1XRFA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
423
structure length
363
Chain Sequence
WMLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLDRLALIEGVKRGIIDCFATDHAPHQTMPGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords Dihydroorotase
total genus 127
structure length 363
sequence length 423
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrfA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrfA02
1UBPC 3C86A 3TN5A 3CAKA 3LY0A 3ID7A 3GTHA 2XIOA 4CQBA 4DI8A 3LS9A 1A5KC 3S4TA 2GOKA 3IRSA 2PAJA 4GYFA 1P6BA 3AU2A 3GU9A 2PUZA 4CNUA 4GY7A 3GTIA 3AU6A 5HMEA 4C6PA 1ITUA 4IGMA 4R88A 1ZZMA 4I6KA 4LAOA 3OU8A 4IFRA 3WMLA 1ONWA 1M68A 1NDZA 4EPKA 4IFKA 2HBVA 1R9YA 2YXOA 4RZBA 3WYZA 3AUOA 1FKWA 4EPEC 3E0LA 3RCMA 4J5NA 1DPMA 3QY8A 3MDUA 3PANA 4UB9A 3MVTA 4CNSA 2O4MA 4ERAA 3K5XA 4XAGA 3QGKC 2OOFA 4NI8A 2AMXA 3ITCA 2OODA 4C6EA 3MPGA 1E9YB 1UMLA 1WXYA 3B0XA 4IQJA 1XGEA 2OGJA 4CNTA 4IH3A 1ITQA 1RAKA 4XD5A 4R7WA 5CH9A 2QPXA 3PNUA 4GX8A 3E0FA 3LSCA 3KM8A 3NQBA 3RN6A 2VM8A 2YZ5A 4C6KA 4CQCA 1YBQB 1A5OC 4LAMA 4C60A 1FWEC 3OODA 4IG2B 3RHGA 2Q01A 1FWIC 1EJSC 3T81A 4DNMA 3OJGA 2FVMA 2Z24A 4DLMA 4IG2A 5E5CA 3ICJA 4KF1A 4ERIA 4H9VA 3OVGA 1KRMA 4XAYA 4LCSA 2DVXA 3BE7A 3ISIX 2D2GA 4ZSUA 4QRNA 2Q09A 3E74A 4ERGA 3B40A 4LANA 3N2CA 2FVKA 1S3TC 3R0DA 3E2VA 1EF2A 1XRFA 2FTYA 2FTWA 4IGNA 1QXLA 4RE0A 3FDKA 1P6CA 2QVNA 3O0FA 3OQEA 3F2BA 2FFIA 4KEVA 4C5ZA 3QGAC 4WVXA 3A3WA 1BF6A 3FDGA 4XD3A 4GBDA 2GSEA 1I0DA 4V1YA 2YB4A 3IV8A 2P9BA 1K6WA 2HQAA 3URAA 1V4YA 4H00A 4KEZA 1A5NC 1FWGC 2ICSA 4UBPC 1KRBC 2WJDA 4XAFA 2D2JA 3IJ6A 1UIPA 4WHBA 3OOQA 5LXXA 4C6OA 1A4MA 3URBA 3T8LA 4V1XA 3GG7A 2F6KA 3GUWA 2DVUA 4QSFA 1FWDC 1YRRA 3NEHA 3URQA 2Z27A 2VC7A 4KERA 3WZ0E 4C6NA 2D2HA 1NFGA 2VHLA 3TN4A 1XWYA 3IGHX 2HBXA 1EJTC 5A6TC 2QS8A 2R1NA 1K1DA 3MSRA 4DI9A 1GKQA 5AKQA 3V7PA 2BGNE 4HK7A 4I6VA 4ICMA 4MUPA 4DZIA 2BB0A 4RDWA 1PO9A 3GGMA 4ZSTA 1FWAC 4C6IA 1RA0A 5HMFA 4H9XA 4QROA 1EJUC 2ZC1A 4QS5A 3PNZA 1FWFC 3UR5A 2R1LA 4J35A 4IF2A 4L9XA 4B90A 3EWCA 2GWGA 4B3ZA 4H01A 3GIPA 4LAKA 3UR2A 1FWCC 4HK5A 4BY3A 1VFLA 1ADDA 4XAZA 2Z25A 2O4QA 1EYWA 4NG3A 2OB3A 3F4DA 4C6BA 2VC5A 3CS2A 4HA0A 4IFOA 1PSCA 1NDYA 4EP8C 4C6JA 1O12A 1V51A 1RJPA 4DLFA 1R9XA 1J6OA 3F4CA 2R1PA 3MDWA 2AQVA 4HK6A 4PE8A 4F0RA 4D8LA 3NURA 4KQNA 1EJVC 2KAUC 2VUNA 3DCPA 4PCNA 3LSBA 1NDVA 3LNPA 3TNBA 3EGJA 3A4JA 4AC7C 2ANUA 2EG7A 4GX9A 1J6PA 2Z29A 2Z7GA 1GKPA 3GU1A 2P50A 4C6DA 4PBFA 3GIQA 4H9YA 2GZXA 3GTXA 3TN6A 3UF9A 2R1KA 1GKRA 3LGGA 2Z4GA 5G4HC 3E38A 2HPIA 4H9ZA 5FSEC 4C6LA 2PLMA 3QY6A 4BJHA 1A4LA 1YBQA 4C65A 4EPBC 4XD4A 1K70A 3O7UA 4RDYA 1RK6A 4GY0A 4R85A 1RK5A 1A5LC 3IPWA 4GC3A 2VR2A 4XD6A 4EPDC 4H9TA 3LA4A 4CEXC 4G7EA 1HZYA 2Z00A 4KETA 3K4WA 1YIXA 4LFYA 1YNYA 1POKA 4PBEA 3EWDA 1KRCC 2UBPC 1M65A 3T1GA 4E3TA 2Z2BA 4C5YA 3JZEA 3FEQA 1KCXA 3PAOA 2HPMA 2UZ9A 4Z42C 1RA5A 3MVIA 1EJXC 2WJEA 4CQDA 4DZHA 4GK8A 3PBMA 1WXZA 4BKNA 4GZ7A 1V7AA 3A3XA 3SFWA 4DYKA 4F0LA 3S2MA 3GRIA 3B0YA 4G2DA 1W1IE 2OQLA 3F2CA 2RAGA 2PGRA 2CZVA 2YB1A 1UIOA 2P53A 3HPAA 3LU2A 4JOMA 3RYSA 2ADAA 4KEUA 3UBPC 2AQOA 4WGXA 3UPMA 4C6CA 3LGDA 3IARA 1E9ZB 4C6MA 1A5MC 3SO7A 3HM7A 4B92A 1FWJC 2E1WA 2HNHA 1FWHC 3D6NA 2EG8A 4LH8A 3GU2A 3ORWA 4DIAA 4LEFA 1FKXA 2PGFA 1PTAA 4GOAA 3G77A 1R9ZA 4H9UA 5FSDC 4YIWA 3S2JA 3S2NA 4RDVA 2Z2AA 4QTGA 4LCQA 4J2MA 1I0BA 3MKVA 4G7EB 3K2GA 3MJMA 2I9UA 1ONXA 1FWBC 1KRAC 2E25A 1RJRA 4DO7A 4KIRA 3S2LA 1IE7C 2WM1A 1JGMA 4GY1A 3URNA 1O5RA 3CJPA 4QS6A 2QT3A 2Z26A 4L6DA 1J5SA 1P1MA 2Y1HA 1EZ2A 2Z28A 4IFKB 3F2DA 3IACA 1J79A 2DVTA 3DC8A 4KESA 4NP7A 4B91A 2EG6A 2W9MA 2GWNA 2I5GA 3DUGA 4H9MA 2R1MA 3QY7A 1M7JA 3E3HA 3TN3A 1QW7A 4INFA 1EJWC 1YMYA 4C6QA 4GXWA 2WJFA 1EJRC 1V77A 1XRTA 4F0SA 2G3FA 2IMRA 1RJQA 1PB0A 1V79A 4AQLA 4LCRA 4HJWA 4RDZA 4P5UA 4PCPA 4TQTA 4M51A 4CEUC 4C6FA 1POJA 1NDWA 4LALA 3MTWA 2A3LA 5HMDA 3HTWA 3GTFA 4OFCA
chains in the Genus database with same CATH superfamily
1W3HA 4F48A 1J12A 3B8DA 4DRSA 1GZGA 3NQEA 5LSMA 1JYWA 4JX4A 1XCXA 3GTHA 2ZWYA 1TJ1A 3UQNA 3S4TA 1XLKA 2RFGA 4PUKA 1Q5MA 4XUYA 1G6CA 3VKJA 3VC5A 5CSYA 3QEZA 4LAOA 4QLKA 1UP3A 4FIRA 3H4GA 3B04A 2QDEA 4RE4A 4D8ZA 1T8XA 4AC1X 4NU7A 4ZE5A 1UZHA 2CWNA 3K4DA 3TV8A 4MJMA 1IM4A 2CKRA 4FA3A 5LIYX 3S47A 2A85A 3I3DA 3ZLFA 1XLEA 3EMZA 3V5OA 3RB6A 3H21A 1E56A 3B0XA 2HE8A 5AYYA 3TMLA 8CGTA 3BJFA 4LUTB 4QE5A 3JS3A 5EMJA 2D0HA 3ARXA 4Y9OA 2QPXA 1ZJBA 1W31A 3BLKA 1HF6A 4G1KA 4UOQA 1V02A 2F7FA 5DY2A 2TSYA 2C6QA 2OWWA 1C29A 4Y7EA 3VM5A 4S2BA 1F3XA 4UTWC 3FJNA 1RPXA 3SRKA 3VIKA 2Q02A 4Q33A 4XBSA 2W27A 1UKPA 4ECSA 4XZLX 4XAYA 2ZXBA 3BQ2A 1PDZA 2W7PA 4GKTA 4ZR8A 3HB9A 4XUGA 1UASA 2QCDA 1UR8A 3TW9A 1GW9A 4JL1A 4BQ2A 4Z2IA 2XFYA 2D1ZA 1G9HA 1VBUA 4D72A 4MNMA 3ZOAA 1BF6A 1PYFA 5EU9A 3KLKA 3W2UA 3SADA 2WHKA 4MM1A 2OVLA 3GDTA 4V1YA 5M3WA 2W9AA 5LNRA 4LVDA 2WKJA 5HXMA 3C0LA 1EC9A 3WLSA 1J0YA 2NWSA 1QI0A 1KTNA 1AW5A 1P7TB 4UBPC 1IIHA 2CHOA 4ZOEA 2VT0A 3ITLA 1OC5A 3HFYA 3RB0A 3RO8A 4YR2A 3DBNA 3WFAA 4NJJA 3S6DA 4PEKA 1W8SA 3N9RA 3GIMA 3RBEA 2J13A 1YDVA 4RNIA 3KLLA 4KERA 3DFYA 2GJXB 3FAWA 2JALA 4O3OA 1JCXA 2H90A 4DL3A 1ZRQA 3MSRA 4XX6A 4MOZA 2R8HA 1K9EA 2PP0A 2ZKMX 4ZXOA 4I7VA 4HOWA 2UY3A 2X7WA 2ZUSA 1MO0A 4PTXA 2NX1A 4OBSA 5FA5A 1KKOA 3UR5A 2V0TA 1S2VA 3IJ9A 5T26A 2DSWA 4B90A 1AG1O 3PTMA 3VNZA 5I6SA 3VMPA 1JZ3A 1MFUA 3VNKA 4IPLA 4BA0A 3FA3A 2OX1A 5C6MA 1PSCA 3CEUA 1OX6A 3VZYA 4DLFA 5ABGA 3CWHA 2TMDA 1EPVA 1EP1A 4RZ4A 4ZQNA 2J9ZA 2AL2B 1TA3A 2ZTKA 5C9XA 3HG5A 4HGXA 1EF3A 3W81A 2QDHA 4XZHA 3TVAA 2WWDA 4XAPA 3PC0A 4PBFA 3PG9A 3MR6A 5FKYA 3WELA 5CGMA 1GVFA 1ZALA 2GGGA 2QUMA 4GVHA 4DELA 2ZX9A 3AJXA 2JGYA 1UD8A 1HL9A 4Q43A 3CT2A 5KFLA 3MUXA 3VGEA 2HMCA 3EOOA 2RJGA 4M80A 9CGTA 3DDMA 2QMJA 2RDUA 4IP4A 2QIWA 3CAWA 3V0SA 1YNYA 2ZUVA 4RLIA 1FHLA 1E1EA 4H8HA 3DHDA 3L4ZA 3Q65A 2BVYA 3Q94A 4UTUA 1JYNA 3LNMA 5HWNA 4ADTA 2FGBA 3C4UA 2GQ3A 3JZEA 3FEQA 2I5QA 5HWMA 4Z42C 1ME8A 3THAA 4QIUA 1S9FA 1BTCA 3W0KA 2EQDA 1KBJA 3PK7A 1DIEA 3AC0A 3ARTA 2ISDA 1BXBA 3PBMA 1C8VA 3AISA 1OWQA 3S1XA 1ZGDA 4WLCA 4ASTA 4F0LA 3LUTA 1YDOA 5CPTA 3GXMA 4AW7A 1EXPA 1Q13A 1QW9A 1U30A 2PF0A 1OX5A 2W9CA 5J5DA 4HA1A 4RL3A 1WDPA 3UBPC 4L4MA 4IMFA 3PZ9A 2PBGA 1S38A 4GZEA 3B3DA 2ZRVA 4FNRA 4C6MA 3LCWA 2E68A 4AU0A 3BGJA 4Q4OA 3IJDA 5BOFA 5JIPA 4O8RA 4GUHA 4BF7A 4O28A 2E9MA 1WZAA 4GNKB 1R3WA 4LS0A 3WLOA 2E28A 3TTOA 3GIIA 3W28A 1R9ZA 3B4YA 1GK8A 3D3FA 1ME7A 4RDVA 4LYRA 3NQFA 4KWVA 2H3DA 5D02A 3D3AA 1X6NA 1LLOA 1LBFA 3OLIA 5G4WA 1BYAA 3PZQA 1GONA 4G6CA 1K8YA 3TQ0A 5JQ9A 1CBGA 1S5NA 3NO3A 5E0CA 3T2OA 1I1WA 4DBWA 4PRRA 3BW2A 1EL3A 4AYGA 5A94A 5HJLA 2PWGA 1ZHAA 3QZ7A 4MWAB 1EZ2A 4TVUA 4A8IA 3OO2A 4QISA 4LVAA 4H6EA 3MO4A 4U28A 2WCSA 3PZPA 2H9AB 3SSJA 1OEPA 4OBTA 3RGTA 4S1FA 1PV8A 3OZOA 4CEUC 4CQAA 3W1RA 1TKKA 3QTPA 3MTWA 2ZUMA 4J9LA 4IHCA 2GJNA 2A5HA 2EHHA 4DUOA 3ID7A 3W01A 5H8MA 4JL2A 4HD5A 1E3ZA 5PTDA 4US5A 4PMZA 4DI8A 4QXIA 4H4IA 1Q6DA 4GYFA 1JGIA 1ZP4A 3VM7A 3ZVHA 4ECZA 1CGXA 2WWCA 4S3AA 1XYAA 1F6YA 3V5CA 1UKQA 7XIMA 2QDDA 4HYRA 4G1NA 5AECA 1ITUA 4MAZA 4CD8A 1NVMA 5KZMA 2OZ0A 3BGAA 4IFRA 3LPPA 1W5MA 3CTTA 3WMLA 3GR4A 1EO5A 2DEPA 4LWWA 3UERA 3UJSA 4IFKA 4QEHA 2GGEA 1VJIA 1PIGA 4HHLA 3WYZA 1KLZA 3EX2A 1R3TA 5ENLA 3DFTA 4J3UA 4S23A 1EFZA 4EXQA 3N9SA 3KX6A 1ICSA 4OE7A 5GQBA 1FBAA 2ZWZA 1BG9A 2QCDB 3PJUA 3WQCA 2MNRA 1UWTA 1S5WA 4J9QA 2VQUA 4QLJA 5K9XA 2DSUA 1TWDA 4O0QA 4HPXA 4YVVA 4RZ6A 3TYDA 1B9ZA 2FYMA 1A5OC 3WENA 2F9RA 3VCNA 3KVKA 2Q01A 5EKYA 3Q67A 2AMGA 2GQ8A 2VZOA 3T81A 4EACA 3EPGA 2DGAA 3GXNA 3N9KA 1JFHA 1AQHA 1QNOA 3B9AA 2WPBA 4O10A 1RP9A 4HHPA 1OFRA 3VTRA 4AXNA 5KITA 4YWSA 2IUZA 1ODZA 5I07A 2XSAA 3FY1A 3N2CA 1KO0A 2V5BA 1V8EA 2D3NA 3R0DA 1PZ0A 2FTWA 4QCEA 5KFGA 1QXLA 3AOFA 4IRCA 1MW3A 3CL6A 3RX3A 3O6YX 2VGIA 3I65A 5FEXA 2EJ1A 5CPLA 4BF9A 5BNKA 2JEGA 3ZS4A 3S1WA 2YBVA 4QWAA 1E43A 5EA9A 4H00A 1T0OA 1Y8BA 1PAMA 1Q6OA 1UR4A 4ZO8A 5KFFA 1DQUA 4UQEA 1KM0A 1UZ4A 3TUUA 2DZUA 4DZAA 1UD3A 1AD1A 1J0ZA 3WF1A 1BFNA 2IQ0A 3ENLA 1KFJA 5BRBA 5IBXC 3IN5A 3W7OA 4JGDA 3CL8A 2NV1A 3TN4A 4LJ3A 4E8DA 1AJ0A 2HXTA 3TFXA 2QS8A 1E0WA 4AIOA 4J9PA 3ABXA 2WSPA 3SCRA 3NJ3A 1ZS2A 3UEQA 4OBRA 3H23A 4DBEA 2Y62A 1WAWA 3DFSA 3Q8SB 1B0IA 4CN4A 5HMFA 1XHGA 3I6RA 3AJ7A 1DE6A 2GDQA 3CUFA 3VKDA 2YCIX 2GWGA 2ZRZA 1DWGM 3BQ1A 2PDIA 5D2XA 2VA3A 1GQIA 4B2DA 1TZZA 3GHTA 4HK5A 2JIEA 1XIIA 2O4QA 2IMWP 4UIOA 2ZYFA 4S3GA 3AMGA 3UETA 3QLDA 1JZ2A 4J3SA 4D71A 1J6OA 3TC6A 2AQVA 4HK6A 1WDDA 1BRLB 3QZ6A 4D8LA 3NURA 1B31A 3HOJA 4Q4PA 2VUNA 4UFMA 5FAJA 4ZENA 3AQUA 1P48A 4GI8A 2WTFA 2HWGA 2Y63A 3SCTA 2Z29A 3A4AA 3BURA 3CQIA 4UFJA 1PZ3A 2WMIB 1CLKA 1PJ9A 3E96A 1N8IA 3HA1A 1O4UA 1ZBKA 3CTLA 6TAAA 3PB2A 3LLDA 3STPA 2SFPA 3W70A 1GJWA 1L2UA 4NX5A 2J62A 3ALGA 4XG1A 3EOLA 4AWSA 3RLVA 2ZA3A 2Z00A 3FAXA 4WSJA 2V5DA 3TNOA 4FMVA 4X61A 1POKA 2WNZA 3BOFA 3V16A 4MWAC 1B5TA 2WMKA 4F8XA 3WFLA 5LIWX 2Z0IA 2VVSA 3OBKA 3E9AA 1UR1A 5BU6A 3TYZA 1K77A 2C1GA 4AHPA 4FLOA 3OEXA 4ED0A 3NA8A 4WJXA 3H2EA 3QM3A 1XSJA 2VFEA 4ZO9A 1ZENA 4PTVA 1UIOA 1BVNP 4TUFA 1XFBA 1ZCCA 4D6EA 3IJLA 3OQ8A 4I90A 3HPAA 3W1XA 1YE4A 3W83A 2X1UA 4W4QA 1OGSA 3HN3A 1EB3A 4TIMA 1O68A 3PPFA 4ED1A 1FWJC 3MO7A 4IUOA 3D6NA 1EEXA 3CBWA 3ORWA 3KOXA 5A8PA 4QAIA 2C18A 4R33A 1ZBCA 1EC8A 1XM3A 4IMGA 4J7RA 4QFUA 1HQTA 1IWAA 5FSDC 2HXUA 3IK4A 4MB4A 2PU1A 4LBUA 3WQ8A 4UC5A 1XG3A 1N8WA 1I0BA 3VGGA 2ALRA 3KTSA 5EBUA 4XWUA 3GXDA 1WE5A 1NM9A 3C3NA 3UZWA 2VDGA 4ZQPA 5TIMA 3BQ5A 3VYLA 3PAJA 3SCVA 2XSXA 3QGVA 4Q4QA 4PMVA 4P8VA 4KCUA 5FL0A 1C9WA 1Q65A 4OUEA 3CNYA 2ISWA 3FVMA 4BFAA 2I5GA 1JL8A 4RE2A 1ISWA 2XM2A 3BXWA 2O55A 1PTDA 1JI1A 1DXEA 3WQWA 3M0VA 3BLLA 1F05A 1XRTA 4KMQA 3QPZA 1RJQA 3VIHA 4LB4A 3ARQA 3FHQA 3WNKA 1P5BA 4AVOA 1HVQA 2CCRA 1POJA 3LRLA 3KFTA 2DIEA 6CGTA 4JN6A 4GJJA 2WZMA 3NQDA 1TUFA 1OC7A 2PLJA 4BK9A 1PPIA 1R6WA 4PB3A 1UOZA 3WUGA 2ON3A 4E2BA 3BAWA 2GOKA 2RDXA 3HV8A 3KHGA 3N19B 5EFFA 4LRTA 1DQWA 3USZA 4C7GA 3AU6A 1HL2A 1VENA 1V0NA 5J5RA 3TAKA 3VOJA 1L6SA 1ONEA 5HJYA 4MKNA 1TZ9A 3FK4A 1TV5A 4F9JA 3WJXA 3N12A 4X22A 4NASA 3VX0A 4KPLA 4BEQA 4LPCA 2FGLA 2FH6A 1AD4A 1IQ8A 4K39A 1E70M 2EEXA 1UJPA 1R7AA 3ZT5A 3WLJA 3P61A 2NXIA 1XGEA 3KBMA 3K13A 3Q58A 5MHBA 1ITQA 3RXZA 4FXSA 4R7WA 4DB7A 1QOPA 5FACA 3TP4A 1TIWA 1WXJA 3KM8A 1KFCA 4DJED 4XVDA 4JHMA 1OCNA 2ZCGA 1DWHM 1DTNA 2Z1SA 4DWDA 4UTJA 3GC2A 1YTKA 2V5LA 3VOHA 3ITYA 4US6A 1LOSA 4UFHA 5MKGB 2HZGA 1H7XA 1TV4A 2XINA 3S46A 3LLFA 2FHFA 4ERIA 1LORA 2DU2A 1ITXA 3GV8B 2WZEA 4A8RA 3VABA 5L6UA 1R3QA 1FDJA 1OJXA 1AQ0A 2DPEA 3CO4A 4Q4RA 2VEKA 1P0EA 3BLDA 3QPYA 1TWIA 5CEWA 3GDKA 1L6GA 1IZKA 5DT7A 3OYZA 1GORA 1UP0A 2Q3RA 1UA3A 1EF2A 1VCFA 3SUSA 3U7VA 3MCNA 4JR5A 3S5NA 1R5YA 3FA5A 2BNJA 2POZA 3VI2A 2VKZG 4E4FA 3KHJA 4KFOA 4O16A 4JFUA 5I3KA 4DUWA 1DEDA 2X7VA 3PULA 1VP5A 4BI5A 4P8WA 2UVVA 3C0QA 3W3OA 4LF1A 5DT5A 3ITXA 1RUSA 3TX9A 3QSTA 5C9WA 4BR1A 4HOZA 3VDBA 5IRPA 2DVUA 1D7KA 3KVMA 4FAMA 2CLKA 1AL8A 3NQ7A 4O4WA 4C1LA 2BQ3A 1XIDA 1ZLPA 5KETA 4M19A 3GC5A 5A95A 4RJEA 3F4VA 4FF5A 4ATLA 2C0HA 2ZRUA 3BJYA 4QDMA 4HZ8A 4NRSA 4IIFA 3SCQA 1M3UA 3NSNA 1TSIA 5KG2A 5J04A 1VQTA 1SR0A 3H26A 1O6IA 1EXBA 1ZAJA 3PNZA 1ICQA 5C7VA 4L9XA 4OU1A 4ZTXA 1R7OA 3ITOA 5AFDA 4GG9A 4ECYA 3CC1A 1M7OA 3PJTA 4MSSA 4FEZA 4K37A 3GWQA 1US0A 3QLLA 3MSGA 4EP8C 3W23A 4XKYB 5BOEA 3OVRA 1R46A 2OSYA 2VNCA 1TB3A 2OCZA 1JDFA 5F2GA 3F4CA 3R1ZA 3QTGA 4JTHA 3PTKA 1XKYA 5AB3A 5KT7A 4EEYA 5H6HA 3WF2A 2MUCA 3W07A 3IVSA 3TNBA 1YNQA 1SFSA 4L65A 2QW5A 2Y5EA 4DY1A 3QQ0A 4ED2A 3S5YA 2DUXA 2A2IA 4H9YA 3GTXA 1RHCA 1C3FA 5G4HC 1S2TA 1DKWA 1E6QM 3FS2A 5HNUA 1RLDA 4K6AA 3CYJA 3C56A 1K9TA 2VFFA 1T94A 3O7UA 5K9DA 3M9OB 1VJSA 4HTYA 3FJ4A 4GC3A 3PW5A 4ROPA 3K8LA 2VGBA 5A6KA 1EH9A 2VL4A 4XSMA 1XD1A 2J6SA 1W37A 3PUEA 1GHSA 1S0NA 4IXXA 4C5YA 4H1ZA 1JZ5A 3HF3A 5BZAA 5KTLA 2D23A 3L12A 2PA6A 3MVIA 2BX7A 2ATLA 1KM1A 1Q6GA 1XQKA 3CHVA 4REQA 4ZQMA 1WXZA 5CZJA 3MR5A 4U6PA 2XIIA 3P84A 3O2LA 9XIAA 3F2CA 2WVSA 1G4SA 1T7LA 5DLFA 2YYUA 5I3GA 3EA2A 5CAKA 2YOCA 2FZMA 3P80A 2D24A 3UVAA 1TPC1 4Q7IA 4O19A 1VFUA 3EWWA 1H1ZA 3H4DA 3FYYA 2HK0A 3CUXA 4B92A 1H51A 3PFMA 5JUVA 5E9AA 4C1NB 3PJWA 4RZ5A 3TQ1A 4RUBA 2DIKA 5XIMA 4PUDA 4GOAA 4R5EA 1X7IA 3W29A 3R43A 5ABHA 1JRCA 3MANA 2FZBA 2JKAA 6REQA 3VINA 1KM5A 4DO6A 2GSHA 3CB3A 3A13A 1KRAC 2VD8A 1YXCA 2WZHA 1ISYA 5G2IA 1IE7C 1JFXA 3PBGA 1ZUAX 2PDQA 3GVWA 4BQ4A 2BVWA 2OU4A 1B30A 1A0DA 3IRDA 2V5JA 2Y7GA 3F2DA 3WMCA 4XKMA 3UW6A 3LCLA 2W9MA 2H6RA 3N13A 4TTGA 2YCLB 4AIUA 3UXKA 3QY7A 3NGJA 1W0MA 3GFZA 1TPWA 1YMYA 2XWEA 3VNJA 2XH2A 1EJRC 4L1WA 2G3FA 4D6HA 1W5PA 3SGGA 4GE8A 2I57A 1Z9AA 2J66A 1DXFA 2WHLA 3TR2A 5KFSA 1W2VA 1PBGA 2BR0A 3HTWA 1VBRA 5GJMA 4X63A 4FOKA 4UXDA 2A3BA 4CQBA 5KT3A 5CSUA 3SUWA 1VKFA 3VIGA 3GU9A 1EP3A 1GT8A 3Q2DA 3GVQA 3T0BA 4PMRA 3STGA 2R6OA 2FB3A 4TV6A 3T78A 4LRSA 2BOGX 5I09A 1PEZA 2Z1VA 4A05A 4DZ5A 1V3KA 2R14A 3PVXA 4B5WA 3ZYZA 2W62A 4O11A 4TTUA 4YL2A 3ZM8A 2P8CA 4KGJA 4AZGA 4UTIA 3RJXA 3ZJKA 4LVBA 3SURA 4C7DA 4PFHA 5A8MA 2XHYA 6A3HA 4GUFA 3H4XA 4IPPA 1WXYA 3W84A 3WH5A 3OP2A 4M6PA 3GSMA 4GJ1A 4OVXA 4AZBA 4PMQA 2VFIA 3G1HA 4AZCB 1CXHA 3ARYA 3E0FA 1DIOA 3M1ZA 4JN8A 3WH9A 2XVPA 1FWWA 2WVUA 2INFA 1Q4NX 1FWEC 2V69A 2VVNA 3WDQA 5L1JA 4EYHB 1GOIA 2CIPA 1ZCOA 4Q22A 3OJGA 1W6TA 4JTFA 4IG2A 2E8YA 4CD4A 1OFOA 4M1RA 3GHRA 5H1WA 3D46A 2CETA 3OVGA 1NEYA 5T8GA 2DVXA 3UESA 2YCKX 3W4RA 2XN1A 2D2GA 2EPKX 4IJCA 2ESCA 4Z1CA 4DAIA 3RMJA 5D03A 3UY7A 2QYGA 3TJXA 1BRLA 3BW3A 1Y7VA 5DGAA 3TSBA 3E2VA 1W9VA 1H1NA 4IIDA 4L5ZA 3O0FA 3G1DA 5CLTA 2OFJA 1GOMA 4PTWA 2BOEX 4YCPA 1NWSA 1Q2SA 2X16A 1VPYA 3MW7A 2ATMA 4FBUA 5GVJA 1A5NC 2C2DA 1E4NA 4UUIA 1W32A 4UOZA 5JIWA 1YTEA 4AVFA 4WHBA 4ECQA 2WJZA 7ODCA 5DBTA 2PC8A 4W85A 5I0DA 3T5JA 1B57A 3SN1A 3BGGA 3WDPP 2R24A 1CXFA 3EBVA 2D2HA 4IIHA 2HVNA 2POTA 4JTIA 5K9CA 3RO6A 2V3FA 4EWND 1W5OA 4UFLA 2BV9A 2JEQA 1TG7A 5TAOA 3WD0A 1Z48A 2VO5A 5AHFA 3R8HA 2OQHA 4MUPA 4E0CA 5LNSA 2J75A 3BC9A 5BU9A 2C19A 3WEOA 4U3AA 1VGAA 1XCFA 2VZTA 3TU9A 4X0NA 4G5DA 4DJDD 4WR3A 5LA2A 3QF0A 2QJIA 3N2MA 3W7EA 4BY3A 5FL1A 3T0DA 2A79A 1VFLA 1A5UA 4F0MA 1J18A 3SIZA 3VKBA 4IFOA 2R91A 3ONBA 5FIPA 2WPGA 4AHQA 1JCYA 3ITVA 1SM9A 3VX1A 4EIVA 4QCFA 1GUVA 2W4XA 1I75A 3WLLA 3PY2A 1Q7QA 3U3HA 4QW9A 3RLHA 2CBIA 1S0OA 5D37A 4HU0A 3ZSTA 3LNPA 3DBPA 3EGJA 1LZOA 2Z6IA 1H4PA 3GU1A 1XS2A 2GZXA 3TN6A 2DZTA 2X40A 3BPWA 2ONEA 3ITTA 2O9RA 5FSEC 3BG3A 2DW7A 3M5XA 3GR8A 2UVWA 2W8LA 5KG0A 1JXJA 4WSKA 5G4EA 1W1B1 4R85A 3AIQA 3NL3A 3IPWA 3F5JA 5DN1A 2OJPA 5C9RA 1HZYA 2VURA 2QIIA 5FF0A 4D1JA 2F6XA 3GH5A 2P10A 1PVNA 4UR7A 1IT7A 1KRCC 3M5YA 1WB0A 2YL6A 3NZQA 4O13A 4EBCA 3RAXA 2NX3A 3PP7A 2IPFA 2OH2A 3BWWA 5KFVA 4Y96A 1PWLA 4BQ5A 2WCGA 4DO5A 1YHTA 4IL0A 1B3WA 4PRWA 3WQ5A 3O05A 2VP8A 1DJXA 4F4YA 1V7AA 5FEPA 3TSMA 3T5LA 4M56A 3D47A 2OQLA 3W75A 4MPKA 4AD2A 1LOQA 2YL9A 2ZIDA 3MV01 1XV8A 3KAOA 4WGHA 3LGDA 4UZSA 3QOMA 2B81A 1DHKA 4GZIA 3MR2A 2HNHA 1WA3A 2PDLA 2CESA 4IPIA 2G96A 2QGYA 1K4HA 1FKXA 3RB4A 3OA3A 1N48A 1NOUA 1B3XA 2OT0A 2WOQA 1KR1A 4RKAA 4GUGA 3I6TA 5EGRA 4XSLA 1NFBA 3TEVA 3A5VA 3V0TA 3T4CA 3W7CA 3ZQ9A 1XICA 4DO7A 4DO4A 3EXRA 3N4AA 3TTYA 1VLIA 1C93A 4JTSA 1H41A 4JKLA 1FY6A 5HQEA 2OGYA 3PZOA 1ECQA 4X9YA 3UR7A 4JBRA 1CGUA 3VOCA 4H9MA 4FNSA 4DX3A 1LBMA 2WAGA 5FJJA 3VK5A 4QAWA 1BYCA 3AZSA 1V79A 2WC7A 5LGXA 2F38A 5B7ZA 1K7FA 3UG8A 3LCIA 5LIKX 2P5NA 2XZ9A 3CUHA 3A22A 3LD5A 3M0IA 4ZO7A 4LSBA 3CAKA 3W00A 1LCOA 2OLHA 1HO1A 2OG9A 2XIOA 5DXYA 3GB6A 3M4HA 1A5KC 3GKAA 2ZICA 5I79A 3BJSA 4JV1A 4Z0SA 1KFEA 4ZODA 3ARPA 3OZMA 1BD0A 1GNXA 3GBDA 4M0XA 2NSXA 5TD4A 2EPHA 5D09A 2Y7EA 3IVUA 2W91A 2NQ5A 1OYCA 3GW0A 3DFQA 3P14A 1DWJM 1W1VA 3VKCA 3LTSA 1OK4A 3ARRA 3BAYA 5M2FX 2JKEA 3B0UX 3QY8A 1XKJA 3R89A 4H8UA 5AC6A 3UJEA 3EMQA 4G8TA 1LL7A 3RIKA 1W1YA 3HG4A 2VZSA 3V1PA 5L9XA 2AMXA 1XISA 3BCFA 1M03A 1R47A 4O57A 3NM3A 1R8LA 5I5RA 4IH3A 1RAKA 3VIMA 4D6DA 3UYIA 4AAJA 3KDOA 3IJQA 4L7ZA 5C2XA 3WLIA 2R8JA 2VA2A 5KFTA 1Q7MA 4YHEA 2VM8A 1PKMA 3NPUA 3CUGA 1PKYA 1KLYA 4IIGA 1T99A 2A3CA 1EGZA 1NH6A 2W5FA 1XGZA 4N7QA 3C8NA 5A2CA 3E2QA 5D4YA 2C22A 4KWSA 5HNNA 1UWAA 5A8QA 3QMRA 5KZ6A 1VPQA 4NY2A 3P3BA 3DGRA 3MWCA 2PDPA 5H91A 2AAAA 2FVKA 2V2CA 4PMXA 3NOYA 1YDYA 2OT1A 1P6CA 5IOBA 3B0VC 2Y2WA 3GX9A 4J9SA 1GTHA 2FMNA 3CHCA 3UA3A 1T3NA 2XVKA 1KGWA 2ZX5A 4AX6A 1Q2RA 3GM8A 1TQJA 3AIWA 2GVYA 5JU6A 3M6YA 5HANA 4GYKA 4MVAA 1Z42A 3MCOA 2QJHA 3OBAA 1S39A 3W7PA 2CPUA 4FX6M 5I3FA 1W1TA 4O1CA 3RJYA 4LF2A 3BTNA 3FNDA 5XINA 4EXAA 3M7SA 2DT2A 1US2A 5D9OA 4AH7A 4NNBA 3N2XA 2Y85A 1KCKA 3R2GA 4GIAA 1D2KA 2R1NA 2J77A 1BQGA 5AKQA 2CXEA 3V7PA 1VD6A 2C2EA 1W5NA 1FP8A 3T40A 1K9FA 4I3GA 3P0WA 3DKLA 1E6NA 3HMCA 1BGAA 3UZYA 3LEPA 1JPKA 4IF2A 4TX8A 3EWCA 2HS8A 3WMBA 3H4WA 4I5RA 1ENUA 2VC6A 4M29A 2TAAA 1ZY9A 2QCGA 1WUFA 4S3DA 1KNWA 4GYPC 3UWUA 1OM0A 2XGQA 3KRBA 2WBGA 1CI1A 1P1XA 1AH0A 4Y8EA 3WEMA 1NOFA 3AIUA 3KP0A 1WKEA 4W7WA 3N18A 3KCOA 4QLLA 3EYPA 1GVRA 3K4AA 3GQCA 2NQZA 4OT7A 3KXQA 4AD4A 5EMLA 1L6YA 3WY1A 3R79A 1HVXA 4H7CA 3T0TA 2DW6A 4FALA 4IT1A 3SBFA 1XRVA 1GG1A 1REQB 4GLEA 4DJFC 1QPRA 4CU6A 1OFPA 1REQA 3W73A 3SRHA 4D8AA 1TJ0A 2VGFA 4U2YA 4V27A 5HNRA 3W1LA 1HP5A 3IIVA 2YXXA 1X6UA 1GVIA 2G3JA 4XD4A 4JEJA 4B3KA 1WX0A 3VNYA 3P5YA 1OD8A 3LA4A 1OFAA 3DHFA 3N4EA 4FOJA 2C2RA 4S39A 4PCSA 4DF1A 3KOYA 1XBXA 3QHNA 4HPNA 4PBEA 3VE7A 2A1YA 2ZDRA 3UCDA 4S3JA 4PUEA 2Y24A 1J93A 2EJAA 3S9YA 5KFOA 4JIRA 2PTYA 1MDRA 1RBAA 1HKKA 2W9BA 3THUA 3TW6A 3GILA 3DU0A 1AK5A 3A3XA 3SFWA 4NAFA 4MDPA 4HA4A 3FX4A 1SJCA 3PUGA 2P53A 3IUDA 2RDIA 4O17A 3G3MA 2CLPA 3SAZA 5DMNA 1C91A 1KTCA 4IQEA 3TR9A 3UPMA 3O6CA 5KFWA 4GGBA 2V3GA 2XVNA 1JCTA 3N2OA 5A3HA 4MYAA 2PRHA 4AIEA 3TA6A 3E02A 3ANUA 1OK6A 3P93A 1E6SM 4B4HA 1MMFA 3T8QA 3G77A 2PWHA 3DFPA 4RV3A 3TC3A 3TTEA 2PRLA 3MMDA 1UD5A 4YCOA 4YR0A 2YLLA 2WNNA 1FWBC 3DFNA 3W1QA 5FJTA 1BXCA 2WM1A 3HJEA 4U5KA 2ALDA 4PMDA 1JPIA 3P74A 3PWGA 3ZR4A 4QJ4B 1PCKA 3OGRA 3FHAA 3DG6A 3HPZA 3UZ5A 3N14A 4PCFA 1JUBA 2NWRA 3E3HA 3KHLA 3E49A 2AGQA 4WKAA 4DAFA 4LW7A 1QPQA 3G6VA 1UB3A 4R27A 3NDYA 4PCPA 1BF2A 4C6FA 3TZNA 1VEOA 2YBTA 3S1UA 2GOUA 1IR1A 4AY7A 1NWTA 4GO8A 1G94A 5DEZA 2C8NA 3N2BA 4P2VA 4GXPA 1MXGA 4MG4A 5FF3A 2W9CB 1XLHA 1PWMA 1G4EA 3BG5A 3M44A 5A5WA 3ATZA 2PCEA 3JVAA 3CASA 2VELA 2C0AA 1JD9A 4I6KA 4AZ6A 1X8FA 3LRKA 1W9PA 3EB2A 5ECVA 4MYXA 4P61A 4EPKA 4FNTA 4N4QA 4UNIA 1PX4A 1R9YA 2YXOA 1H63A 4JD4A 1S1RA 4EPEC 1JI2A 3N6JA 1NJJA 1GOWA 1YXDA 3K5XA 1P0KA 3S1GA 2J6TA 2OYMA 6XIAA 2ZZ5A 1SUXA 3QZ8A 1KR0A 1OHLA 1PHQA 4UTFA 2D2OA 1KBLA 4Q8OA 3FV9A 2C79A 1HJVA 5D38A 2V5CA 1DV7A 2CZ5A 4JAWA 2IKGA 1B2YA 4LAMA 3RPTA 5DMLA 2E5CA 1YDNA 5KSWA 3ZLHA 3LENA 4BS0A 1FH8A 3BVJA 1R2TA 1TCDA 2FVLA 4PUWA 5HAOA 1JJKA 3I7QA 2HRWA 1XUZA 3CWNA 3G6XA 4I7WA 1OCQA 8RUCA 2BXVA 4YNGA 3ARUA 1VEMA 4YVPA 3B8TA 3UXIA 3LX9A 4JN7A 1KQYA 3IEBA 4UQ9A 3KE0A 3UJ2A 3NTYA 2RDJA 3FDKA 4WIWA 4PRTA 3CQKA 3FDGA 5LIUX 4GBDA 3DN5A 2QUVA 5AC7A 3DGBA 2GVEA 2J7DA 3SCOA 3RRAA 1QHPA 4O18A 3L23A 4Y2WA 4EX4A 5REQB 3W02A 4B15A 4D6GA 2DSKA 5JXQA 4EF8A 2VR4A 1OIFA 3T5KA 3VD3A 1NF7A 4O3SA 1NY1A 1Y5VA 3T8LA 3GG7A 3GUWA 4JX5A 1RCXB 3KW3A 1LUCA 2VUYA 3URQA 3TC7A 2ASLA 4UTTC 3L5AA 2ZFAA 3LHZA 1UWRA 1DJIA 2BASA 3QKEA 4JS3A 4WOQA 5AVHA 4EOUA 3LCGA 4NIRA 4DYEA 3QFWA 3WDHA 1PDYA 2PD9A 1HP4A 2ZZ3A 1SO3A 3AXHA 3GGMA 1TMHA 1CX9A 5FOOA 3GQYA 2B7QA 5CZKA 4OIFA 1GYLA 3OVPA 3O06A 2XU2A 4HP5A 4DJFD 1CNVA 1LF1A 3B06A 1PTGA 1T6MA 3DAQA 1PS9A 3A47A 4GFSA 3LMYA 4HA0A 3USBA 4RNHA 4BHYA 4QNWA 4Z1AA 1JIHA 1Q6LA 7CGTA 1R9XA 3GDMA 4YTQA 4W7UA 3WQVA 1WAUA 3WX7A 4QE1A 3UZJA 5KZEA 2PDFA 3DCPA 2CLEA 4I9TA 4Q3MA 4UTMA 4Z0JA 3LSBA 4ECXA 4JFVA 1S5MA 2I9EA 4WY0F 3WDJA 3W24A 4J9JA 5BXTA 2NX9A 2FHBA 3NZ1A 1CGYA 4FLQA 2WSYA 3CM4A 1AQMA 1F7BA 4IR9A 3RR4A 3UF9A 3I4EA 3BZGA 4E4PA 5KFJA 3STFA 1JPDX 4PUNA 3MMUA 3AYRA 2J24A 3QYQA 1OBAA 1H0IA 2IQTA 5KFQA 2WHJA 4PB4A 1RK5A 1K3UA 1LBLA 1QRQA 4DJDA 2JF7A 1H61A 3BQ6A 2FPTA 3LN3A 3BMWA 1J8VA 1E9LA 1FH7A 5ABFB 3ZT7A 4A29A 3AALA 3WF3A 4RXGA 4NZJA 3ARZA 1E1CB 3PAOA 3AXMA 3UA4A 2GDVA 3M16A 4JYEA 1DYSA 2PEVA 2P88A 2W3ZA 4ZOBA 3PR2A 4PMNA 4DZHA 5A1AA 2R8GA 1KD0A 4MLJA 2DQXA 3H2CA 1FA2A 3FXGA 4V15A 4G2DA 1LT7A 1RPKA 4IIEA 2PDWA 1I2NA 1HO4A 1E3XA 4DWSC 2CZVA 2YB1A 2OX4A 2WBKA 3H2MA 4V28A 5DGBA 3HPSA 5HWJA 2BXZA 3LERA 4OOUA 3IWPA 4RPQA 3W22A 4LY8A 1JXLA 3W7MA 5BWAA 3A9BA 1W56A 5C8BB 5LHFA 4JQ4A 3BLEA 3HM7A 4J3WA 4O50A 4RW3A 4XZBA 1O5QA 2EG8A 1JZ4A 3RBDA 2E67A 4AD1A 4DXKA 2QF8A 5M03A 2V3EA 2Y0FA 4XISA 4Q7NA 2DDXA 1PXGA 1WBHA 1EHNA 1LWIA 1RBLA 4LCQA 2D0GA 4CU8A 3MJMA 2I9UA 1QNVA 1JD7A 3S1VA 1S2CA 3C2RA 3HQNA 2D73A 1TX0A 3H2OA 1QNSA 3M0LA 2DH2A 2CBJA 5G2HA 5DLCA 4N2YA 1BVZA 4IFKB 1VHNA 5E09A 1EIBA 2YJQA 2G5WA 2FFCA 4LBRA 5BXSA 4QJ5B 4IJBA 2Z1WA 3TN3A 4NJHA 1K7XA 2W9BB 1EJWC 3VAVA 4CD6A 4K1GA 1GYNA 5FI8A 1Y5WA 3HPXA 3LM3A 4E2VA 1X7FA 5KFDA 3BH4A 1O1HA 1XPYA 2ZXQA 1THFD 4X0VA 3E0VA 2AU0A 1NQ6A 1A5BA 3OGSA 3N6HA 4EAMA 1HKIA 3VDGA 3CGTA 4AZCA 3SDOA 4PCTA 4K38A 2YZRA 2NVCA 1Q8JA 4A2RA 4RK8A 2E7FA 3CPRA 2VMFA 3H22A 4MIMA 1Z6KA 4DVOA 5B7YA 1US3A 1DBTA 3L0KA 4GO9A 3IV3A 3OPSA 4F2TA 4W93A 1TRIA 4OV9A 3SY1A 3HJZA 1MEIA 1W3KA 1SZGA 3KBJA 1KFLA 2DZWA 2DZVA 4A3RA 5EMYA 4DM1A 3IUHA 4E8CA 1QBBA 3MUAA 4AVNA 4S2CA 1PIIA 3C2FA 1Q45A 2ZUWA 3N2TA 5KT4A 4B5UA 1XYMA 2E5DA 3IANA 3GVGA 3A64A 4QSHA 1EIXA 2A4AA 4C91A 3ABRA 3MHFA 3S6OA 2J78A 3E0WA 1FCUA 1FWTA 3EEGA 4GX8A 3HMJG 5KFYA 1S97A 1C8YA 4FP1A 2QVHA 3T07A 1UOKA 3RNDA 1M01A 4FX8A 2XZ7A 5DFAA 1FWIC 2PU0A 2A3EA 5HR6A 3C3UA 1DWFM 1FUYA 1ELSA 1SO6A 1XGDA 2XFWA 1JCJA 3NO5A 1UD2A 5E5CA 1HGYA 2HCVA 2QF7A 5F2LA 1GVQA 2NXHA 2J27A 4F4WA 1O5XA 4NJKA 4CCCA 4ADSA 1PKNA 3Q45A 2G4FA 5DELA 4ZFMA 3BE7A 4B5XA 1A5SA 1ICPA 1F74A 4JTCA 1K02A 3W7NA 2WSKA 4WRHA 2X05A 3EWXA 4YMZA 3GVRA 1H1YA 2J8TA 1FWSA 4KT2A 4UTKA 2XCPA 4RE0A 1KTBA 4WVXA 3D5HA 4JTEA 4ATWA 4JIIX 3SQSA 3CZ8A 4NZ1A 3W2MA 2GSEA 1CB7B 3VD7A 2P9BA 4ZTYA 1UKOA 3NQ8A 2AGTA 2OLSA 2X1TA 5E0FA 3VE9A 1J2BA 5HPOA 4J40A 3DC0A 8XIAA 1E0TA 5BXRA 2YIHA 1MVYA 5KFBA 4DWSD 1WV2A 1OINA 4MWAA 1R3VA 3H2NA 3KRSA 4AG0A 2O9PA 1SPQA 1XWYA 2BSLA 2G3MA 4FOUA 2QAFA 5CSRA 1R3SA 5CXPA 4Z2GA 5HQMA 1GZJA 2IQDA 4PUUA 4RDWA 1QDSA 1TV3A 2PGEA 3S3GA 3BW4A 5JBEA 2VZVA 2VZUA 4GACA 2PE4A 1D9EA 1OB0A 3V6JA 2NT0A 4J35A 3TIMA 5KG7A 3RM8A 1TA3B 2YCLA 1QNPA 1UW9A 1TX2A 3TDFA 3ITGA 4PL1A 4XAZA 2Z25A 5D2YA 3QV9A 4NG3A 2ASDA 4XBKA 4GYJA 4C6JA 1O12A 5TQLA 2J9XA 1U1HA 1FX6A 3NM1A 1JUKA 2OQYA 3LTPA 2PFHA 2P1FA 1ZBVA 5MF5A 4NX0A 4QGCA 3POHA 4MZ8A 1NAL1 2P3EA 3E2SA 1I2QA 4M6VA 1G7VA 5GPRA 2QXWA 1TJ2A 4CVWA 1HXJA 1D3GA 1BWKA 1EDTA 2BBFA 2GJXA 4FPSA 3LZ5A 4EANA 1TTQA 4GY0A 4PMJA 3FJ6A 1CIUA 1RQEA 1LT8A 4XD6A 1HG3A 1Z89A 1SSDA 3K4WA 5E6YA 4LUSB 1TJRA 4LFYA 1XLDA 1YX1A 1ZU8A 4WUIA 4B5SA 3T1GA 3NR0A 3IAQA 1QATA 1KKRA 2D20A 3PF3A 3QFEA 2PLCA 3T2QA 1Q6CA 1WO2A 3NL5A 1RA5A 1OT1A 1D7FA 1SZFA 4E5TA 1EJXC 2VGGA 4DWSB 3RAOA 1CXKA 2Y5SA 5BRQA 3M5ZA 4AFYA 3QH2A 3B0YA 3H7RA 3SUVA 1DJNA 2WKLA 4G9PA 5DANA 3WJWA 1OT2A 3G6YA 3CV2A 1R2RA 2WLYA 4JOMA 1UR9A 2ADAA 7TAAA 3LDVA 5A6BD 3DKJA 2BQRA 4WJEA 3FLUA 3W7HA 2FZ9A 1MQQA 3QR1A 1SZRA 3NVDA 3GU2A 2J7HA 4QDWA 1ZP3A 4US5D 4ECLA 1AH4A 3W6MA 4N6FA 4R9XA 2DPIA 2PRMA 1TPEA 4AYSA 1XINA 1W9XA 2GVGA 1B3ZA 3GNXA 1VFFA 1H50A 1E6PA 1I8JA 1OC6A 1J9YA 3ABOA 1J11A 3PSVA 1VR6A 3BSMA 4GVGA 2EPMX 3K2GA 2FLIA 4H7ZA 1RYRA 3MBDA 4HB7A 4W5UA 3C6CA 3S2LA 2A3AA 4OGZA 3CJPA 3VNMA 4J4KA 3AMDA 1T8QA 3E0IA 2BOFX 1ML1A 4KRZA 2WLZA 1Q4WA 2FMOA 3LQGA 3S5OA 1J79A 3EDEA 1O60A 2X0SA 3NGDA 1F8IA 2GWNA 2HDJA 1TIMA 2ACSA 3ATYA 4H8NA 1AZ1A 1JYXA 2EF9A 2GDUA 1P7TA 1XLIA 4AQLA 3PW0A 2HJPA 1V6WA 5D9PA 1OADA 5FJRA 3UG5A 4JXCA 2QUUA 3G1SA 3PW7A 1M04A 4HN8A 2UWFA 1UBPC 3HQPA 2WM0A 4POCA 2Y5JA 3BV4A 3M0HA 4DM2A 2Q6ZA 5C54A 3KUMA 4AUBA 3RM4A 4XQ6A 4Q8FA 3IRSA 4HCDA 1R87A 2YKKA 4RNFA 1KW1A 3AWNA 1F5ZA 3EEZA 4CUCA 1HJSA 4UTLA 3TE9A 4ZOAA 4IGMA 4JDBA 3OHIA 5CQ1A 2UY4A 3QW4B 3UXLA 1S1PA 3M46A 4FHAA 5M1TA 4W7VA 3ZZ1A 2YSWA 3M7WA 1QBAA 4JYFA 1C90A 1B4KA 2Q3OA 2Y89A 4N02A 3CQJA 4JTDA 3SFKA 5BOOA 4LTSA 2DZAA 3JUGA 4HSOA 3E0LA 1E1CA 1ZJAA 4MPQA 4NZ3A 3WFZA 3WO8A 2PDXA 1XLBA 3PANA 4UB9A 2EPLX 2WVTA 4FNUA 5F4XA 1DJWA 3P6LA 4XAGA 5CCZA 2YCJA 5ABFA 4HBKA 2NT1A 1UMLA 1C7TA 3G18A 1IV8A 1LG1A 1NWRA 3L2IA 4U7CA 3FIGA 3GD6A 2PS2A 3TYCA 3IIPA 3AIVA 3MB9A 3WBAA 3PBYA 3YPIA 2PODA 1RD5A 1YBQB 5CGQA 1GQKA 2VCAA 3P62A 2CERA 2W92A 1BHGA 4KFNA 3RHGA 1EJSC 3F4NA 3LHUA 4O0KA 3SCSA 2JKPA 3B8UA 4LNCA 2RGMA 2VQTA 3QQ1A 1UUQA 5DQHA 4ZB5A 3S9IA 4QJ3B 1F9CA 2Y4SA 4LCSA 5AHIA 2E09A 4ZQRA 3JW7A 2Q09A 1EC7A 1U1UA 4JCMA 5KT6A 1UKSA 3BOLA 1LROA 2QULA 3IVTA 2WK2A 3ZMRA 2KZHA 1F61A 2V6AA 4H6QA 4KKXA 4R3UA 4KEVA 2Y7DA 1AW1A 1IZCA 3GG8A 3NL6A 4MB5A 1ZFJA 2ACUA 3LRMA 1OD0A 3CLMA 4DBDA 4PC8A 4ED3A 2GUUA 1JNDA 1OCJA 1VFHA 1W5QA 4O4VA 2FKPA 3POCA 4EK7A 3H2AA 3M07A 5U4NA 1CLXA 1I6NA 3CAQA 3GXFA 5LXXA 4P8UA 3T09A 3LHYA 3P0XA 3OG3A 3OZPA 2F6KA 2X42A 1IXQA 1QTWA 5DMMA 2J25A 2GYIA 1OIMA 3VNIA 2VHLA 1XLJA 4H83A 1EJTC 1SFLA 1I45A 2PWFA 1GZ1A 1I1XA 3NQVA 4MB1A 5A6MA 4H6KA 1Z32X 1LDCA 5L1IA 2OELA 1RA0A 1QI2A 4H9XA 1JPMA 3E12A 4G3IA 1GGOA 2R1LA 1R3YA 1FWCC 1OF8A 5KINA 1H7WA 3N04A 1EYWA 1XIHA 3F4DA 3KBSA 1KXQA 4XO7A 1AA1B 4PTNA 4PZVA 3WUEA 5A6SA 5KG6A 4J1OA 1CT5A 3NFUA 3MHUA 4ZGYA 4Q8UA 4HPGA 5HUPA 3T4WA 4IPJA 3RR1A 4F0RA 2CWXA 1A47A 1JG9A 4AZ5A 1NDVA 2YFOA 4AD0A 4KCWA 5IDIA 1XIEA 4AC7C 3VIPA 2OO6A 3NNTA 3DH7A 1SJBA 1VLWA 4DXXA 1GKPA 2AL1A 3MWAA 2P50A 1LM1A 1IF2A 2OKOA 4KBXA 1B3OA 3H55A 3R5EA 4AD5A 3LGGA 1HN1A 3ES8A 1W9UA 3OIXA 5D9MA 4CD5A 2BG5A 3SCUA 1RK6A 2G3IA 1OFQA 1YLVA 2BY1A 2HVMA 1G4PA 4HYWA 4BWLC 3FN9A 3W7IA 2PTDA 1W54A 5EY5A 3K8MA 2PD5A 1HKWA 3RK8A 3A5FA 2VXNA 3AO0A 1WKFA 3RCYA 1KQZA 4YYFA 1M65A 4N9CA 5AOUA 3UPWA 2Z2BA 4DJEC 4ALDA 4MWAE 8A3HA 1IEVA 3VOGA 3SIMA 1XYZA 4QM1A 3HQ1A 2V9DA 3L5LA 3PZNA 4NVTA 3LXBA 2QJGA 3GNOA 1MW1A 4UQCA 3MYPA 2GK1A 5FJPA 3N29A 5FF4A 4NAEB 4O1FA 4U5IA 3HBLA 2P0OA 3N15A 2OSXA 3LI1A 3H4BA 4UFIA 3RILA 1D8WA 4NAEA 2CLFA 2AQWA 3L65A 1KFBA 1CYGA 2ZX8A 5KFIA 1E9ZB 4N42A 1A5MC 4AXKA 3ERPA 4ZB2A 3N3MA 2ZE3A 6PTDA 3WNNA 2MANA 2AKMA 4HCLA 1UROA 4PN2A 3WMSA 2PGFA 2C16A 1DTUA 5D2TA 1VFMA 3TFCA 3BAJA 1U33A 5CC6A 2Z2AA 1EGVA 3NVTA 3C0JA 1OZQA 2VD9A 2NV9A 1EBGA 5L1KA 1G01A 1NELA 3QC3A 3U2ZA 1Q6EA 3RDKA 3QR3A 1K8CA 3M0KA 3TH6A 4J3ZA 4ED6A 3EA3A 1R2SA 3R8RA 2IPGA 3V35A 3DUGA 1K1SA 3TQPA 5C5JA 5LNUA 3AS2A 4Q8QA 4DUXA 1JAEA 4GHRA 3MP3A 3WBYA 3L2LA 1EP2A 1FH9A 3T9PA 3M9MB 2Z1KA 3UWEA 3QW3A 4I8DA 3MSYA 2XGBA 4Z2LA 3PG8A 5EMUA 1XYLA 4J9MA 3FOKA 3C86A 3PPGA 1WBJA 3N1AA 1QK0A 1NFPA 3VGFA 1UZ1A 3AUJA 3QR0A 3W27A 3ZSSA 4MTVA 2QMKA 1P6BA 5DRIA 2VDHA 3PZGA 2IKJA 1OFEA 2QJNA 3WJZA 1LOLA 2B7NA 4IGSA 5CGTA 1OX4B 3NDZA 4YWIA 3GAYA 5EB8A 2OZ3A 1GOKA 3PUDA 3TJIA 3UYCA 5LHEA 3EPIA 1P6WA 4C1NA 3QZEA 4JV0A 2VX7A 1L6WA 4GKLA 3KZSA 4K8GA 4GMEA 2D69A 2NQHA 2JK2A 1CWYA 3MDUA 3FCPA 4I5XA 3PS7A 4N9BA 4XBJA 2CBUA 3HFTA 4PA8A 2PDHA 2OODA 4JZ5A 4O1AA 4C6EA 4R8UA 3WD3A 1E9YB 3NXLA 4LBSA 3I6EA 3QV7A 3AIBA 3PZMA 4HN4A 1MUMA 3CEPA 3TSDA 2G3NA 3L68A 2JEIA 1CCWB 5C5YA 3G1RA 4JQ2A 2IS7A 2UVRA 2V63A 1K4GA 3IGSA 1RZMA 3FW6A 5G2WA 2Z24A 2J4GA 4DLMA 1GQNA 1SW3A 3W7QA 4CNOA 1H2JA 1F3EA 4Q44A 3KWXA 3QC0A 1AH3A 3V6HA 4PMYA 2DZXA 2V2HA 2ZA1A 3R58A 4QRNA 3N4FA 3VPLA 2ACRA 1RBOB 1XX1A 4ERGA 3HG3A 4R53A 1MW2A 3NXFA 1LL4A 4DN1A 4IGNA 1TPUA 3OQEA 3F2BA 2FFIA 3NGFA 1WDSA 1KFWA 2EKCA 4X2RA 3PN8A 1MXSA 4NJGA 5CKSA 1VJZA 2PTZA 3THCA 1KWGA 3CLWA 3IV8A 1K6WA 4TV5A 4Y9AA 5AHEA 1VC4A 4FX7A 3WH6A 4XAFA 3IJ6A 2GGHA 2RHGA 3V5FA 3GG1A 3SJNA 4V1XA 3H7VA 2OMAA 3WDIA 1WOBA 2ZVRA 1W3JA 1QT1A 3WH7A 2CLMA 2XFRA 2VC7A 3W7DA 2YLAA 3CZJA 2B7PA 3SZ8A 1P43A 3V4BA 4QWBA 2E0PA 5I2UA 3W38A 1VBGA 4DI9A 3N3TA 4ECWA 4ADUA 1NP0A 1X8CA 1BVWA 3R25A 2OYLA 3WBEA 1XIJA 1PO9A 4A4AA 2GFTA 1SU5A 4C1KA 3AYTA 1MUCA 4P7RA 3GFXA 1BQCA 1TE1A 4LYPA 4H01A 3A3HA 1FRBA 1EWEA 1F2JA 1ZJHA 2IKHA 4BCEA 1TVPA 3TYAA 3HO8A 4QDPA 1V51A 4PMOA 4GI4A 2G4JA 4UTWA 1RVGA 1JCLA 5HUOA 2IXVA 2ZTJA 1LYXA 2WANA 1Y5XA 1RR2A 3NO1A 2JBMA 2OEMA 5KFZA 3BCDA 3SECA 3F5LA 2FTPA 2OO0A 4UMBA 4TVDA 4NZFA 2EG7A 2PP3A 1J6PA 2G37A 5SWUA 1AJZA 3KVJA 4ZMGA 2AKZA 2FZ8A 4AY1A 3WNOA 1TPDA 4LY4A 4UCGA 3LK6A 3IAPA 3TWAA 1PX8A 2ASHA 4TMCA 4L61A 1IYXA 3GNPA 5EWGA 5IFTA 2BLEA 3Q37A 1GVEA 3LOTA 4S3CA 3CV7A 1BWLA 1QJWA 4FS9A 3IS4A 3W2LA 1QWGA 1TZ7A 3RCNA 5I03A 2VR2A 3PBWA 1T41A 5JMUA 2VEFA 4EPDC 3WUFA 3UY8A 4IMCA 5KFUA 1UMYA 1VFSA 4JTLA 1CXIA 1MSSA 2XH0A 2BTMA 2DFAA 1UPPA 4WD0A 2V82A 5BWFA 1GEHA 2A7RA 3EDFA 3NPXA 4IQDA 3CIXA 1MEHA 5A6LA 4WDUA 5DXXA 1NWUA 1UC5A 4D9PA 4IX2A 1DWAM 4UOJA 4LNYA 4ILSA 4ROQA 4CQDA 3MC5A 3LHVA 1H5VA 4U10A 3B9OA 2ZUTA 4GK8A 1VIZA 5C70A 1JF6A 4KIEA 2G0WA 4GD0A 2PDJA 1TELA 4UFKA 3F5KA 2QGHA 2GK1B 4KCTA 3VUSA 2AQOA 4WGXA 3PHAA 2QAPA 1TPFA 4W8BA 2XGPA 2GVJA 3TJLA 5C2CA 2E1WA 5F1VA 1WOAA 2DH3A 4LC8A 4JNYA 3I7RA 2DUZA 5T9CE 3G1VA 4WK9A 3VCRA 4H9UA 2AGPA 3I68A 3VMNA 2ZZ4A 3B8SA 3HGRA 4RNMA 1A80A 3G6MA 2O0TA 1W8GA 2FIQA 4CCZA 2YL8A 1O1ZA 4UZUA 4FR1A 1HUVA 2FZDA 3NZPA 4QW8A 4KIRA 4QJ1A 4HNUA 3TWBA 2EBNA 4QS6A 2QT3A 1QOQA 3IIOA 3UJRA 4ZZ9A 3EPMA 3NL2A 5IHRA 3T44A 4AY8A 3CL7A 1JQXA 1HJWA 5HOSA 1C7SA 3IACA 2PMQA 4IL2A 1QR7A 3WK3A 4KRTA 4XK2A 4XZWA 2ALZA 1CDGA 4GXWA 1V77A 4F0SA 1YKWA 2RJHA 2CYGA 3H54A 4Y90A 2GL5A 3VNDA 3K8KA 4P5UA 2Y8UA 5HNTA 3SRDA 1EOMA 4XIMA 1BSIA 4JNZA 4Z1DA 4L9ZA 1LLWA 1GCYA 1V3IA 4HPJA 5HJXA 3KRZA 1YW1A 4AB4A 1VB9A 1Q8AA 4LXFA 4LVGA 3LY0A 1BEUA 5EDWA 5KFAA 2FB2A 3RB3A 3CZKA 5CPOA 1GEQA 5E70A 1PUDA 1A53A 6REQB 1I2PA 3INPA 3M5VA 1TCMA 1FHVA 3SGZA 2FDSA 1MI3A 5AC4A 4ZB0A 4GI6A 3UWYA 5IBXA 2NQ9A 3P67A 2BHUA 4IXHA 1AMYA 1IEXA 3AXKA 5EMKA 1TO3A 2GQAA 2X41A 1G0CA 3RF9A 3AMCA 4Q8WA 2OSWA 1VCVA 3SB0A 3T05A 1S46A 4ZL1A 4NRRA 4FZIA 7ENLA 5DCBA 3UCQA 1KWKA 2OLAA 3PWIA 4JTAA 4GNVA 2J8FA 3ITCA 1W9BM 5F9NA 3G2GA 4I9MA 1UZDA 3BK0A 3OIHA 4GCXA 4XD5A 2Q8ZA 2C14A 4AD3A 3BANA 5ABEA 4RCXA 1UQZA 4CQCA 4GYPA 2J7FA 4YQWA 3MA8A 4U2ZA 4WY0B 3TW7A 1TE6A 2FVMA 1MNSA 4FBTA 2AGOA 5RUBA 2NV2A 4GJIA 3EWUA 1W3LA 4S3KA 1EKOA 1RYSA 2YFNA 4F0HA 3SUTA 3ISIX 3O9NA 3KL5A 2ISVA 2OTDA 4LV4A 1RXOB 4P7QA 2WHMA 3EA1A 3B40A 1GOXA 1V0MA 3K1GA 1CZ1A 3IUIA 4JTRA 4GVFA 3SSZA 3QMSA 2J74A 1V3LA 3TONA 2YW3A 1YYAA 2QVNA 2ACQA 3UWQA 1FFQA 4M3PA 5GNXA 3WKZA 3C2OA 2Q8LA 2HQAA 1SVDA 5BYWA 1ECEA 4HMDA 2CZEA 4AEOA 3L5MA 1EX1A 3G1YA 3T55A 3ABSA 2E1DA 3L2MA 2WJDA 4GH3A 1UIPA 2A0NA 1CGVA 2RDTA 3SN0A 4Q8VA 2O7SA 3HZ3A 3PPHA 3BSGA 4NQ1A 1FXPA 2BXYA 5KFPA 3EKLA 2QR6A 1JZ6A 1OZMA 3ANYA 3SCPA 4A8NA 2NVDA 3BV7A 4FXFA 1BSLA 3HQOA 4WCJA 1K1DA 4PL2A 4GZJA 4WY0A 1MRQA 2WV8A 4UCFA 4KCVA 1B90A 3PW4A 3DOPA 4ZSTA 2FLNA 3G8RA 3PR5B 4IR1A 2DSVA 4ICNA 2CBVA 4Q8TA 4PUJA 2HV5A 4B3ZA 3GIPA 4LOCA 4YTRA 3G0SA 2OR2A 1XYCA 1ADDA 3BAXA 1U83A 3RUBL 4MFEA 1NDYA 2J7EA 4IICA 4GIYA 1OYAA 1J96A 3XISA 3CPGA 2ZZ2A 2VR5A 4YYCA 3MDWA 5U7SA 3RAQA 1VYRA 3GYEA 3G1FA 1ONRA 2LLEA 4M5PA 1RCOB 1I9CB 3B4UA 3GIYA 4JY9A 1MRAA 5I23A 2ZUNA 1O66A 2Z7GA 1XD0A 2ZA2A 3DYMA 4C6DA 3GIQA 2XUCA 2VI0A 1MWOA 4JCLA 4RNJA 3W74A 5T14A 4K8HA 1DJYA 3EPNA 4C65A 2WVVB 4J9OA 1A50A 2FQIA 3APTA 3RLGA 3KDNA 1V3MA 3MI3A 4CEXC 3L67A 3WLQA 3BLFA 5A8GA 1VIWA 1X98A 4MNLA 4PEEA 3W26A 4MY8A 4O3PA 4DL7A 1FDYA 3EWDA 1W1PA 3BICA 4QITA 1VYSX 5A2BA 1JUEA 1BKHA 4WDXA 3WF4A 2V4QA 3CV6A 1MDLA 4UR8A 3MZNA 3ARSA 3TLLA 1KXTA 2UZ9A 1ISZA 3WK0A 5L9FA 1QFEA 4AF0A 4GC7A 2X2GA 3VGDA 3CUIA 2H9AA 3MUCA 5LZLA 3UNDA 3CXOA 1VHCA 3TYUA 2ASJA 2INZA 3EOUA 1ZBWA 3GDLA 2CZFA 5FEWA 3JU2A 5DY3A 2XM1A 2JQXA 1UWSA 5FD0A 1NOWA 5AHLA 2BY3A 5DCDA 2YX0A 3MMTA 5HR7A 3W1UA 3IJIA 3MP5A 4MGGA 3SO7A 2PWVA 1Z69A 5LIXX 1H09A 4IPNB 1FTXA 1QO5A 5CJMA 1EO7A 2BVDA 2R8WA 1PL9A 3VD5A 1KM2A 1QPNA 1A3WA 3SM0A 1KBBA 2ISFA 4F4ZA 5D8WA 4XVEA 2ISSA 3AIEA 1QU4A 3RX2A 1XBZA 3MKVA 3GHUA 4GABA 1ONXA 1TVLA 2IPJA 3W87A 4O53A 3HURA 1PHWA 1F6PA 1E0VA 1J0KA 3SGUA 4DF2A 3LPGA 3LPFA 4L9YA 4ED8A 2XCAA 2A7PA 1KCZA 4Y9NA 5LNWA 2V3DA 3B05A 2CNCA 3IJ8A 2DVTA 2NQLA 4J3XA 3UXDA 3W1NA 1YEYA 4TO8A 3NDOA 6TIMA 2IKIA 3ZJ6A 3CYVA 2KX9A 2VTFA 4RXFA 4GH1A 2F8QA 2PWUA 2ZX6A 1S0MA 3V36A 3HGSA 2VEMA 3GDBA 5F4WA 3Q8PB 3WJSA 3MFIA 4LALA 1JIBA 2A3LA 3H2FA 4AIBA 1BLIA 2GJLA 3MP4A 1D8CA 3H70A 4QE4A 5D32A 2YW4A 3PPCA 1LQ0A 2VEIA 1JYVA 3CZLA 4W5ZA 1IR2A 3BAIA 4ZE4A 1X97A 3KL3A 7A3HA 5A6JA 3V3WA 3MHGA 1EJ7L 1Y0EA 4B2DD 3UXAA 1KGUA 3TQVA 4R88A 4AWEA 2C3ZA 2VEPA 4MJ2A 4CCEA 3VIFA 2PDNA 4J9KA 1M68A 1NDZA 5AY7A 1VBHA 4BI7A 2WQPA 3FGCB 3OA5A 4GISA 2AL2A 1V02E 3GIJA 3M64A 3ONCA 1FKWA 3JR2A 4ZVJA 3R8GA 2JE8A 4J5NA 4Q4SA 4RW5A 2P76A 4BZYA 3MY9A 4Y9MA 2DP3A 4NL1A 4D6IA 4J2PA 4A21A 5TBOA 3S8HA 2PSNA 3VA8A 4IQJA 5KT5A 7PTDA 1FHUA 3CHFA 4H8VA 3W85A 2OWCA 3MI2A 1V3JA 4W87A 3RN6A 3KHDA 3PW2A 4L4OA 4Q8PA 1FDZA 3B8WA 4F79A 4I9AA 4EBEA 2X1RA 5REQA 5HPCA 2C15A 5D2WA 1YPFA 1TJPA 2J88A 1P4CA 5FJOA 1X1OA 1N7KA 3IK2A 5ECUA 2ZDSA 1Z41A 4Z1YA 3PFRA 3TK7A 3SY5A 3TROA 4DL4A 1J0IA 1UHVA 3UWZA 4O1DA 1NSJA 2FDMA 3U9IA 4LANA 4YR3A 4QWDA 3T0AA 3GK0A 1S3TC 4GUIA 5KFNA 2F2HA 1UKTA 2L5HA 4AMAA 2V67A 2DT0A 4QBXA 3W2KA 3MT1A 4ICCX 4JTJA 3AAMA 3CH0A 3QPEA 4IGHA 3EDDA 4F3HA 1M5WA 3W7KA 1V4YA 3AFBA 3NYZA 3VNLA 3QV6A 1AFSA 3VKAA 3T08A 2Y8KA 3C2VA 1JDEA 1DHPA 4XV0A 3WNMA 1CW2A 4DNHA 4PYSA 2D0FA 5H8UA 1XRSA 4DL5A 1CPUA 1XH2A 3GW3A 2GPTA 3DHUA 4UNLA 3SN4A 4HCHA 3WZ0E 3PTDA 2HK1A 4Z2JA 1KA9F 1QNQA 4W9TA 4PULA 1ISVA 2DZPA 3QOKA 1KM3A 2NUWA 4WDTA 1X96A 4O3QA 1JCMP 4O8AA 1BPLB 4O1BA 5CG7A 2O92A 2ABAA 3RRXA 3RX4A 2BB0A 1QMLA 2YA0A 2BDQA 4DWSA 1TR9A 4WF7A 4GFIA 1S3HA 1FWFC 1WCGA 1FHDA 5AHNA 3U8GA 3KTXA 4LAKA 3G3DA 5KG3A 3MU7A 2QPUA 1J10A 2OZTA 3W6YA 4B16A 3CB8A 4HU3A 3CS2A 2BVTA 4IZGA 1HJXA 3AMKA 2J9YA 2R8IA 2PZ0A 3MJYA 4TXEA 5T91A 3CIVA 4KQNA 3S5ZA 5M17A 1H0GA 2VRQA 2WMIA 1KXVA 1VS1A 1RLCL 1JNEA 3W82A 1A5AA 2VX4A 3A4JA 1KC7A 5BCAA 5I06A 3KVLA 3F7JA 4S3EA 1A3HA 2QCNA 1YPXA 5MKGA 5D05A 3WJYA 1GKRA 4RU9A 3EX3A 2Z4GA 4JEQA 5FEZA 3TCEA 1WP6A 3FDSA 1XCWA 4JIQA 3WK2A 4E2OA 2NXGA 3K46A 4NYYA 4Z08A 4A3HA 4YTTA 1A5LC 4YVXA 3FKRA 1ZAIA 4G7EA 3WG6A 2AOSA 3R11A 3L0NA 5DF0A 5EFDA 2WZTA 2B7OA 3NAVA 3REQA 3GY1A 5CBJA 3UJFA 2A7NA 2HVOA 3GDRA 2G50A 1VZWA 1LG2A 3QKZA 3VZXA 4Q8MA 3O6DA 1TMLA 4LS2A 2ZQ0A 3AXXA 1I2RA 2QCEA 2VEGA 2HNEA 4KEMA 1JQVA 1KFKA 4GZ7A 4ZBCA 1CXEA 1OFDA 2VX6A 4MDOA 1W1IE 2V9WA 1F8MA 4ACYA 5DQPA 3GH7A 3NG3A 2NLYA 1VRDA 3U48A 1IEIA 3WF0A 3V18A 2JGQA 2BY2A 4QG6A 1QAPA 3LU2A 3CT7A 4PODA 3WLMA 2JIWA 2R82A 1ADOA 2VOTA 4GCAA 3GV5B 2QUNA 5FESA 1B54A 4C6CA 2QZRA 1HL8A 2X8RA 2JEFA 4FLRA 3H40A 1XSKA 2WO5A 1E1FA 3KS5A 1QI3A 3OLGA 1QWKA 2PWEA 2R94A 4Q6XA 2PTXA 4RR4A 4LEFA 3ALFA 3GG0A 4QWCA 4IQLA 4PB5A 2YDRA 1BYBA 1MQPA 1PTAA 3V0UA 2EKGA 2IBKA 3EKGA 1SJDA 3NSXA 1AW2A 1GTEA 3PM6A 1QUMA 4QTGA 3W9ZA 3NQMA 3OHBA 3DFHA 5BRPA 1HIZA 1TVNA 2VCCA 2HROA 4H6RA 3W7LA 3LYEA 4NLGA 5A69A 3LI0A 4FXJA 1J2WA 3R12A 4JDYA 4GQ0A 3STCA 4HYKA 1XYFA 4KESA 1WZKA 5DQIA 4M81A 1JR1A 4NZ4A 4YJ5A 3KHHA 4INFA 3M0YA 3T2PA 4C6QA 1B3YA 4MFDA 3CWOX 5FAGA 4H2HA 4B5TA 1Q7ZA 1UWIA 5AZ1A 3SRFA 1V03A 4GUJA 4BF5A 3RMEA 1XXXA 3EWBX 3SUUA 2PZNA 4QEEA 4U33A 4P7NA 1O94A 4AMCA 2W6RA 3BOXA 4FSAA 5D33A 4IIBA 2ZXDA 2V4RA 4PSPA 5DG9A 3P7YA 1H60A 1RALA 5LKYA 2F2KA 3VDHA 1FXQA 4GQQA 3QHOA 4O52A 2XN0A 5LYRA 3V1HA 1RY8A 5FCZA 3WNPA 5HINA 3ZJ7A 4E2DA 4LYKA 3OTRA 2WSRA 3RG6A 4AF0B 1E4LA 4G7FA 1H3GA 3R94A 3RU6A 3EB3A 1IEQA 1LRQA 3REQB 1DPMA 4WJ8A 4HMNA 3MVTA 3NQ6A 4JYDA 4B5VA 3LBOA 2OOFA 4NI8A 3MPGA 2VWSA 1GOOA 4CD7A 3L9CA 2PPGA 3P8JA 4IRDA 4AWUA 4XZNX 2YDSA 5GNZA 3Q8QB 3HPFA 1TYGA 1V6VA 3GLCA 3XIMA 5CAHA 4GRSA 4GPNA 4C60A 1XF0A 3OODA 3QHMA 1WDRA 5H8PA 1TTIA 3E5PA 2PB1A 3GS6A 2XISA 2W79A 4O14A 2VFDA 5K7JA 1W3IA 4DF0A 2EAWA 4YP3A 3LCHA 4ZFCA 3T5HA 2ZX7A 2QV5A 2QEZA 2FLPA 3DI1A 2ZRXA 4FNPA 1HKVA 1E40A 3MSDA 3UVIA 3VCCA 1JPHA 1F4AA 4A22A 5IFPA 1UR2A 4HNOA 3EKZA 4HA3A 4YN5A 1L6FA 1I0DA 2ZBTA 5LNVA 1H7RA 4X60A 4PTMA 5XIAA 3MUIA 1LRNA 3LCXA 3GHSA 1F3WA 4I8YA 5A8NA 1JEZA 2V68A 4GQGA 1XG4A 2ICSA 1OQFA 1C8QA 2W8KA 4NYUA 1CB2A 3AICA 2A3HA 3BJTA 2YCEA 4PBGA 4JICA 3SCWA 4EKJA 4GIEA 3MKCA 2CU0A 4OZOA 4J9NA 2I16A 2YDQA 3MYOA 4YHGA 2Z2UA 2J6XA 3IIZA 4RZRA 4C6NA 4Z17A 3NSMA 1SZEA 5AC8A 3KWSA 3U6WA 3TXVA 3PR4A 1MUWA 2GLKA 2I7GA 5KG1A 4MMWA 3SCNA 9RUBA 3WBXA 3TTQA 1XW8A 4Z2HA 4HSNA 4V2XA 3EXTA 4E8GA 4LEQA 1YADA 3THDA 1XIBA 1TR1A 4M7TA 4MAVA 5LA1A 4IP7A 4W86A 5I7GA 4ML4A 1NTHA 1K8ZA 4HU8A 2A6LA 3H12A 5HBFA 4Q4KA 5AN7A 2HSAA 1FQ0A 2QNEA 2PDUA 1RJPA 1EUNA 3GZAA 3DESA 3QQWA 3VO0A 2EXOA 3O63A 3QJAA 5EWFA 3VOIA 3CAVA 2XTKA 1NP2A 1UBSA 1QW8A 3VC6A 3MUY1 3W1PA 5G1TA 3CMJA 5BMWA 1QPOA 1NARA 3HGOA 4GIRA 1IWPA 3ZO9A 4DPPA 2ZVIA 4IX0A 1QI5A 2NUXA 1WDWA 3UWWA 4H9ZA 3WL0A 2PLMA 3KBNA 2NVAA 1A4LA 1CGTA 2C13A 5C9UA 1SYTA 2ZADA 2VWTA 4ORMA 3I4KA 1BGGA 4H9TA 3PZUA 1R0MA 1GPWA 4TVCA 1DJGA 4GQRA 3PB0A 2OKTA 3T7VA 1TPH1 1GVYA 1EQCA 3BLPX 5IHSA 1EDGA 3KCJA 4WDWA 3FA4A 3NQAA 5KFEA 1S10A 3WQDA 4W8LA 2Y70A 4ZA0A 4RNOA 2XH7A 4KWWA 5E93A 3VD9A 4RV8A 1WYIA 4OTKA 4KW2A 5KFCA 1VFTA 5DCEA 4H2CA 3A4WA 4GC6A 1AJ2A 1DJHA 3GRIA 3UD6A 2WB5A 5B80A 4R8UB 3W2NA 2TPSA 3GH4A 3WQ4A 3H8AA 3ZVHB 1UCWA 1MXDA 4UQBA 3SEPA 2CFFA 4KGLA 3OLEA 1N82A 3ANVA 5GJPA 1O7AA 4XKYA 1BWVA 2WYSA 2OEJA 1MQRA 2CEQA 3QSRA 4ECTA 5A2AA 2BMBA 1XC4A 1UC4A 1B3VA 1P0NA 4CN6A 1HGWA 1XLLA 3FYPA 4JQ1A 1V5XA 3MS8A 1Q3NA 4I5UA 2G41A 4WQ6A 5AYBA 5GNYA 4B4FA 1LTDA 2BHYA 1XBVA 1DOSA 3NQGA 5JVLA 3WQFA 2GQ9A 3S0CA 1AVAA 1GG0A 4KFPA 2DJLA 4C7FA 4XZMX 1XQLA 3S2NA 4JTUA 4OUIA 4JY8A 5I3IA 3PBUA 4IISA 4Q45A 1SFTA 3M0ZA 5I00A 4A3QA 4E3VA 3CHEA 1JZ7A 3KOZA 1ZNNA 2QDGA 1L8NA 4JV2A 3I3BA 3QV8A 1J5SA 1DWIM 3KCLA 3PBVA 5I3JA 3OSNA 1JZ8A 4H04A 1JAKA 4NP7A 1XDLA 1WKDA 3FGCA 3KRUA 1HTIA 1ISXA 4DXVA 1M7JA 4JFWA 1G4TA 2WJFA 4EBDA 1XLFA 4LCRA 4RDZA 4A6GA 3B9EA 3RM9A 4U4MA 3C8FA 4LUSA 2R8KA 4KH2A 4YPJA 3ABQA 3U0HA 4DL2A 2DV0A 3TN5A 3FYOA 1E5NA 1HKJA 1UYQA 1FCQA 5DO8A 5DMYA 1VFOA 1J0JA 8TIMA 3LS9A 5CC5A 1O95A 2YA1A 1B1YA 1QNRA 4O12A 1VRXA 2FH8A 4IWWA 4MZ1A 4FB7A 4GY7A 2VX5A 3GTIA 3BCJA 1IT8A 2PWDA 1T96A 1GHRA 3P81A 3V6KA 1VF8A 4F4XA 2C1HA 1ZZMA 1E6XM 3KS6A 1UP2A 1TV7A 3TA9A 3GTNA 4CN1A 1UR3M 3QRHA 4D6CA 3VMOA 4KWOA 2E6AA 1J01A 5G1MA 1M7XA 3M6DA 1TPVA 3W86A 1SW7A 5LXEA 1KBKA 7REQA 3A9IA 3CMFA 1DE5A 3B03A 4MLRA 5KG5A 3WEZA 3C61A 3WLHA 3DENA 2YA2A 3VUPA 4HPHA 3WD2A 2FJUB 3GIKA 2XFFA 1NF0A 1XSIA 4TQSA 4GBUA 1S5VA 1IXOA 1AZ2A 4U31A 5CH9A 4JHOA 4MWAD 1DIKA 2BWGA 3VKKA 1Q6FA 2YR1A 4PSRA 4YS1A 3O6AA 2QCHA 1UWQA 1FWNA 3OLDA 1R3RA 4TQRA 5AYXA 4E38A 2HTMA 5FF2A 2Y6ZA 1RD6A 5DLGA 4HSHA 5KT2A 1LWHA 3KBWA 5DG7A 4OKDA 4IJRA 3ICJA 5EMMA 2ZE0A 3O07A 1GQJA 1WDQA 3FVDA 3O1NA 2W63A 3H6OA 2BODX 1UD6A 3GXTA 5AC5A 2C7FA 5CZTA 1KB3A 1VAHA 2YXGA 4ORIA 1U22A 4H7VA 3TJ4A 2INEA 3QGAC 1CECA 3A3WA 1KGXA 4LC6A 1JULA 3LGEA 3H7UA 2BGSA 1SQ7A 4XZIA 5IM51 3CIWA 4BWLA 3APGA 4KEZA 1XL9A 3CMGA 3B97A 1EOKA 3NPVA 1QCWA 1L9WA 4GC4A 3OVQA 5CPNA 2WC4A 3CK5A 2ODOA 2HEJA 2WSQA 3I3EA 2E6DA 1DJZA 4URIA 4KS0A 1FWDC 5TF0A 3R10A 5F7UA 1S2WA 3GUGA 4K3ZA 3TTSA 2TODA 5KZDA 1EPXA 4M7SA 4MZYA 3OSPA 3EOSA 2CXGA 3VIJA 2QLYA 3OGVA 2HBXA 2GUBA 4W8AA 2BZNA 4F0KA 1W3NA 3ZR6A 1V7YA 4UMAA 5CJNA 1JVNA 4HK7A 4AISA 4LUYA 1A49A 4I7UA 3WD4A 3S2CA 3QVQA 1R86A 5DX7A 2X30A 4NZCA 1E4IA 2ZC1A 4QS5A 3U5YA 2CZDA 3SI8A 1WZLA 3LCFA 4K36A 5FJIA 1L2QA 1I60A 1MZRA 3R4IA 4RE3A 5CPMA 2G8ZA 4LU0A 3MCMA 3UG4A 1M53A 4A2SA 2ZUUA 3UFYA 1BTMA 3RFAA 4TU1A 2R1PA 1SR9A 4IMAA 3WBWA 5EWEA 1XR2A 3B9DA 1S5TA 3LBCA 1GVSA 3FXYA 5HULA 3DYOA 2W61A 1XBYA 3DERA 3GNDA 1E6ZA 3EAUA 1W17A 1TRDA 2ANUA 2B31A 2QUTA 4MJ4A 1SO5A 3HU7A 4QX4A 2HS6A 2HISA 1PYMA 4EE9A 1YE6A 2V30A 3ME3A 6XIMA 4GWEA 3E38A 3J7HA 4DL6A 4C6LA 2VC9A 3O16A 5HA7A 1XC6A 4BJHA 4CGTA 1UPMB 1K70A 4HZ6A 4XZ9A 3EDKA 3TMQA 1J0HA 2RUSA 1JCNA 3QXBA 4FK9A 1GJPA 1MEWA 1V6YA 1QVBA 4HT3A 1UG6A 1K7EA 1DQXA 2QJMA 4KETA 3QN3A 3DG3A 3W37A 4F9DA 2DQWA 3LXAA 4H3DA 3UCCA 4XTDA 4JKMA 4QR6A 3U4FA 1LP6A 3P60A 3W25A 5EYWA 4HNTA 1FCBA 2HPMA 1E73M 1M41A 1UQYA 4N0RA 2QKFA 4HIBA 3GC4A 2WJEA 3VDCA 2CLIA 1KM4A 3XINA 1TWSA 3LBMA 3DX5A 4M24A 5AVNA 2XVGA 3OYXA 2QJJA 4HNNA 2PGRA 2YL5A 4RPPA 4CNNA 4MJZA 4TMBA 3MKKA 4TX9A 2XGZA 1UJQA 3DYPA 4QHRA 4NZ5A 4AWTA 4HTBA 2NZLA 4OOZA 1C9DA 2IPWA 4CCDA 3WD1A 5E9XA 5K3VA 4LH8A 2PDCA 1X39A 3G1AA 3NYDA 3EZ4A 4IMEA 4UQDA 4XB3A 3M0XA 4AZIA 2BS9A 5G1YA 3EDJA 1KV8A 4JTGA 1R38A 4RUCA 4YIWA 3S2JA 3UP8A 3AHZA 1TTJA 2VCBA 3PSWA 3NZGA 4G7EB 1PCWA 1MYRA 1S2AA 3N17A 1F4HA 3O0KA 4DBUA 1TWZA 4L6OA 3MUZ1 2CITA 5KFRA 2Z26A 3MBFA 4CNPA 1MW0A 1P1MA 5CJ5A 1ZAHA 3TZFA 3VU2A 4B91A 2EG6A 3W71A 5C2GA 2PDBA 3W7GA 4B9YA 3U5UA 2VFGA 2X0YA 1QW7A 1A0CA 3AZTA 1QOXA 1N55A 2FPYA 1E0XA 1XDJA 3PVFA 2IMRA 1SFJA 1WPCA 1A5CA 3LTYA 1D3CA 4PH6A 2Z7KA 4L1GA 4JTQA 3NQ2A 2XG9A 4JKKA 4L4LA 3L4VA 1EDQA 3NEHA 4YU1A 1GQLA 3TOYA 5CC3A 1S2UA 1OGBA