E0LA 4PUDA 3I65A 1UKSA 1VYRA 2WJZA 3PZMA 4H6KA 2RUSA 2H8XA 1K1DA 2VRJA 4DUXA 3TC6A 3PN8A 4J9PA 3VI2A 4Z0SA 4LUYA 4GC4A 3WQ8A 2ZUTA 2IQTA 4J3UA 1W3TA 1OC5A 2Z6IA 2ZRYA 3T07A 1CT5A 1GVFA 1B54A 1JDEA 1ZAJA 3MFIA 4YR0A 1FWTA 2TPSA 5C9ZA 4NSBA 4A05A 4Q8PA 3GV5B 4IZGA 3EDKA 4Q8QA 1ISZA 1WBHA 5LIKX 1BTMA 2ZA3A 3W07A 4JY9A 5CC3A 1S9FA 1BFNA 1N8IA 4QS6A 1A50A 1FUYA 4ZOEA 1SFTA 3GNXA 2X1RA 1IGWA 1KGUA 1XC6A 3U5YA 1N7KA 2Y5JA 2XVLA 4IIDA 3EXTA 2D22A 3EOUA 2WHJA 1RQBA 4DL6A 1UIOA 1F74A 5DT7A 4EYIB 1X38A 2EKGA 1GKRA 4YPJA 4XUGA 5DLFA 3ZVIA 4DO4A 3GV8B 2O0TA 5TF0A 3QSRA 3DFSA 3SCTA 1PZ3A 2FTWA 3VKDA 3EB4A 4XUYA 1PKNA 1AH4A 1N56A 3KBWA 2OYMA 3RITA 4X0NA 4TOQA 1JL8A 3H4DA 2VXNA 1KTBA 2J66A 1TTPA 4YN5A 3ORWA 1B90A 3U7VA 2C91A 4W9TA 3T05A 1Q45A 3IIPA 2PE4A 3S46A 2PGWA 2AL2A 4GUJA 3W1UA 3LERA 3MMUA 3HPXA 1DVJA 2HK1A 4JTKA 1VBJA 3DFOA 4UOJA 1FWIC 4XB3A 1PJ9A 3Q67A 3S6TA 4Y7EA 2CITA 4JTDA 4ADTA 3RCMA 1OG0A 3N14A 4CD8A 5BU9A 1QAPA 3ARXA 1JPIA 4B90A 4C1KA 4G9PA 1TV2A 1WNOA 1KBKA 4HN4A 2TSYA 4YTRA 2BGNE 4JHZA 3F5JA 4Y6GA 4P8UA 1M7PA 4ECWA 3W01A 3WLSA 2PLMA 3SCVA 1TG7A 1FCVA 3HJZA 3MR6A 4KWWA 4F0SA 5G2WA 5BYWA 1W1VA 2X0HA 1JEZA 4AIUA 3EYPA 2PDUA 4PULA 4ED7A 3ANVA 3VZXA 4N9EA 3A5FA 1E9LA 4OKDA 4QX4A 1K9EA 1P7TB 4RW3A 1EGVA 2J8FA 4AU0A 1RBOB 2GWGA 3MUZ1 2BDQA 5HBFA 2VZTA 2CZVA 4C90A 4AD0A 1IZKA 2EHHA 4MJMA 3RB3A 2WTFA 2RDIA 1JF6A 1EEXA 2XH7A 5CJNA 5EL1A 3C0QA 3F5LA 4LJ3A 3TKFA 4DBSA 4LUTB 4GYKA 4E8GA 4O11A 2ANUA 1JZ3A 3RBDA 2ZXAA 2R1KA 2IS7A 2FZMA 2CETA 3EPMA 2NQLA 1X97A 4I5UA 2VO5A 2WJFA 4GACA 1ITXA 4RNFA 1OFEA 1CGVA 2FPYA 2YX0A 3WY1A 4DEFA 4LEQA 3N4FA 5GJMA 1A5LC 1OX4B 3IK2A 2GPTA 2YCKX 2DH3A 3G18A 1SZEA 4FR1A 5EA9A 1V3KA 4JQ4A 1A5CA 4HOWA 4ML4A 4NILA 5CZ0A 3A24A 3UNDA 5XINA 2C1IA 1P4CA 2GK1B 1V0LA 3O6CA 3T40A 1EZ2A 4KT2A 1K6WA 2QCEA 3DFHA 1GPWA 1VFOA 1Y7VA 3ABZA 2YCLA 2CLHA 1BG9A 3SGUA 4KFOA 3WBYA 4NNCA 3IJ6A 4B5TA 4JN7A 1RBLA 3GVRA 3L68A 4ICMA 3CUGA 4H3DA 3HGOA 2INFA 4WQ6A 3CGTA 5B7ZA 3WNNA 3MV01 4PMXA 3H24A 4GYJA 2NVDA 4PL2A 2JIWA 1XDLA 3U8GA 3R7MA 4C6CA 3TX9A 3SCOA 5CSSA 3Q37A 1BRLA 1M01A 4KRTA 2ZC8A 1Q6GA 4GUFA 2NLYA 3W27A 4R9OA 1KXHA 4NP7A 3E5BA 4C6JA 3B0UX 4MNKA 1RY0A 2R1LA 1G4SA 3IJ8A 3UWEA 1LF1A 4FX7A 3WNPA 3VK5A 1KXTA 5LHFA 2DW7A 3GU1A 4FAMA 1I1WA 3ID7A 3R5EA 4HA3A 1ZJHA 1IZCA 3LSCA 1QR7A 2PTZA 2JKEA 2HQAA 2QCHA 4JQAA 3S42A 1JDAA 1QPKA 4PMDA 1XGDA 4PMNA 1E0XA 3KRZA 2OQHA 1E0WA 2W5FA 3MVTA 5GPRA 4KEVA 5LIXX 4IIEA 4X3ZA 2PDBA 1ECEA 4RPQA 1TX2A 2BXVA 1T6MA 4EWJA 2VR5A 4BF9A 1SO5A 2OT0A 1KWKA 3B9DA 3M0ZA 1WDSA 1PCKA 1I0BA 1VCGA 1XH0A 1GJUA 4CNSA 3VNJA 1PIIA 4A8IA 4G3IA 4WDUA 1OSEA 4WSKA 2W8KA 1CBGA 4H8UA 2VEMA 2E6FA 3URAA 2VR4A 3QH2A 1LG2A 4AX6A 2Q3RA 3KBSA 4D6CA 3S5OA 1VJZA 4OUIA 2PDNA 2D2GA 1R3QA 3WLQA 3CHFA 4QJ3B 1D3HA 2NX9A 3KHDA 4HTYA 1UH4A 2WC4A 3CAWA 1TV3A 3ISIX 4DELA 3IACA 4QM1A 4XIMA 1KM6A 5KFAA 4NHVA 1EF3A 4J2MA 2PWUA 4AIOA 3VNMA 4FNRA 3DKLA 4RE4A 3GLCA 2QS8A 3O3RA 1OD0A 3NYDA 3LM7A 1US0A 3B9NA 4UXDA 4Y96A 1FWRA 2OSYA 5M03A 3G1SA 1XIIA 1G9HA 3V16A 1JDDA 4NKCA 3W7OA 4LNCA 4JIEA 2R8GA 3CLMA 4QSHA 3MR5A 4PMJA 3HB9A 3RLUA 7ODCA 4LFYA 2V3DA 3WDPP 1OX5A 3KUMA 1C92A 4NQ1A 3NDZA 1XI3A 4FR6A 2QPUA 5CPOA 3TTYA 1B9BA 2YL6A 3RAQA 3OG2A 4PCSA 3MHUA 3D3FA 2PURA 5ABFA 4R9XA 3NL3A 1W3HA 2ICSA 3WQVA 3NPWA 2P8BA 1YLVA 1OYCA 2VMFA 1SYTA 2PU1A 4P8WA 2EG7A 4LVAA 2WKLA 1RCQA 3FSTA 4ZA0A 4FK9A 2ON3A 3R8HA 4C7GA 5C9RA 2Z2UA 3SO7A 4HOZA 3GZ3A 5I77A 2V3GA 1OGBA 2AKMA 3DG3A 5E9AA 3IRSA 1RA0A 3MZ2A 4U33A 1OQFA 5I3HA 4LRSA 3TN5A 3NG3A 4YL2A 3WF1A 4R8UB 4Q4OA 3G6MA 1JYXA 4H9ZA 4LC8A 1B31A 1RYSA 2GGGA 2IBKA 1ZJAA 1UPMB 2VEKA 4Q6XA 1P0NA 5JBDA 1N2VA 5I3KA 1KM0A 2IKIA 4Q33A 5JXQA 1TUXA 3TWBA 1KR0A 2E9MA 1E72M 2JE8A 1XBZA 4GXWA 3KBMA 2OYKA 4LBSA 1CGYA 4IMFA 4HNCA 2J13A 3PP7A 3VA8A 4JX5A 4ECZA 1ZENA 4HZMA 3IJIA 2GUBA 4O1BA 1P5BA 2CLIA 2EQDA 1NOWA 1SU5A 2YDAA 1NELA 2HEJA 4FNSA 1M7OA 3BOXA 3VGFA 4GH3A 4L1XA 3WBAA 3ECQA 1B4KA 4AB4A 5CG7A 2FMOA 4B5XA 3HM7A 2PRHA 3Q4DA 4ZSUA 3GZAA 3CMGA 3PNZA 4HNTA 3GAYA 3K5XA 4QWAA 2YA1A 4UOQA 4UCGA 2R8JA 1K1QA 3UXAA 3TAOA 3T42A 4Z42C 5DGAA 3IV8A 1ELSA 3AIUA 5JH1A 3SI9A 1Q3NA 1WDPA 1UKQA 1O6IA 1UKOA 1W5QA 1W9DM 5DQHA 2Z1KA 1XKJA 4Q4QA 3BW3A 3H12A 1ZHAA 5I7GA 2HXTA 3TOPA 1LCOA 1RAKA 1BSLA 1EOKA 2Q02A 3LXCA 4LSBA 1PBGA 1UROA 2BV9A 1X8FA 2E4TA 1UR0A 2ODOA 1A4LA 1FCUA 1WAUA 2LLEA 1IWBA 2P50A 1RPKA 2WM1A 2WV8A 4M0XA 3BG9A 5FACA 4IFKA 3TJ4A 1MDLA 4A8NA 2XPKA 3QKEA 1P1MA 1VLWA 1EJXC 5KFYA 3G6XA 1Q7QA 2ZZ3A 2XU2A 4PN2A 4LBRA 1HL2A 2VELA 5HA7A 4E4UA 5E70A 4CCZA 3BMXA 3GTFA 3D6NA 1X7IA 1A5BA 1ZZMA 3WF0A 1EDQA 1TJ0A 2QUMA 2QF8A 3IGXA 2ATMA 4TUFA 2BVTA 3QY8A 1EHNA 3VC5A 1Q8JA 1RD6A 4HPJA 1IEWA 4GX8A 2J9XA 1M03A 2BY1A 3ZSTA 3TCSA 2A3EA 4IT1A 2C16A 3E0IA 2CBVA 3AHTA 3WJZA 3M16A 5F2GA 2YW3A 3O6DA 4ZB5A 3SEPA 1ODUA 3CQIA 3QV7A 4M7SA 4ADSA 2G8ZA 4OFCA 1GOIA 2VZSA 5C7VA 1O5KA 5FEXA 6ALDA 3TC3A 3FK4A 4GIYA 5DMYA 1XHGA 3F4DA 3DFQA 4MJ4A 3WEMA 2BX7A 1K8ZA 1YE6A 4IP7A 4MWAB 3VIOA 1I6NA 3TK7A 2MANA 1GVYA 4XWUA 1J2BA 1U30A 1IEVA 3LYEA 3VOJA 4FSAA 2PTWA 2WVSA 3LGDA 3R58A 4JPGA 5JIPA 2J88A 5CJMA 2XFWA 4J9MA 2DPEA 2REQA 3WLIA 2Q8LA 4NZCA 4EIVA 4ZTYA 3S4TA 4YR2A 1RVGA 4IL2A 3AS3A 5C9WA 3EOOA 1KTNA 1EP2A 4RDYA 3N9RA 2OQYA 3LOTA 3RAOA 2YPIA 1ME8A 3C5QA 3LU2A 1JNEA 2DW6A 2OELA 4BI6A 2G5WA 2NV1A 1V79A 4IIHA 2ZXQA 3E02A 1CX9A 3QFWA 2X41A 4Q8MA 1EJ7L 3T44A 3Q8SB 2C71A 1UR8A 3BCJA 4FNUA 1B5TA 4TV5A 3MCOA 3KOXA 1BXBA 5F2LA 3E0VA 3A4JA 1KB3A 3BUVA 4MWAD 2W63A 3PTMA 2W3ZA 3W23A 2PU0A 3EAUA 4DYJA 3VIFA 5HULA 2G4JA 5BU6A 4ZQCA 1HKJA 4GZJA 4DWDA 4EBCA 3MFHA 1GZJA 2JKAA 3MP4A 4LAUA 3RX3A 4J9QA 3WENA 1LRQA 4LPCA 4IQJA 3DKJA 4JIQA 1GONA 1HGYA 4TQSA 1J01A 1HKIA 4EKJA 1A47A 4XVEA 3DHUA 4FS1A 4EXBA 4WXYA 3CUFA 3TNOA 3HBLA 1A5OC 3HJEA 4GC7A 1JCNA 3D5HA 3GR4A 3H2NA 2VNCA 1W9UA 3MQTA 1K7EA 1KKOA 3W7IA 4DI9A 3FJLA 1B3YA 4RLIA 1BKHA 1AJZA 1UBSA 1UR1A 4NXKA 3U7BA 1G0CA 3VILA 1WE5A 5CQ1A 3IJ7A 3KTSA 1AFSA 2C2DA 3M1ZA 2C6QA 4GX9A 3HQ1A 2D1ZA 4RU9A 2GGIA 1OABA 1TFVA 2J47A 2VQUA 3AIQA 2WZIA 5GJPA 3TMQA 3DGBA 3FXYA 3ZR6A 4A8LA 4UQBA 5TNVA 5T14A 4GO8A 2G50A 4ZFCA 2ZDRA 4TO8A 3LDVA 4XX6A 1E6ZA 3G1XA 4HCDA 1W8GA 3SGGA 3CEUA 1Y5XA 3T0AA 4D2JA 5AYZA 3LCXA 2R8WA 1CENA 4US6A 3STPA 4KW2A 4P2VA 1PE1A 3FAWA 3ZWTA 4XKYB 5CC6A 4O53A 5AHEA 5A1AA 3WQEA 1V6TA 2GLKA 3ATZA 4FLOA 4K7YA 2V6AA 3EWUA 3EDJA 3N18A 4QCFA 4MVAA 1YIXA 1V7AA 1KW1A 1XD0A 1SMAA 1TSIA 3C8FA 3AFBA 1JRCA 3PNUA 3VIGA 4Q4PA 4PYSA 1M9HA 3MHFA 1H7OA 4GKTA 4HOXA 1OYAA 4HMDA 4UMCA 5HR7A 3AICA 3STGA 3N17A 4GBUA 3H53A 1OINA 4F0LA 2KAUC 4YVVA 3USZA 1FRBA 2QVHA 4F2TA 2VUYA 4RDZA 3OBEA 4JV0A 5IFTA 2CHOA 3A3HA 4Z2IA 4JS3A 1FDYA 5DCDA 3DHFA 1WO2A 2P9BA 2A6NA 2EJAA 1VFTA 5A8QA 3ITLA 1AH3A 3CHVA 1OFPA 1J0HA 3K30A 3GRIA 2R82A 3PTKA 4F0MA 4MB3A 5H6HA 4K39A 3TJIA 1OCBA 4XD5A 3RRXA 1JD7A 9CGTA 2PUZA 2QMJA 1M65A 2HXUA 1Z89A 4REQA 2RDUA 4P7NA 2E9LA 3PZOA 2VDIA 5AZ0A 4DY1A 2A3CA 4CVWA 3BPWA 1ECQA 2VA2A 2RH9A 2J77A 3RB0A 3A23A 1TPWA 4DJFD 2GOUA 3IVUA 2C13A 3FSUA 3DHPA 1Z32X 3RAXA 5JQ9A 2E6DA 1TRIA 3ZFHA 3GVQA 4LUIA 1WKEA 2XSAA 5HPOA 2PDQA 2A85A 2VTFA 3NOEA 3LMYA 4E3VA 1MNZA 6TAAA 3W72A 5BXPA 1OGSA 1DQWA 2ZZ7A 1XLLA 4G56A 2NZLA 3L21A 2Q8XA 1VCFA 2IKJA 2JEQA 1CI1A 1MXDA 4JFWA 5CEWA 3WMSA 1V0KA 4IJRA 1FOBA 3HMJG 1QI0A 1I4NA 4DVOA 2NVCA 1SPQA 4CNPA 3T2QA 2CBUA 1IWAA 3RNDA 5IRPA 5A6AA 4O8AA 1TPH1 1K7XA 4R7WA 5KFUA 5T8GA 3WQOA 1FFRA 2V2CA 4PSPA 5FSEC 4NAFA 1BWVA 1V6WA 1JVNA 1RQHA 1M53A 3W6MA 1LBLA 1NWSA 4GVFA 3SY1A 5BRPA 1UC4A 3ME3A 1UKPA 3JR2A 2FB2A 3G24A 1LL4A 3R25A 4JTTA 3DX5A 2PDIA 2V5DA 1PKLA 3LEPA 1AJ0A 3OB8A 3HPSA 3C8NA 5GNYA 1LLOA 2INEA 2WJEA 1REQA 3HZ3A 3M07A 4ERAA 4NJJA 3SB0A 4AF0A 3SQSA 2PAJA 3G2GA 2CLPA 3TW9A 2R6OA 3SGZA 4EPDC 1WPCA 4Q32A 1T3NA 3E96A 4FPSA 5D2VA 1QXLA 5I3JA 2R24A 3LZ5A 2VX5A 2XWEA 3K2GA 2OEMA 3BVJA 3VD4A 3IAPA 1S2WA 1HKVA 3GIIA 1E4NA 1VC4A 2FMNA 1FWJC 1N82A 3BLIA 3T4CA 3LRMA 3LI0A 2ISVA 3WUBA 2UV8G 3ANYA 3CC1A 1K4GA 3RR4A 3OZYA 2ONEA 2C22A 1FHLA 3CWNA 1OD8A 4F48A 3WMCA 4RZ6A 4ZE5A 2P88A 3M46A 1W3IA 1XBYA 1PEZA 5F2IA 1TPVA 4WEVX 1UD8A 3RU8X 3SN4A 1TZ9A 4IFRA 4JL2A 3G1RA 2WXDM 4HYKA 3AIWA 2OZ0A 4JTFA 2G4FA 2Q71A 4EX4A 3GWQA 4ORIA 4QJ1A 3VIPA 3S5ZA 3HURA 3K8KA 2BHYA 4LV4A 1T7LA 1E0UA 1L9WA 2ACQA 2PCQA 4DJED 1B3WA 1QHOA 1ICPA 4QDPA 3NXFA 1XLJA 2OKOA 2ESCA 5CSRA 2DGAA 3SFWA 3VM7A 6TIMA 2BB0A 1UMYA 3BL3A 1GOOA 1QPQA 1WCGA 2CBIA 5A95A 5KITA 3CYVA 1SO3A 5K2ZA 5KFTA 5BNKA 1O4UA 3LSBA 2DSZA 2W9BA 3G1DA 4C60A 3LPOA 3PZ9A 2CKRA 3URBA 5M17A 4GO9A 3LPPA 5C0QA 3M5XA 3IK4A 3WH8A 2PWHA 3MWCA 2B0MA 2J27A 4X9SA 3ZJKA 3P74A 1JQXA 5ECVA 5AYIA 4JFUA 2YLLA 1R3SA 1LG1A 3SW6A 3M5YA 1GK8A 4EOUA 1YTDA 4HIBA 2C1GA 3BDKA 4XBSA 4UFHA 2CZDA 8XIAA 4ES4A 1X1OA 1UR3M 1XDJA 4AVOA 1EJVC 4GC6A 3UA4A 1TZ7A 4LYQA 1XRFA 3GIPA 4Y9AA 4XO6A 1CGUA 2QPSA 5AZ1A 2FZNA 4YMZA 1XLKA 4JXCA 2AMXA 1ZGDA 5C55A 2GJLA 1RP8A 4LGXA 1F8MA 3DEQA 4PMQA 3GO2A 3W75A 1TIMA 5EYWA 3H4BA 3NQGA 2QV4A 3W2UA 1YX1A 4G1KA 3FJ6A 4CN6A 2X1SA 3NZ1A 1T8XA 4HK5A 1VBRA 3W1MA 2C19A 4KCVA 4WJEA 5EDWA 4MNLA 1XBXA 2Q3OA 2NWRA 1OT2A 3AWNA 1CXKA 3RM9A 3U48A 4ED1A 1XLFA 3BAWA 3P80A 3PJTA 4JX4A 1W31A 1IEIA 1PTAA 3ES8A 4GUIA 3W82A 5KTLA 4UBPC 1J0YA 3P62A 1EC9A 4WVXA 1PDYA 1YTKA 3UJFA 4HJWA 5EWEA 2R8HA 4J27A 2QPXA 3W0KA 2A6LA 4EXQA 4KMQA 4WK9A 1VH7A 3VIJA 2VEPA 5REQB 1TV4A 3T5KA 3L65A 2BASA 3NA8A 2ZZ6A 5CPTA 1UUQA 1SW0A 3CTLA 1P6CA 4GHRA