1XRFA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
423
structure length
363
Chain Sequence
WMLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLDRLALIEGVKRGIIDCFATDHAPHQTMPGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotase
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 127
structure length 363
sequence length 423
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrfA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrfA02
1PO9A 2GSEA 3N2CA 3GGMA 4C6JA 4C6EA 1YBQA 4CEUC 2Z7GA 1FWFC 4C6DA 1J79A 2R1MA 1V4YA 3LGGA 1RJPA 2FTYA 3HM7A 3F4CA 4ERAA 3QGKC 3GUWA 3AU2A 2GZXA 2RAGA 4CNTA 3IV8A 4ERIA 1RK5A 3UPMA 3B40A 4IFKA 1PTAA 4B3ZA 3S2LA 1JGMA 4DZIA 3RYSA 1QXLA 2PLMA 3S2NA 3LY0A 1NDYA 2HBXA 1A5KC 3MTWA 3T81A 4GOAA 3WYZA 4DIAA 4G2DA 3LSCA 4ICMA 2HQAA 4IG2B 2OB3A 1BF6A 4UB9A 2YB1A 4KIRA 2R1KA 2WJEA 3JZEA 3E2VA 2DVXA 4ZSTA 3C86A 5HMEA 3CJPA 3UF9A 2EG8A 4HJWA 1ZZMA 2FVMA 1EJUC 4LAMA 1I0BA 1NDVA 2QS8A 4BJHA 1M7JA 2Q01A 2AMXA 1UBPC 2Z26A 1VFLA 2Z4GA 3E0LA 2VR2A 3CAKA 3IJ6A 4CQDA 4H9XA 4LEFA 4GBDA 3AU6A 4GK8A 4KESA 4JOMA 4C6LA 2Q09A 1IE7C 1EJWC 1A5OC 4R88A 2VC5A 5G4HC 2I5GA 1XWYA 1RK6A 4NP7A 3CS2A 4KEUA 1EZ2A 4C6PA 3IARA 1YRRA 4HK5A 3DUGA 4LAKA 3MDWA 4D8LA 2QT3A 4CQBA 1A5NC 3F2CA 2XIOA 4KETA 3MPGA 2Z27A 4Z42C 4LANA 1RAKA 2VHLA 4GX9A 2Z2AA 3RCMA 2VC7A 1P6CA 2I9UA 4MUPA 3TNBA 1YMYA 4XAGA 2VUNA 1UIOA 4G7EA 3K4WA 4GZ7A 4KERA 4B92A 1K70A 2AQOA 3GTFA 1KCXA 1P6BA 4NG3A 2OQLA 3GTXA 4RDWA 3ORWA 1KRMA 4H9VA 1EJXC 1ADDA 1KRCC 4GXWA 3TN3A 4GY0A 2WJDA 3EWCA 4HA0A 1FWEC 1RJQA 2PAJA 3S2JA 4DNMA 4DZHA 3B0XA 3DC8A 3ITCA 4NI8A 3OODA 1FWGC 4PCPA 3TN5A 1FWDC 3MSRA 4IFOA 4I6VA 4KQNA 4DI9A 2HNHA 4IF2A 4EP8C 4C6KA 1V51A 3FDGA 1EJSC 1YNYA 4LCSA 3OVGA 3UR2A 4B91A 4C6BA 5HMFA 2GOKA 4XAFA 3OJGA 3QGAC 3NEHA 3PNUA 3GU1A 3QY8A 4RDYA 4OFCA 3QY6A 2HPMA 1FWJC 3BE7A 4DYKA 3O0FA 3MJMA 4LCRA 1P1MA 3GTIA 1ONXA 4C6OA 4H00A 4CNUA 2KAUC 4P5UA 3O7UA 3IRSA 3D6NA 2UZ9A 1I0DA 4YIWA 2ICSA 5AKQA 2Z2BA 3MVTA 3OU8A 1WXYA 2HBVA 3HTWA 1FKXA 3GTHA 4IG2A 4C65A 4LCQA 2GWGA 4BY3A 3PNZA 4RE0A 4C6FA 3E38A 3MKVA 3F4DA 1POKA 1EF2A 1ITQA 4H9MA 4EPDC 2OOFA 3K5XA 3PANA 4B90A 4PBEA 4PCNA 4KEVA 2FFIA 2ADAA 1V77A 2Z25A 3SO7A 5FSEC 1GKPA 4IGNA 4KF1A 2P53A 3AUOA 4BKNA 1NDWA 2IMRA 4INFA 2D2HA 1PB0A 3PAOA 4DI8A 1K6WA 3K2GA 2Z28A 4CQCA 3F2BA 3LU2A 3RHGA 3URQA 4J35A 4CNSA 1EYWA 4WHBA 4WGXA 3FEQA 4LFYA 3LNPA 2W9MA 2UBPC 2OGJA 3UBPC 3DCPA 1XRFA 3IPWA 2ZC1A 1UIPA 4I6KA 1ITUA 4AQLA 3F2DA 4DO7A 4XD3A 2D2JA 2QPXA 1RJRA 2Z24A 4M51A 4XD6A 4LAOA 1RA0A 4XAYA 5FSDC 3RN6A 1EJRC 3LSBA 2E1WA 3G77A 1EJVC 4ERGA 2PUZA 4WVXA 4XAZA 4ZSUA 1NFGA 1QW7A 4DLFA 1M68A 3E0FA 4C6NA 2FVKA 4IFRA 2YZ5A 4J2MA 3NURA 1FWAC 4IFKB 3TN6A 3LA4A 2PGFA 2BB0A 3UR5A 3GG7A 2YB4A 1J5SA 3NQBA 4XD5A 1FKWA 4PE8A 4PBFA 2P9BA 3GRIA 4C6IA 1XGEA 5CH9A 1V79A 4H9TA 1KRBC 4H9UA 3WMLA 1EJTC 3B0YA 2O4QA 3ICJA 3QY7A 3URBA 1RA5A 4F0RA 4EPKA 3MVIA 1GKQA 1KRAC 1E9ZB 4L6DA 3URNA 4GYFA 4L9XA 2F6KA 2R1NA 4IGMA 5E5CA 3HPAA 4GY1A 3URAA 2GWNA 4QROA 1A4MA 2PGRA 2R1LA 3A3WA 4XD4A 4R7WA 1POJA 3MDUA 4UBPC 1E9YB 1J6PA 1UMLA 4QS5A 4QSFA 4R85A 4E3TA 1R9XA 2HPIA 4C5YA 3OOQA 4H9ZA 4J5NA 4LH8A 1A5LC 4RZBA 1WXZA 3PBMA 3FDKA 3EWDA 3GU9A 3WZ0E 4C6MA 1K1DA 1O5RA 2P50A 4V1YA 3A4JA 4AC7C 4V1XA 4GC3A 3T8LA 3ID7A 1ONWA 1R9YA 2BGNE 5A6TC 4TQTA 1J6OA 4EPBC 4HK6A 2EG6A 4GY7A 1R9ZA 3GIPA 2G3FA 4H01A 1PSCA 2O4MA 2OODA 2CZVA 3S4TA 2D2GA 3LGDA 3V7PA 2A3LA 3EGJA 1FWBC 2QVNA 1W1IE 3A3XA 1HZYA 4QRNA 3GIQA 4F0LA 3S2MA 1GKRA 4EPEC 2Z00A 4G7EB 5HMDA 3IACA 2WM1A 3OQEA 2YXOA 2Z29A 1S3TC 1M65A 4QTGA 3R0DA 1DPMA 3IGHX 3E3HA 1FWHC 3GU2A 5LXXA 4H9YA 1O12A 1V7AA 2ANUA 1A5MC 4GX8A 4F0SA 2AQVA 4DLMA 4C6CA 1FWCC 2EG7A 1FWIC 1YBQB 2DVTA 3LS9A 4C60A 4LALA 2Y1HA 2VM8A 1XRTA 4C5ZA 3SFWA 1A4LA 1YIXA 3ISIX 4C6QA 3E74A 4RDZA 3T1GA 3TN4A 4HK7A 4RDVA 4CEXC 2R1PA 2E25A 4IH3A 2DVUA 3KM8A 2FTWA 4KEZA 4IQJA 1NDZA 2WJFA 4QS6A
chains in the Genus database with same CATH superfamily
1M41A 3G1RA 4Q44A 3CTTA 4CEUC 2ZOXA 4HSOA 5C6MA 3W7HA 3C0LA 4EAYA 3UG3A 4LF2A 1K9TA 5FJRA 2ESCA 2YIHA 3TAKA 1QO5A 1Y8BA 3PUOA 4IP7A 4QJ3B 1EJ7L 1OFRA 3MUAA 1J12A 1G6CA 4YQWA 1UBSA 1R3WA 3TOYA 1HQTA 3IJQA 4XX6A 3B9DA 1R0MA 4F2TA 3UNDA 5I2UA 1ISVA 3GH4A 1D3CA 1NOFA 1E3ZA 3UWUA 3M0YA 3BZJA 3WMCA 3P67A 4Q3MA 3W72A 1M5WA 4Q32A 3W28A 1JRCA 4NNCA 3THAA 2VA3A 4LAMA 2ZRVA 4LXFA 4BJHA 4PB3A 1TJ2A 4J2PA 6TIMA 1JCJA 3VKBA 1H11A 2D0HA 1G0CA 1KM2A 2PU0A 2Z4GA 4CU7A 4CQDA 2WHLA 2FKPA 4BI5A 3QR1A 3PPFA 4S2BA 4GIEA 3OYZA 1REQB 4NP7A 1OZMA 3CS2A 4D71A 5KTLA 1P43A 1K9FA 3GXNA 3GDRA 2EPNA 3PULA 4IL0A 3F2CA 2VEMA 3OIHA 3VE7A 2E6YA 2VHLA 1LROA 4Q4SA 5JUMA 2VC7A 5HQEA 1GEHA 1WDQA 1JDFA 2OEMA 3DFNA 5KFIA 2VUNA 5C0QA 4QX4A 3UERA 3EYPA 3HPXA 5A8MA 1TV8A 1QPKA 3KBSA 1K70A 5DQHA 2J8FA 4POCA 2HXUA 4A3RA 3VFCA 4F4WA 1UKSA 5DG9A 3LERA 3NL5A 4WJEA 1X1OA 4QJ1A 3S2JA 4GGHA 3EMQA 5K4ZA 1XIBA 3T4WA 3VYLA 4EAMA 3KBWA 2VFHA 3GZ3A 3N6HA 3RX3A 1YKWA 2A6NA 3LG3A 1W54A 2J8GA 4MZ1A 1GOKA 4RNJA 4S2CA 3UCQA 4N9EA 3W7CA 4K39A 4XO7A 5CPTA 3VKAA 5BOOA 1MW0A 3DBNA 1XINA 3BAIA 3UETA 1YDOA 4ADSA 4RDYA 5EMYA 5FJPA 4OFCA 3VD5A 1IGSA 4JTAA 2GJLA 3CASA 1OFPA 3RPMA 1P1MA 3KWSA 5KFAA 5DELA 3O2LA 3P74A 3T78A 1XIHA 2V5JA 3FHQA 4HPGA 2F38A 4XQ6A 3AMKA 5D8ZA 3OU8A 4I5RA 4Q45A 1WXYA 1TV2A 4WDTA 2E77A 1HKKA 2Y6ZA 3E1F1 2GWGA 5AHNA 3ZVHB 3QV6A 5IHSA 5KFQA 2A2IA 3P6LA 1ZP4A 5F4XA 3WUFA 3GV8B 3GWQA 5FAGA 5FJJA 3FNDA 4RUAA 4ORMA 3KHRA 3SDOA 2PGWA 5FKYA 4HNCA 1EHNA 4FNQA 1MQRA 2IW0A 1GCYA 1X8FA 2ABBA 1IIGA 2DSKA 3JS3A 3O6AA 4NX0A 3KCJA 3QXBA 4W84A 5DN1A 2PTDA 4FS1A 3DENA 4YPJA 1DQUA 4DF1A 2OGJA 3IPWA 3PG9A 3W7MA 1HP4A 2D2JA 2B4GA 3B97A 3SQSA 3CL7A 2PC8A 1XGZA 3QOKA 3W81A 2QULA 3G1YA 3CMJA 3H2NA 4E2OA 1D7FA 4L4PA 1LUCA 4WY0B 4XISA 5EYWA 3PSWA 2Z6IA 3ERPA 1I2NA 3JU2A 4DLFA 1M68A 1IHIA 4JIIX 3U48A 3R89A 4JNMA 1N7KA 1Q6FA 1PUDA 4KFPA 2PDKA 4NI3A 2JFEX 4HPHA 1EIXA 2J7HA 3H53A 4NJKA 4G5DA 1IZJA 5KFGA 2QVHA 3WJZA 1AG1O 2PWDA 2VFEA 1AODA 4LPCA 1DJZA 2DJLA 1TTJA 2C13A 2EPLX 1OZQA 4O54A 3NO1A 3ONCA 4XVEA 3NGJA 4JTUA 4DYEA 5G1TA 4B5VA 1JZ8A 1UPPA 1MVYA 3RM8A 5JH2A 3RFAA 2C3ZA 2ACSA 3FX4A 2V68A 3T0DA 3RNDA 3AO0A 4KEMA 1Z42A 2WZHA 1ZS2A 4HOWA 1OC5A 1ZBWA 4F3HA 1KXHA 1QW8A 4Q4QA 5I24A 4GABA 3LPFA 1K1QA 1KM1A 1CIUA 3GB6A 1ZQ5A 2AL1A 3UZJA 1GOIA 1DKWA 1YXCA 1VHNA 5H8UA 1H7WA 4XTDA 2VGGA 3NM3A 5C5JA 3WBXA 2EG6A 2CLOA 3CZLA 3CH9A 3ATZA 4HPXA 2DSUA 2D2GA 1J0ZA 3Q58A 3CAQA 3WFZA 3M9YA 2G8ZA 6PTDA 3S2MA 1C9WA 4EPEC 4Z2LA 3N13A 5HMDA 3IACA 4FIQA 4GUGA 2GDUA 1JDAA 1G5AA 4I9JA 4PB4A 1MUCA 4HSNA 1C9DA 1C8QA 1BXCA 3A5VA 2W63A 3E3HA 3QVQA 3HMJG 3L7RA 3RAOA 4GYPA 3VIMA 5FESA 4H04A 4IGSA 3LHZA 4ZEPA 4C6CA 1EB3A 1YIXA 2GGIA 5FEXA 1B30A 4H7VA 4C6QA 5HQMA 3WQWA 2WVSA 2X42A 5KG0A 4ECQA 2FPTA 3QMTA 3LHWA 1UR3M 1PO9A 3N2CA 1X96A 4MIMA 4C6JA 4JY8A 3KFTA 4G1NA 3UT0A 4IRKA 3W83A 1JCMP 5A6KA 1RJPA 2XN1A 3GH5A 3IVUA 1JPKA 5DQGA 2ASLA 2VL4A 4ZE5A 1EWEA 2Z0IA 5JUVA 1AD4A 1CB2A 4F2UA 2CLMA 3W6YA 4LV9A 4OOUA 3QJAA 3AROA 4ZODA 1BTCA 4JTQA 1JFHA 3R13A 6XIAA 1KBLA 2X1IA 4YJ5A 4H6KA 3CQKA 4LJ3A 3ZM8A 4LF1A 4PUNA 4ED2A 4GQGA 2ZRYA 3A9IA 4JV2A 2QEZA 5AB3A 3WNOA 1GYNA 5KFLA 3SCVA 3W76A 1UZDA 1W5NA 2HQAA 3ZSSA 3VOJA 4HOXA 3GNRA 2R1KA 5JBDA 2DVXA 1XLFA 2LLEA 4LBUA 2GL5A 5HMEA 1AFSA 5CSRA 3LTPA 3SURA 3BAKA 3MANA 3V0UA 3W07A 2WC3A 1FCQA 1KA9F 2MNRA 1SJCA 2QS8A 3W1AA 4DO4A 4ZOEA 2EGZA 3U7VA 2OO0A 2V30A 4CNNA 3ABOA 3C5QA 2YYUA 3C2FA 1SW3A 3KOZA 2FDMA 4OKDA 1VGAA 1AH3A 2E09A 1KLZA 3BANA 2NQJA 3H40A 2H9AA 4IJCA 1VRXA 3CZEA 4F4XA 1MUMA 1VH7A 1CPUA 3E5BA 1IEWA 3QR3A 4IJBA 1B9ZA 2GJXA 3LHVA 1P0NA 1ZAIA 3RCNA 5E0FA 2ZA3A 1HL2A 5FA5A 1P1XA 1XBVA 4GX9A 1DXIA 4Y8FA 4ZB5A 4C1NB 4H8VA 2E9BA 1XL9A 1GVRA 2WZMA 1I60A 1ZSXA 1AQ0A 4GZ7A 4LVFA 3IUIA 3MI3A 4XVDA 2AQOA 1SFSA 1L2QA 3QHMA 2FTPA 3CUJA 1P6BA 3T2QA 3NO3A 1XUZA 1EJXC 4KRUA 4FXFA 2Y5JA 4PCFA 1JJKA 3PJXA 1FXPA 3W02A 5CQ1A 2D2OA 4Z1CA 3H26A 3R0KA 5FEPA 5G1YA 3RLGA 2BTMA 3B0XA 1D9EA 2OXNA 3W7EA 1FWGC 2V6AA 1A3WA 2NQHA 1WQ5A 4O50A 2PU1A 1HN1A 3OO2A 5BW6A 1EYEA 3PJWA 1K3UA 4MDPA 1ZCOA 2R14A 3WENA 1FCUA 1MXSA 2CCRA 4LS1A 4Q8FA 5KG4A 2C91A 1O5KA 4IIGA 4NLGA 3PNUA 1CLKA 1RALA 4G6CA 3TIMA 1MZHA 3VAVA 2ABAA 4W88A 4EIVA 4DL7A 8RUCA 3TMLA 3FJ6A 1TJ0A 3WLPA 3Q65A 5DGBA 3TUUA 1OX6A 2EAWA 2J6VA 3DHDA 1FQ0A 1PWLA 1ZENA 4WRHA 3L2LA 3ZR5A 3AIEA 4ECZA 3VKCA 2GOUA 4BI6A 1A0CA 3GAYA 5I09A 4XZHA 1KXVA 3KHGA 1BYCA 2PEVA 3P81A 1O4UA 1XPYA 3C2EA 3OP2A 1TR9A 1E73M 2PDWA 3MWCA 5EMMA 1EFZA 5HWJA 2NV2A 1K6WA 2OYLA 4J35A 2OQYA 4RUCA 4N6FA 5T26A 4JL1A 5D2TA 3ES8A 7CGTA 1RYSA 3LRLA 4NJIA 1J01A 2QIIA 5T8GA 3K13A 3VIFA 2ZQ0A 4IMEA 1O7AA 1YXYA 2GGJA 3HN3A 4IMAA 2DT1A 4YWIA 2E9LA 4ROQA 2J7CA 4US5D 4O13A 4AX6A 4YN5A 4N2YA 2W92A 1QPRA 4US6A 1T3NA 1JDEA 3FGCA 1ZTVA 4U31A 3MMTA 2BQ3A 4AC1X 4L64A 1M53A 3AS3A 1J5SA 1O5QA 2RJHA 3SW6A 3L0GA 3ARYA 4QBXA 5C8BB 2VZUA 2ZXAA 4MWAC 4IISA 2NWSA 1BG4A 3GNNA 4UQDA 3BW3A 5ENLA 2VT0A 4PMJA 3D3FA 2PDIA 1P48A 2VR4A 2XG9A 1PIFA 1LYXA 3GD6A 4TMCA 5KG3A 2F6KA 3MYOA 2ZZ7A 3W1PA 3HPAA 4AVFA 3RUBL 2YFNA 3M7WA 3L9CA 3W24A 3VTRA 2R1LA 1QRQA 1B3XA 3L65A 4IWWA 4AG0A 3WZ0E 1W5QA 3ZVIA 3QPZA 1XYCA 1JDDA 3MYPA 4J3UA 3TC3A 1BWVA 4UC5A 3L67A 2C2DA 4YTRA 1DIEA 4QG8A 3LGDA 1ALDA 3WX7A 6ENLA 3NR0A 3CK5A 3LGEA 4YR0A 4F0LA 3RR4A 3GHRA 1O1HA 2PTYA 3FLUA 4ECLA 2OSWA 3WH8A 5IRPA 4B15A 5U4NA 4YHEA 3WF1A 1XUUA 3M41A 4GBUA 4GJ1A 4LAUA 3H2MA 3LZ5A 3WF3A 4Z2HA 1IT0A 3FSTA 1S3HA 3BJSA 1B0IA 3EWYA 4LALA 5DFAA 4OUEA 3KZSA 4NL1A 4X0NA 9RUBA 1Q7MA 1BRLA 2A85A 1H49A 2BXVA 3SIZA 1HXJA 2VFDA 1TIWA 2XISA 7XIMA 4U33A 1FDJA 4PGLA 4IL2A 4ED1A 8A3HA 1SO6A 4FNPA 4D6GA 1RCOB 2RFGA 3KAOA 1ZY9A 3KEHA 4BEUA 3RU6A 4IPNB 1QBBA 1WP6A 3GG8A 4GC4A 5CC3A 3UR8A 2VNCA 2PLKA 4ERIA 1LZOA 1PTAA 2G95A 4QE5A 1W9UA 1Z9AA 3AS1A 3K4AA 2V8ZA 4UNKA 4PFMA 5JQ9A 2XVNA 2QCEA 3OEXA 2HBXA 2CBIA 2PBOA 3CV1A 3NQGA 4UQBA 4DJDD 1SVDA 1XCFA 4C1LA 4FPSA 3GAKA 1OX4B 3QMSA 3V5OA 2YL9A 3BJYA 4GG9A 4RU9A 2EEXA 2WJEA 3A24A 3E49A 4ZSTA 1MQQA 4GUHA 2EG8A 1EJUC 3THDA 1FWNA 3PUGA 1QMLA 2OWXA 4PZVA 5A6BD 1T96A 4L1XA 5HUPA 1P5BA 4JQAA 1K9DA 1GJUA 3WCZA 3ZJ7A 4IMGA 1BVWA 2RGMA 1WAUA 2FB3A 4GBDA 3MUIA 4ADUA 3FA3A 3W6MA 4C6LA 1UKOA 4O4WA 2XIQA 4IPPA 1BYAA 1EZ2A 4C6PA 3CZGA 1LQAA 1ZFJA 2BY3A 3LK6A 5GVJA 3CMGA 1YRRA 4HK5A 2FQIA 1KBBA 3CMFA 2WPGA 3ARPA 1YHTA 2Z2AA 4XBSA 4OV4A 2E8YA 3S42A 4FLSA 4YTQA 3BAXA 3GXDA 4XAGA 2YKKA 3GS6A 3TZNA 3UGRA 4G7EA 1XDJA 5ABEA 5M1TA 1GVSA 3CWHA 1KRMA 1F3XA 5IHRA 1OINA 4DJEA 3OYXA 2VENA 3MB9A 4HKPA 5T9BG 3EPGA 1VBUA 2CW6A 1GEQA 2FGLA 3KS5A 3VKJA 1TJ1A 1QVBA 4R8UA 4PCPA 2VJXA 4BF9A 5A6JA 2HROA 1JI1A 3AHYA 2OYKA 5IFTA 2VWTA 3AIRA 3TYDA 1TE6A 2YOCA 4ACYA 2XGZA 2YJQA 1J0JA 3WK0A 1VFFA 2P0OA 4U6PA 2BOEX 2C2RA 1S2VA 4E2VA 4AIOA 1E1CB 4ATLA 1O1ZA 4C91A 4FP1A 1R3VA 4PRWA 4EWJA 1Y5WA 3DYMA 3N9SA 3LI1A 1XIGA 3LBOA 3G0UA 4JQ1A 4JQ2A 2IPWA 4JIRA 4CNUA 2WKJA 1EHAA 3RAXA 4KRZA 1JYVA 4YHGA 3S2CA 2PI6A 5CBBA 4ED3A 2I17A 4DL4A 2OO6A 4LUYA 4AVNA 3KTXA 1KBJA 1PIIA 1Z41A 2WMFA 3CAVA 4H83A 4JV0A 3SJNA 1TO3A 1KBKA 1UP0A 2GDVA 4MADA 4B9YA 1EO5A 2VMFA 5AHEA 4JKMA 2INFA 3SRKA 1I2PA 1VF8A 2YR1A 4GUJA 3MUY1 4O0QA 1QNQA 4MMWA 3GVWA 5CC5A 3PAOA 2Z28A 4S3AA 4EVZA 5C9WA 4CGTA 4MWAB 2W9MA 2J62A 3LLFA 4H6EA 4AQLA 1JYWA 4P8UA 1ZAHA 2Y7FA 3CL6A 2JGYA 1Z89A 1CDGA 4EE9A 2I5QA 4O4VA 4JTFA 1KBIA 4XD6A 2CKSA 4BZYA 5I06A 4PRTA 2PUZA 1T8QA 4ATDA 3WNPA 4JIHA 3NYZA 2PDYA 2R24A 5A69A 4MNMA 2ZUWA 2DGAA 5FF3A 3H7UA 3NL2A 3O06A 3W01A 3WF2A 1FWAC 1GQNA 3AI0A 3UZZA 3G1FA 1X39A 2ZE3A 2QAPA 3STEA 5LHFA 3AXMA 5HNNA 3P14A 2RGLA 4FOKA 1RBAA 4DL6A 2PSNA 1IEVA 3B0PA 4NNAA 1JFXA 3BV7A 2XYLA 1HKMA 1S39A 4EPKA 1PTDA 5HAOA 3DESA 5D33A 3U2OA 4F2BA 1O68A 2GQ9A 2PDNA 3L68A 3G2GA 3HU7A 2OWWA 2WSPA 1US2A 5E5CA 2QPSA 2HE5A 4GY1A 2YBUA 1T8XA 3VGBA 5FF4A 5BWFA 2WB5A 4QS5A 1A3XA 3EX1A 4DWSA 1GYMA 3P62A 1O5RA 2P50A 4V1YA 2QLYA 4GC3A 3PTKA 3BLKA 2R8WA 3NSXA 4S23A 3WJYA 3ZSTA 1KTBA 4NSBA 1NAL1 2UVVA 2W8KA 3CO8A 4FSAA 5IBXA 4AIUA 3BGGA 4E38A 3VIJA 1MO0A 3QMRA 3N6QA 3AALA 3H4XA 3KVLA 2OSXA 2ZWZA 2P3ZA 3HPFA 3ZJ6A 2PD5A 2DW6A 2WANA 3VIOA 2A3CA 5KEZA 2G50A 1S0NA 4RNOA 2R8GA 3OIXA 4Y96A 1UUOA 4P7OA 2DIEA 1I1WA 1ZJAA 3CZ8A 3ENLA 3WLHA 5AFDA 2P3EA 1K8ZA 4B4FA 4XAPA 3C56A 3PBWA 1XYAA 8CGTA 5B7YA 2PE4A 1NARA 2V3EA 3LTSA 2ZZ2A 2VOTA 4B5NA 5A6AA 4S3CA 1OC7A 3KDNA 4ZQOA 1FWFC 1LOQA 1YTEA 1M6JA 1XIMA 2P10A 2B7OA 3LGGA 3IV3A 3M0KA 3W1QA 3JUGA 3R7MA 2PWEA 3ZT6A 4XKMA 3KRZA 1KV8A 2GFTA 5KFJA 2PTWA 1BYBA 4BCEA 5HK4A 1R86A 4ACZB 4HNTA 5KFDA 3S2NA 1L6FA 3UWQA 4ZB0A 3VOCA 2XFWA 1NDYA 5DMNA 1PCKA 1RVKA 4M6UA 2Y0FA 1KNWA 1B54A 3GHSA 2GJNA 4AZGA 4JTSA 4ICMA 3HGJA 1TQXA 3T0AA 1GG1A 2YB1A 2V4RA 3N9RA 5DMYA 2J7EA 4EXAA 3T55A 4BK9A 3UF9A 3STGA 4EXQA 4HB7A 4LBRA 1NDVA 4YYCA 1NSJA 4N9BA 1H09A 1J4EA 3MP4A 1XV8A 4EYIB 2I1OA 4NZ3A 3TAOA 2VR2A 1XDLA 4MVAA 5LA0A 4JOMA 2DZUA 3EX4A 5CPLA 2VC5A 4P2VA 1V0LA 3VZXA 2ZRXA 1JCXA 2ZRWA 3WD0A 2W9BA 2ZX6A 3HA1A 4KETA 1C8XA 1HKWA 4LANA 5HWMA 4R3UA 2IPGA 2JIWA 2VX6A 4S1FA 3B0VC 3GTNA 3JR2A 3GSMA 5AVNA 2DUAA 3SBFA 2VFFA 1HJQA 1JXJA 2GQAA 4ZBCA 3T9PA 1KCXA 3KOXA 3RXZA 4NZ5A 4H9VA 4QG6A 2Z1XA 1P6WA 3R94A 4B5TA 2R8JA 3HGOA 3V0TA 3DERA 3IGXA 1V6XA 4HNVA 4GC7A 4P7NA 1E51A 4MJ4A 1JXKA 3F4WA 1CCWB 4JDBA 4LYKA 3KUMA 4S3BA 4JGDA 4H2CA 3G1VA 4DM1A 3GILA 5HBFA 4GIYA 5AC4A 4F0KA 3VX0A 1C8VA 2OQHA 2VQTA 4O3QA 3HG5A 1OGBA 2WCGA 3MUZ1 1OWQA 3MMUA 3C0SA 4M6VA 4J27A 3M5XA 2PURA 4MKNA 3TH6A 4AEFA 4AB4A 2J66A 4DPPA 3FKKA 5AC8A 2PWUA 1WDPA 1DL3A 4Q7BA 2XC9A 1RY8A 5JIPA 4C90A 2DSVA 3O0FA 2WQDA 1WDSA 4G8TA 1PX3A 3M0JA 1CWYA 3SSJA 1BG9A 1C90A 3OZYA 1GOMA 3ARZA 5HJLA 2QUTA 1ISZA 4S3JA 2BY0A 3I6TA 3ZR4A 2UY3A 3STPA 3FJ4A 1LBFA 2YPIA 2WSYA 1S9FA 3D5HA 4QCFA 4RPPA 2YLAA 1UQYA 3CQHA 4UTTA 1V77A 1J96A 1OC6A 1FWRA 2E67A 2P53A 1VB9A 3PW0A 1J8VA 3PBGA 4YXGA 1V6VA 2G3MA 2UY2A 2BBFA 4WGXA 4LFYA 3WNMA 4HPNA 4KCVA 2UBPC 4AU0A 2ZC1A 2XZ7A 3UW6A 4TQSA 4JKLA 1UWIA 5CLTA 4ECYA 1UC4A 3UWYA 1JEZA 1PIGA 1WX0A 1W2VA 1W3TA 3WG6A 3CL8A 3UCDA 2DZBA 4ERGA 3MC5A 4U5IA 4WVXA 3IJ7A 1JZ4A 3FFSA 1QW7A 3XINA 4MB1A 3VU2A 3LCLA 2R94A 3QQ0A 2WBGA 1VYSX 1TCMA 3QLDA 2VEFA 1NWSA 5CLWA 1VFUA 4GYKA 5SWUA 2OLHA 3RB4A 1K1SA 2J78A 3UA4A 2P9BA 4TOQA 3PPHA 1W6TA 4C6IA 3DFOA 5HNUA 5A2AA 2QJJA 1WBJA 1DE6A 4A2RA 4QHRA 5I3JA 3ZQ9A 4HN8A 5ECUA 4KGJA 3TC6A 4MOZA 3KBVA 3CLWA 3FYOA 4PUEA 3HPSA 2WO5A 2PWFA 3V3WA 3WMSA 6REQB 1QNVA 2EJ1A 2BWGA 1JR1A 3XISA 3MDUA 2W3ZA 4WDWA 5DG7A 1DHKA 1L0PA 1LL4A 4U4MA 3MQTA 3FDKA 3EWDA 1W5PA 3KBMA 1NY1A 1RHCA 2NX1A 2ZKMX 3GIKA 1R7OA 1JDCA 2BS9A 1F6KA 5KFFA 4ZQPA 1XFCA 3ALGA 1P4CA 1Z6KA 3SN1A 5BXTA 1Q6RA 3OG3A 3T0CA 1FWBC 1VP5A 1OFDA 3D0CA 4M3PA 4ECXA 4GNKB 1UD4A 1W1A1 4K2SA 4KFOA 2C1IA 4A22A 1VC4A 5D9OA 2INEA 1IEIA 4EYHB 4F0SA 3S5ZA 2HVMA 4Z0SA 3W7PA 5FL0A 1J2WA 2GJPA 3C6CA 5KZMA 4NASA 4C5ZA 3ISIX 2QF7A 4Z17A 4HK7A 4CN4A 1D3HA 3G1DA 2AGTA 1U1UA 4MLRA 1BTMA 2CKRA 4JPGA 3S6DA 3N19B 1IXOA 3WO8A 3GGMA 4GI4A 1DE5A 3VNDA 5C71A 3LV6A 4JIQA 4N0RA 2BY1A 1EGMA 3FA4A 1ZUAX 1F4HA 3G1HA 3QHOA 1DJYA 2W9CA 1GJWA 3W82A 4XWUA 5HMSA 1JX4A 3VIKA 3QYQA 1OIMA 4R27A 5E9XA 1LBMA 1GTHA 3MI6A 4I8DA 1PYMA 3FXYA 4F66A 4B2DA 4L6OA 5L1LA 1DQXA 5DBUA 2C6QA 2X40A 1UP3A 3MTWA 4IUOA 1ECEA 5E93A 2O56A 3W73A 1U22A 1ADSA 3ABZA 3U6WA 2ZADA 3SY1A 3GR8A 2QCFA 4HA3A 1NELA 3B9AA 3C0QA 2WKGA 2ZBTA 3L2MA 3PZVA 4GNVA 4DJDC 4UB9A 1W3NA 4B5WA 1BFNA 3LCIA 4YMZA 4DPQA 3RM4A 4AZBA 3EEZA 1SW7A 4JQ4A 3RRXA 2C0HA 1V8EA 3SQMA 1AA1B 2AKMA 2AMXA 3CGTA 4JN8A 3R5EA 1XH1A 4R33A 1CGXA 1W1VA 3E0LA 3LCWA 2CHOA 1LCOA 1OFAA 4XZWA 3SUWA 1JZ5A 1N8FA 2ZX8A 2Q09A 1IE7C 2CERA 2C1GA 4W93A 4LUJA 1W5MA 2QHAA 3QZ7A 4D8LA 4E3VA 2XIMA 1I6NA 4H8NA 1V6TA 2HZGA 4PUDA 1SJBA 6A3HA 1TPDA 3N3MA 1R30A 1RLCL 1WXJA 1GUVA 2Z1SA 3AXIA 2GJRA 3UGVA 3G8RA 4MSSA 5GNXA 3G6YA 1REQA 1FTXA 2BHUA 3NQCA 1H60A 1B4KA 1E56A 1A50A 3K4WA 4GKTA 2A21A 4RK8A 2VZTA 1QNSA 1LP6A 1KO0A 1PBGA 2YDAA 1YQ2A 3BV4A 4OUIA 1EX5A 4MPQA 5H8PA 4IPJA 2ACRA 2Y63A 1GVEA 3R2GA 4WQ6A 4L61A 4HU8A 2IUZA 1Q66A 4FS2A 3BC9A 2ZTJA 2ZUMA 3DC8A 1NWRA 2PF0A 4NI8A 4MWAE 1MEIA 3TN5A 1EXPA 3LQGA 3HJZA 1Y5VA 1C91A 3CQ0A 1H7PA 3K1GA 1Z44A 3M5ZA 2V2CA 1H3GA 3WH7A 5EPDA 4C6KA 4HNOA 3BG3A 3V18A 3H24A 3OPSA 2Y24A 3GG0A 3PC0A 2FZNA 3W6LA 2WAGA 5KZEA 4J4KA 4UCGA 4NY2A 3WLKX 1KLYA 4PTWA 5HATA 4GNJA 4HTBA 1TPH1 3TCEA 3MHGA 4ML9A 4TX6A 2Y8KA 1KFJA 2AQ4A 1QPQA 4A8IA 2OR2A 3O7UA 2XVPA 1OYBA 1U1JA 3EOEA 4DZAA 4QISA 2Y2WA 1ZHAA 1V3MA 2O7QA 1EPXA 3R11A 2HBVA 5LHEA 3WK1A 5L6UA 2Q3OA 1XM3A 1S5NA 1Q85A 3AJ7A 1W9PA 3K5XA 3AS0A 3ABSA 4BR1A 3PK7A 3P93A 3W85A 3BLDA 3N4AA 4PBGA 1E3XA 1WAWA 4IIDA 4A3UA 4BKNA 4O52A 2D2HA 2IBKA 3KL5A 1PB0A 1GK8A 4IM4A 1GQIA 1KQZA 4Q7NA 3AC0A 3ARWA 3TWBA 4C7GA 3S9YA 4QM1A 3DCPA 3A9BA 1XYMA 4BQ4A 4YTTA 1KTNA 5GJMA 1AUSL 4ZOBA 3HF3A 1QFEA 2Z24A 3ABRA 1EO7A 5T9CE 1RA0A 4XAYA 3UZWA 1PHWA 1OFOA 3UYCA 2GSJA 3FJNA 4IRDA 3G77A 3MV01 1QJWA 4DN1A 3L4TA 1B3OA 3QBUA 1NFGA 2OH2A 4HSHA 2PDJA 3C61A 4DJED 1UD3A 3W1NA 2QCDB 2NQ5A 1K77A 4Y2WA 3LXCA 4IJRA 3DI0A 1UR0A 1DVJA 2BHYA 1J2BA 3UR5A 5EMUA 1B4EA 4PFHA 4AYSA 5AZ1A 1Q6OA 1A5BA 4GISA 3H55A 4ZO6A 4WY0A 1QHOA 1VJSA 2DJXA 3GDBA 1XGEA 2DV0A 4H9TA 3Q94A 5TNVA 3UY7A 3WNNA 2NV1A 1EIBA 2OZTA 1ZBKA 3QY7A 3FAXA 3HQ1A 3I68A 5BXSA 1GKQA 3FY1A 3BWWA 2OPJA 1U83A 1R85A 2D23A 1O94A 2XGQA 1ZALA 1QI5A 1YE6A 4ZVJA 1C7SA 1CXHA 1V02E 1G94A 3SI9A 1BGGA 1EP2A 4EF8A 4UBPC 1M3UA 4HMCA 1J6PA 3PY2A 2DZWA 3PFMA 2E4TA 3SCRA 3GXIA 5KINA 4HHPA 3BOXA 2V3DA 3APTA 5C7HA 1ADOA 2IPFA 3PFRA 4Q4RA 1XLJA 1SO4A 3N04A 4Q8WA 3K1DA 1HVXA 4QLJA 3BO9A 2VELA 4H01A 1PSCA 2O4MA 2BGQA 2F2HA 3Q8PB 1S2CA 1HL8A 2GGGA 1MDRA 3ME3A 2UVUA 1GHSA 5A8GA 3FAWA 3M16A 4H4IA 4G7EB 1BXBA 2W7OA 2X05A 3QZ8A 3EPNA 2VX4A 2FPYA 4RV8A 3FW6A 2W0UA 4I8YA 1FWHC 3GU2A 2XTKA 4PL1A 3W71A 2ANUA 1J10A 4JZ5A 4Q8OA 5JH1A 4HHHA 1NJJA 4NZ4A 3MFHA 2VM8A 5I3HA 4UR8A 4Z2IA 3T1GA 1E4IA 1I2QA 2TAAA 2E25A 4IH3A 3UZ5A 4PTDA 1EQCA 1OYCA 3REQB 1MEHA 1UH4A 2WVVB 2GGEA 4AEEA 1DXEA 4Z1DA 1QI2A 1J79A 3T8QA 3S8HA 1YTDA 5DCDA 1JUBA 4AZ7A 3VOIA 1A0DA 1BWLA 2DZPA 3NQ7A 3IUHA 1NFPA 3GDTA 1D8WA 3VE9A 3F4CA 3T40A 3LEPA 5HXMA 2JKPA 3BGJA 1MUWA 1RK5A 3H2OA 2BNJA 1FHDA 3ZJ8A 4Q8QA 4DJFC 3ARVA 1RVGA 1IWAA 2WSQA 2HEJA 1E4LA 2OZ3A 4NJJA 3W1MA 1DTNA 4YCPA 4GOAA 3M64A 3CPUA 1UKQA 3UXAA 5FF0A 3RJYA 3GXPA 3M0IA 1KWKA 3B04A 1OM0A 4E8DA 1SZGA 4JTKA 1LQ2A 1VBRA 1W0MA 2B7QA 3LMZA 5CJMA 2VRJA 4PYSA 5B7ZA 4QNWA 1EOMA 5CJ5A 1IT7A 5CPMA 1JZ2A 4NJHA 3C86A 1NQ6A 3UYIA 3AYSA 3W7LA 1XLIA 1PHQA 3PZQA 3VZYA 3L4VA 1XH2A 4DWSD 3V16A 3W7RA 1KM0A 5D2WA 3NM1A 3SGGA 1MDLA 4UCFA 5EBUA 3SB0A 3QFEA 3VA8A 4KESA 4QWDA 1R5YA 4FX7A 3W2UA 2I5GA 3W0KA 4R53A 1L6YA 3M5VA 1QASA 4O1BA 1SZFA 3OHBA 2Z27A 3CC1A 4DB7A 3EWZA 4H7ZA 4DAIA 3SCQA 1AVAA 2CBVA 3GXMA 1XLDA 3R79A 3EWXA 1RPXA 4JTDA 4V15A 4YP3A 1SZNA 1CENA 4ATWA 3V1HA 5EBAA 4JHZA 4M29A 3VCRA 3GTXA 3FVMA 1M7PA 2XVLA 3MSYA 1ELSA 4W86A 1OD8A 3Q67A 3UESA 4DZ5A 2MANA 3I6RA 2DIJA 4XIAA 2XIIA 3BQ2A 3EWCA 5BMXA 3QQ1A 1FWEC 3E5PA 4HOZA 1J0IA 4REQB 2XUCA 4XUYA 1JNEA 3M0XA 3T08A 1EX1A 4PTMA 1OK6A 4H41A 3AHVA 1OQFA 5F2MA 1SGJA 3W7QA 3CIWA 3VD7A 3M4HA 4F50A 3RIKA 4NNBA 1JL8A 1RH9A 4KPLA 5KT6A 4JTIA 3L4XA 3GNDA 3C0JA 2ATMA 3TFCA 3PR2A 1HNYA 3L12A 2YBTA 3GU1A 2FLLA 4NX5A 3BSHA 1DBTA 3UWWA 3A3HA 3BQ5A 2IXUA 3NOYA 3TDFA 3WLLA 4C6OA 1HG3A 1DTUA 1OT2A 3WL1A 3EWWA 3PWGA 3HB9A 3GC4A 2DY3A 5AKQA 2ON3A 1M03A 3O63A 1KWGA 1OSEA 2WMKA 2BVWA 2FZDA 4AY1A 2W5FA 5KT3A 2GUBA 4LCQA 2GSHA 2GVYA 2IQDA 1V6YA 5LIYX 3E38A 3WDPP 3R12A 1WKYA 2ZXDA 3P0XA 3KP0A 3VINA 3TCSA 1GT8A 4M6PA 2QKFA 5CZJA 1VJZA 2Y5EA 4XBKA 3RMJA 2BDQA 3SIMA 4DY1A 7TAAA 3UPBA 3CTLA 3F2BA 1RYRA 2ZE0A 2VGFA 3DZ1A 4IQEA 2QCCA 5LIXX 1YPIA 3U5UA 5KFMA 5AYXA 4NRSA 3U57A 2BODX 1RJRA 3KVJA 1TWSA 3UU0A 1OD0A 4M51A 3RMEA 9XIAA 1R8LA 2D3NA 1IWPA 4LY8A 2Z1VA 2E1WA 1VS1A 2UVRA 1G4EA 4GQQA 2Q8ZA 3A4WA 2AGQA 2MUCA 3E96A 2WWDA 2O9PA 3WBEA 2JK2A 4OIFA 1YEYA 5FJTA 1B3WA 1LL6A 3UXKA 2A3BA 3H70A 1W9DM 4PA8A 5AYIA 4O14A 3RITA 3NQBA 2VZVA 1FVPA 3PJUA 1RQEA 3P8IA 3BOFA 3L5AA 4K38A 3W75A 3K8MA 4AZCA 4FOUA 3SAZA 1VYPX 2G5WA 3W22A 3H8AA 2QV5A 3L0NA 1JD7A 3B0YA 1HVQA 1QOXA 3POHA 3WH6A 1GW9A 4CQAA 5G2HA 2QPUA 1ML1A 5HPCA 1XBYA 2ZX7A 1QCWA 5C9RA 5E9AA 1JIBA 1RP8A 2ZRUA 4L4LA 1YXDA 3TEVA 5T14A 4FNSA 3G0SA 2ATLA 5CGMA 1SYTA 2C19A 2W91A 2VQUA 1C3FA 3Q8RB 3H54A 1OB0A 4PMOA 3SGUA 2B7NA 1GWJA 5CZTA 5DMMA 2J47A 1NU5A 1MYRA 1K1DA 1RPKA 3UVIA 1YDYA 3E2QA 4V1XA 4BA0A 3CYJA 1H4PA 1X97A 5HWNA 3B9EA 3MMDA 4UQEA 3TA6A 4QQ3A 5LA1A 3E12A 1GTEA 4KWWA 4GO9A 2QCMA 4UTHA 4W4QA 5DXYA 3VNJA 1C8YA 3NG3A 3P60A 2AGOA 3H2CA 2A3LA 5EMKA 5H1WA 3CHDA 2QVNA 1HZYA 3WFAA 4TX8A 3O0KA 3LZ3A 2YXOA 3MKKA 1LBLA 1PWMA 3R0DA 2AOSA 3N3TA 1QATA 3CEPA 4Q4MA 4R9OA 3TROA 3DFYA 5KT7A 2CLHA 1GPWA 4K1WA 3W7NA 1FWIC 4BWLC 3O6YX 4MYXA 3U7BA 4GCAA 2FH8A 1A4LA 4OE7A 2BR0A 1RQHA 2J7BA 2QR6A 2ZXBA 4XZIA 2HISA 3V0SA 1AK5A 3C8FA 3GNOA 2ZWYA 1MNZA 1KFLA 3DG3A 1NDZA 1ZJHA 3HV9A 1SFJA 5BU9A 2H8XA 1T40A 3W1UA 1S2TA 4HZ8A 1V4YA 1PEZA 4D1JA 1XLEA 4F4YA 3DAQA 4B5UA 3N4FA 2DORA 4QR6A 4UXDA 3QKEA 3GK0A 2V3GA 2VR5A 1OCQA 1QI0A 3ZMRA 3M5YA 4GQ0A 1XG3A 5EMJA 4PUWA 5HJYA 3LOTA 2PDCA 4OTKA 3RPTA 5GJPA 1KW1A 2WQPA 4KCWA 3PW4A 3LY0A 1S0OA 4HYRA 1B90A 3CEUA 4KCTA 2Y89A 3WQGA 4PUMA 3NZQA 2HJPA 5M17A 3CUIA 4IZGA 3QV7A 1TTQA 5TIMA 4WX2A 2OEJA 1XX1A 2FH6A 2Y8VA 1EKOA 4UTWC 1K7FA 1LDCA 3UP8A 3WLRA 4JIEA 4HMDA 2O9TA 2YXXA 3UCCA 1JF6A 3MP5A 4LYPA 1IXNA 3WLQA 2PDUA 3CNYA 4JR5A 2A7RA 1KR1A 1RUSA 1TUXA 3HGSA 1GGOA 3QSRA 1UBPC 3JVAA 5HNRA 3TKFA 4ZTYA 3WLNA 1L9WA 1JZ6A 3TFXA 1XWYA 3NVDA 4AF0B 5ECVA 4FOJA 1ZLPA 5CC7A 4YWSA 1NOWA 4DO6A 3J7HA 1KV5A 5JU6A 1PPIA 2CNCA 1TSIA 4LBSA 3VNKA 1HJWA 3TNBA 3V35A 1Q6LA 4R5EA 2IMWP 4HYKA 3KCLA 3WQCA 1HX0A 4AVOA 1R47A 1Q63A 2WNZA 4KERA 5D2XA 3T05A 1UYQA 4DBEA 1XSJA 1NTHA 3ZWSA 2IKIA 5HNTA 3M0LA 4XG1A 4GXWA 3TN3A 2REQB 4Z1BA 3CM4A 4UQCA 1NOUA 4JIPA 5BRPA 4JX4A 2PP0A 5L1JA 3UY8A 1E9IA 3IK2A 4AEOA 2Z1BA 3SRHA 3MSRA 2CFFA 3P5YA 4OV9A 2PD9A 3TJ4A 3AYVA 1Q3NA 4RNMA 2E1DA 3FDGA 2FLNA 5FAJA 1TRIA 3OBEA 1IXPA 4O1DA 3VGHA 3VC5A 4M6QA 4ICCX 1WZLA 2FLIA 4JCLA 3B05A 3WBWA 3FHAA 2OSYA 4B2DD 3CYVA 4ED6A 1EC8A 4FLRA 1MXDA 3BQ0A 1FOBA 2X7VA 3DFQA 1IYXA 4HQVA 4QWAA 3BJFA 4PN2A 1LG1A 1H1NA 1E1CA 4DXKA 1XRVA 2ZVRA 1OFQA 3NAVA 1A5CA 2W67A 1WKFA 3MVTA 1NF0A 3GG1A 1HKVA 4FXSA 2V38A 2F2KA 5DCEA 3HTWA 3Q45A 4JFTA 4ED0A 4J1OA 3RB6A 3NQVA 1AQFA 2YLLA 2IKJA 4M8UA 4RE0A 4FX8A 3OVQA 5E70A 3F4DA 1WDRA 3AJXA 4EPDC 3ZR6A 4B90A 2ASHA 1AJ0A 1B3ZA 3PUEA 4FR6A 3TX9A 2BVYA 3IIZA 5AYZA 3SUSA 1JYNA 2YL8A 4KF1A 3VCNA 4RNIA 3SGZA 4TTGA 2H90A 3HV8A 1PXGA 4JUZA 2CU0A 2FHBA 4LVGA 4DI8A 1KXQA 2VDIA 4G7FA 4WKFA 1H62A 4V2XA 1A49A 4LSBA 2VRKA 4DYJA 2FHFA 3RBEA 4RW5A 4LRTA 4LYRA 5A8QA 1MMFA 4WJXA 2KZHA 3BL3A 3BCDA 1WUEA 4FMVA 1V3HA 2XM2A 2AL2A 4PMUA 2WWCA 4Y9PA 1Z8AA 1KM6A 5HQLA 1FRBA 1EJVC 3SRFA 4MWAA 2WYSA 5D9NA 1E15A 3I7RA 3DGRA 2ATSA 4AHPA 4MNJA 3SUVA 5I0DA 2PMQA 4E2BA 5BNKA 3SCNA 2PDPA 4XZLX 4ZTXA 1ZU8A 4LVBA 1ENUA 4TVCA 4LUTA 1WKDA 1FKWA 4PE8A 4AAJA 1V3LA 1AD1A 2NX9A 3SI8A 1CECA 3GHTA 2NT0A 5JIWA 5LNWA 1TPVA 3EXRA 2W62A 4QWCA 3GXFA 3F7JA 3LCFA 4AWSA 3G1AA 1DJWA 1A3HA 3URAA 4LT9A 3I7QA 3EKZA 3GNPA 2PLCA 3I65A 5BXPA 2QXWA 1PVNA 1E9YB 5I23A 1YLVA 5BOEA 1DJHA 2WOQA 1BSLA 1BVNP 1QT1A 4LS0A 5A6MA 2OX4A 1KD0A 1PKNA 1K8XA 4GRSA 4H1ZA 5J8LA 3H2AA 4XZBA 4ADTA 3BGAA 2BGNE 5A6TC 1W17A 3H4GA 1J6OA 1F74A 3R4IA 2VXNA 3IIVA 4EK7A 3H4WA 5G4EA 1J18A 4IP5A 4QGCA 2PDBA 3UPWA 3KDOA 2V5DA 1EDGA 3NPXA 3RDKA 5MKGB 4O3PA 1PZ2A 1U30A 3V7PA 1P0EA 3ITYA 4L5ZA 3EGJA 1RV8A 2VCAA 4DM2A 2FHCA 4TX9A 3MWAA 1N8WA 5AHLA 2Z29A 3EOUA 1M65A 1MI3A 3VKDA 4EX4A 3UVAA 1XS2A 3G6VA 2F61A 3ARQA 1QUMA 1JZ3A 5A3HA 1PYFA 2P8BA 2F6UA 4HNUA 4DUXA 4MY1A 1EL3A 4L9ZA 4AX7A 1KXTA 1WE5A 1CYGA 1TPB1 4ECTA 1UQZA 3R8GA 3R58A 4CLMA 3PAJA 2XSAA 5DXXA 3MBFA 4P8WA 2GSEA 3GKAA 4DBDA 1E1FA 4J3TA 1FH8A 2RDUA 1FHVA 4UFLA 3IN5A 3QM3A 2OLSA 1W3KA 2ISFA 4DF0A 3JW7A 4XO6A 5ABHA 3W00A 3G22A 3CZKA 2QMJA 4J9KA 1E5JA 1D7KA 2DZAA 5FIPA 3VMNA 2OU4A 2IQTA 2ISWA 4ZR8A 4LWWA 1QXLA 3AIUA 3WY1A 2PLMA 4OHQA 2C15A 3G5EA 1W56A 1AQMA 1V02A 4IICA 4TVDA 1B3VA 2BHZA 1YE4A 1A5KC 3UXLA 3T81A 2ZCGA 1XLMA 2QDDA 4WXZA 3GY1A 3C2RA 2EKGA 3C3NA 3W88A 1E55A 5DANA 2J74A 1SW0A 5LNRA 4FBTA 4Q33A 4A4AA 3S1WA 1BF6A 2CWXA 4U7CA 4ACZA 1R2TA 3FIGA 4MY8A 2D0GA 4PR4A 1TVNA 4HCDA 1NP2A 4MKSA 5KFVA 2J6SA 1Q6CA 3OA5A 1GVYA 1F8MA 3AIWA 2YFOA 2CXEA 3BOLA 4Q8UA 4W9TA 1Q6EA 4EWND 3BLIA 4LEFA 2QQ6A 4CD5A 3W3OA 4YTUA 1CGVA 3W2LA 2E6AA 1G67A 3LPPA 2F84A 2VGBA 4AD4A 3DUGA 4O3SA 3P5ZA 2Q8LA 3ZLFA 1T5AA 3LM7A 4U3CA 1X6NA 3MPGA 2R6OA 2IKGA 2ZA2A 3DGBA 4DUWA 3OVPA 2GK1B 2X2GA 3RCMA 3N18A 1S97A 4Y9NA 5CPNA 1X8CA 1W3HA 4UMBA 1P6CA 5XIMA 1UASA 2OFJA 3PTDA 4W5UA 5A5WA 4E2DA 2GUUA 3I4KA 4DRSA 4AZ5A 3VK5A 1UR1A 1JVNA 4S38A 1TJPA 3POCA 4B92A 4KCUA 3EPOA 2X0SA 5C2GA 1JNDA 5A2BA 2YYTA 2UVWA 1XP3A 1W31A 2IA6A 4PODA 2RDIA 4GHRA 3S5SA 5KFOA 4Y8EA 4J3ZA 1RJQA 2KX9A 3ZYZA 4RUBA 2XSBA 3KCOA 4FLOA 1TIMA 3ITCA 1S1RA 3TTQA 4RNFA 2ZZ6A 3GUGA 3TP4A 2C18A 1AJ2A 3EMCA 2NLYA 4X2PA 3RM9A 4KQNA 1GPFA 1QTWA 3OSNA 3VGDA 1FDZA 2PFHA 1R2RA 1ZL1A 4LCSA 5D2YA 3WUGA 4RNHA 2L5HA 5D4YA 2JEPA 2PPGA 1G1YA 4A05A 3ZOAA 2GVGA 3QY6A 4F40A 3KS6A 1JCTA 4K8GA 1OHLA 4WOQA 1ME9A 1VLIA 1W5OA 3H4DA 3QFWA 2IS7A 3AZRA 4W85A 3M0MA 3RB3A 3U4FA 1Q8JA 2J7GA 1V3IA 2RDXA 4MZYA 3A23A 4DELA 1TPC1 3IVTA 4F4RA 3CIXA 1JPDX 2UWFA 3AIBA 5LIWX 1FKXA 2X1TA 3GTHA 3H7VA 3A4AA 1Y65A 2VTFA 3TA9A 4GA8A 2CLEA 4ED8A 3PR5B 3MR6A 3MKVA 1EF2A 4BS0A 9CGTA 3W23A 4CVUA 3PANA 3EB2A 2ZUNA 3P80A 5I3IA 3P82A 4KEVA 2FFIA 4GYJA 5D30A 1UWAA 5LKYA 1VBGA 1GKPA 7A3HA 4ZE4A 1V3JA 4LW7A 2EO7A 1NDWA 1B3YA 2PP1A 3GBEA 4CCEA 2I9EA 4B3LA 2C79A 1K7EA 3URQA 1QWGA 2YA2A 2XIBA 3TW7A 2CC0A 2D73A 2Y61A 3BCJA 4WHBA 3IJ9A 1H5YA 1SPQA 3GC2A 3OGSA 5T91A 4J9JA 3CPGA 1Q65A 4O57A 3UJSA 5AC7A 2DPJA 2J9ZA 1F76A 3N29A 1EEPA 1FFQA 4UUIA 3W7OA 3O9NA 1WO2A 2VCCA 3WBAA 1EJRC 3VIHA 4JS3A 3LSBA 3NWRA 4EF9A 1TV7A 4NU7A 1VEPA 1H0GA 4V27A 4XAZA 4C1KA 3MHFA 4W89A 1ECQA 5BZAA 2ZZ1A 3ZT5A 4B16A 4DUOA 2DUXA 3ZO9A 1GOQA 3AFBA 2YZ5A 2ASDA 2QGHA 2VD9A 3HG2A 2HS6A 4JTTA 5CSYA 3M6DA 2WK2A 3WEOA 2JQXA 4L4MA 3KRSA 3IK4A 5CH9A 1K8YA 1BQCA 1KFWA 1KRBC 3LHUA 3HFTA 3VDHA 1BF2A 1HGYA 3MSGA 3DECA 2V3FA 3URBA 3R8HA 1KRAC 2VUYA 4L6DA 4R7JA 4GYFA 4NZFA 1D3GA 4JD4A 2CETA 1E1EA 1EBGA 2XGPA 1LOLA 2Z1WA 2QDHA 4XD4A 1BPLB 3RB0A 1UH2A 2EBNA 2C1HA 3IAPA 2RH9A 3W29A 2QCHA 4E3TA 3OOQA 1DJQA 5EFDA 1E72M 3PBMA 2PB1A 3N4EA 3WELA 3A4JA 2XZ9A 3B8DA 1AW5A 4UIOA 5GPRA 4EPBC 3S46A 6REQA 1HTIA 3KVKA 5GQBA 1CGTA 3N11A 4O1EA 1KM4A 1UJPA 2G3FA 4XSMA 4HZ7A 3WLJA 4FI4A 5A95A 2BY2A 3I6EA 4J40A 4P8VA 4NZ1A 1Q7QA 2ISDA 4WUIA 1E40A 3QEZA 1Z48A 3PZIA 2H8ZA 1JF5A 3BG5A 5AOUA 3TK7A 2EG7A 1YBQB 2DVTA 3LS9A 1ZB5A 1XRTA 2G3NA 3EAUA 4RDZA 2VOMA 3ATYA 4CEXC 1VFOA 3NPUA 3QZAA 2DVUA 4K37A 4AYGA 4RPQA 3KM8A 2FTWA 3BAJA 4RXGA 1I1XA 3OBKA 4ROPA 2D0FA 4ONVA 3HFYA 3LQLA 3PG8A 1AMYA 2WZIA 3WD1A 2OG9A 3VXGA 1SJDA 4E0CA 3K46A 4RR4A 3WQFA 1EA9C 5TAOA 3BLOA 1UUQA 3M1ZA 3NNTA 3AU2A 3TMQA 3HZ3A 2P5NA 3OZPA 3THCA 1XSKA 2FMNA 4IXHA 4PUUA 4Y90A 2J4GA 4R9XA 3M43A 3IS4A 4DL5A 1EUNA 2NQLA 4JDYA 4PTVA 2XH4A 3D47A 3T2OA 2ALRA 2Y4SA 4XSLA 2PC4A 4JICA 1HFBA 2DPEA 3B4UA 4FNUA 3HQNA 3O8AA 3S5OA 3VO0A 2XWEA 4X9YA 1UHVA 2JF7A 3VIGA 1M7JA 1TE1A 3L5MA 1JQVA 1QNPA 1DWGM 2ZX9A 4A8RA 3O05A 3AU6A 1PZ0A 4D6HA 4R88A 1CXEA 2NUWA 3TE9A 4ZA0A 1S5WA 4KEUA 2FJKA 2WBKA 3GIJA 1MFUA 3N2OA 3MDWA 2XIOA 2X09A 3WQ8A 4OJYA 2JEQA 5EMLA 1OYAA 1R46A 3AISA 3R6IA 4K7YA 4GQBA 2NVAA 2ZXQA 4D6EA 5BMWA 3H22A 1S0MA 1JXLA 4GZEA 4RDWA 3ORWA 1VCGA 2CESA 5DCBA 3KHHA 2WNNA 1F73A 3LTYA 4LRSA 5F4WA 3PZTA 4A35A 1KRCC 3R25A 1V0NA 4GY0A 4IIEA 5I77A 2PAJA 4EOUA 4AZCB 1C29A 3PUDA 1RLDA 1EGVA 3N15A 3BW2A 3LNMA 3CHFA 1UWRA 3G18A 1DQWA 1S46A 4GIRA 4GD0A 1IR2A 1WB0A 2CLKA 3UEQA 5TD4A 2D1ZA 2CITA 3MCMA 4M0XA 1CT5A 3G6LA 3RLHA 3WIJA 2ONEA 5KT2A 1EA0A 3QY8A 3ZXWA 4I7VA 1TRDA 4DYKA 2C28A 1XG4A 1WDWA 1VFHA 3V75A 3GTIA 3TYAA 4Q22A 4J9LA 2Q02A 2HDJA 3CBWA 2YCLB 3IRSA 4A2SA 3S6OA 2XH0A 2NW0A 4ECWA 4RZ4A 3KBNA 2VEIA 3STCA 3L4ZA 5CZKA 2W6RA 1G7VA 5C9ZA 1MZRA 3HURA 3OLIA 4Z2GA 4C65A 3LYEA 2VEKA 1W37A 2QIWA 5D04C 3BMXA 3EOOA 5KFTA 1POKA 1LTDA 4Q4PA 1XRSA 3B03A 2WVTA 1ITQA 1MEWA 3TQPA 2OOFA 5E09A 2IQ0A 3BMWA 3DX5A 1V3KA 3NPWA 1OJXA 1XFBA 4AHOA 3KOWA 1IEQA 2QJNA 2QJHA 3AUOA 1DV7A 4AZIA 2G4JA 3BURA 2FGBA 4DEZA 4CQCA 1LRNA 3VDBA 2OGYA 4AIBA 3W70A 1R38A 2J79A 3F03K 3HPZA 2X1UA 1V08A 5EFFA 1ITUA 1S1PA 4WKHA 1KFKA 3KHDA 2E8ZA 3GW3A 1EOKA 4RLIA 2PLJA 4JFWA 1UD5A 4PMZA 2AKZA 3BARA 4Y9AA 1VEMA 5EL1A 3OHAA 3GYEA 3VPLA 5LNUA 1YTKA 3QTPA 2HE8A 4EEYA 3NGDA 4RV3A 3BTNA 1US3A 1PCWA 1ZRQA 4A3QA 1QR7A 4C6NA 1GG0A 4JTJA 1XBXA 4UWMA 4KT2A 1E9LA 1DIOA 1X6UA 3GG7A 1YADA 4ZXOA 1BSIA 3NQMA 4NZCA 5BU6A 4Q8TA 1XF0A 4Y9OA 4Q6XA 5BOFA 1FCVA 4HZMA 1FP8A 4H9UA 3LV5A 1EJTC 2QCDA 1DXFA 4NZJA 4W8BA 3INPA 2WHMA 2NXHA 3KTSA 3LX9A 1CI1A 3C3UA 4Z08A 3TV8A 3GV7B 1F3WA 3VI2A 5REQA 3VX1A 4O3OA 2V5LA 1O6IA 4D6FA 1CLVA 4QROA 4CVWA 1VJIA 1KGXA 1U5VA 1UH3A 3W1TA 3SCTA 4DBSA 3RILA 1ME8A 3T07A 4S3FA 3MV11 3TSBA 5DT7A 1HJSA 1OT1A 3IJLA 4P7QA 1NH6A 4QE1A 2D22A 1ESWA 4LU0A 3T8LA 3F5JA 2V9WA 1LL7A 3UWEA 4JYFA 3E0WA 2CLLA 1X98A 3M0HA 3MI2A 1L8NA 4YVPA 4L7ZA 3IRDA 3FVDA 1JPMA 3QSTA 2ZFAA 4ZZ9A 4PMRA 3BW4A 4XKYB 3Q8QB 2OLAA 2PWVA 2PS2A 3W2NA 3FSUA 1E6NA 5I3DA 2OX1A 1JGIA 2QUVA 3WSUA 1KFBA 2VWSA 3ITXA 3KBJA 1J11A 5FEWA 3LENA 1XR2A 1DWFM 4MF4A 1XCXA 1G7UA 2BQUA 3HG3A 4PSRA 4RNNA 3WFLA 1SO3A 5L1IA 2HWGA 2WPBA 1ISXA 1XYBA 5JXQA 4MUZA 1UWSA 3TXZA 3ZLHA 4IXXA 2WJFA 4QS6A 2AAMA 1CBGA 1JCNA 4MWAD 1Z3NA 3QKZA 5A6SA 1PL9A 1H2JA 2X0HA 3E9AA 2Z7GA 1BVZA 3NPVA 2PDQA 1PAMA 4IT1A 3DFPA 5DQPA 3TYUA 3U2ZA 1BWKA 3DFSA 2Q3RA 4V33A 3ZWTA 3BQ6A 3P2VA 2RAGA 4EANA 4M7SA 2O92A 4DJDA 2V2DA 3REQA 1MW3A 4ZENA 2WVVA 3UZXA 3S2LA 2OKOA 4DZIA 1K02A 3RYSA 1IWBA 5C5YA 3GVGA 5AHIA 4CU6A 3LN3A 3W1LA 2NXGA 4J9SA 5DBTA 3WYZA 4DIAA 3NSNA 2WMIB 3GBDA 3BICA 4W87A 1N8IA 3A22A 4XBJA 5D9PA 1BEUA 3RO8A 1FX6A 4GVFA 2VVSA 3M44A 4URIA 5B80A 3EZ4A 3B4YA 3WEZA 1H7XA 2XN0A 2JE8A 3F4NA 3A5FA 3IAQA 1ZZMA 3MMWA 3T5HA 3CUXA 1SMDA 4HVXA 5FOOA 4AD2A 4GPNA 1YPFA 3NZPA 2WC4A 4CQ9A 3SM0A 5K9CA 5G4HC 1FDYA 2RHGA 1I8JA 1MW1A 3D3AA 2C14A 3S1XA 1DJNA 3KL0A 2PDXA 4UZSA 1AZ1A 4CQBA 3FXGA 1XKYA 4MY9A 1PKMA 4JFSA 4M80A 1F9CA 1ONEA 4GXMA 1EZWA 1IGWA 2GDQA 2I56A 4CCZA 1W1ZA 2AL2B 3SFKA 3UXIA 3NQFA 1MW2A 1JUEA 2FZ8A 4DBUA 3GFYA 1PTGA 5BWAA 1XGDA 1Q7ZA 1KR0A 3GTFA 4OBRA 3GR4A 1ZJIA 2NT1A 3OGRA 4LUTB 1UPMB 4MGGA 3CUHA 1PS9A 3GQYA 5CEWA 3M9MB 1LWHA 2POTA 4DZHA 3FJLA 3U2EA 2J24A 3TQKA 3WQEA 5PTDA 2XHYA 5G1MA 2C8NA 1E6XM 2G3IA 3I3EA 2OZ8A 5DRIA 1NVMA 5A8PA 4UFKA 2DU2A 2E7FA 3TOPA 1V7YA 3WQOA 3NFUA 1PX4A 1XISA 3OVGA 4WKAA 4K8HA 3IIOA 3A13A 4REQA 3BK0A 3ZS4A 2GOKA 1VRDA 4AWUA 5J5RA 5DT5A 4G1KA 4MZ8A 4MTVA 3TVAA 4AZ6A 3Q8SB 1F61A 5AHMA 4GZIA 4GVIA 2W66A 4AH7A 1W1YA 1LM1A 4N9CA 3T5JA 3BLPX 1W3IA 5C54A 1CLXA 3BE7A 3OZMA 3VVGA 4CCCA 4JX5A 2RJGA 3S0CA 3MFIA 3N34A 2D3LA 2CYGA 2KAUC 3P8JA 3E2SA 5D32A 2BLEA 4WK9A 1ZJBA 1J93A 1LLZA 1HGWA 1KQYA 5CSSA 4F9JA 4RE2A 2WZEA 4GCXA 5G2WA 1H7NA 1TMQA 4X9SA 4BY3A 4MKVA 4C6FA 5CXPA 2ZZ5A 3AHXA 4ORIA 2WNWA 3B06A 1TZZA 1OX5A 3GH7A 2VI0A 2INZA 5FF7A 4L1WA 3TYEA 1PX8A 3WBYA 4GJJA 3VABA 1YYAA 4ZOAA 5I03A 4WCJA 2ZTKA 3H21A 3AXXA 3WLIA 3WF0A 3W27A 3H2FA 1TKKA 3C2OA 1TZ9A 1VYRA 2V2HA 3MJYA 1H63A 1W1TA 1V6WA 2QCNA 2F6XA 1XRFA 4JYEA 2H3DA 4KGLA 1UIPA 4N7QA 4HNNA 3LRMA 4W8LA 2BQRA 3WQ6A 2G0WA 2CBJA 4FA3A 1F07A 5CZ0A 2GLKA 4PMXA 4AD3A 2XH7A 5FSDC 4LNYA 5DX7A 1SFTA 3NGFA 3CT7A 1LG2A 2VEGA 4GH1A 3VCCA 2O7SA 1TPEA 3IVSA 1V03A 3GDKA 4DEFA 3EX3A 2FVKA 4Z2KA 3V5CA 5G5IA 2VD8A 1V6UA 2FZBA 3I3DA 4IIBA 2DZTA 1ZETA 4RW3A 5FEZA 1UA7A 4JAWA 3HO8A 2XM1A 4DXXA 5KFXA 3IJ8A 1VENA 3HJEA 1LLWA 3DFTA 4AIEA 4AHQA 5KFWA 2W79A 2ZDSA 3O3RA 2X2YA 5F1VA 3V5FA 2YGYA 3HMCA 3DKLA 1E0WA 2QJGA 4PCSA 3UNTA 1SM9A 4JFVA 3VIPA 4F0HA 1E0TA 1F3EA 2VGIA 4K3ZA 4FALA 4OBSA 2ZIDA 2QW5A 3CH0A 4QITA 4ZO8A 3W2MA 4YVVA 2J8TA 2FYMA 1S2UA 1R9XA 4W8AA 4D72A 4MG4A 5I5RA 2ZZ4A 4AMCA 2AGKA 2Y5SA 5DQIA 4DUVA 3EMZA 3W53A 3WLTA 3K8KA 1YNQA 4KWSA 3WDJA 3ID7A 3PP7A 3NZRA 1XBZA 3ANVA 5EU9A 4JKKA 1H7OA 1ITCA 3CT2A 4K68A 3UWVA 2PODA 3ANYA 4J28A 3DHUA 5FCZA 2RDTA 1G69A 3ALFA 2OODA 1W8GA 1TPFA 3GR7A 3S4TA 1X6LA 1M04A 2POZA 5H91A 2WJZA 3HQOA 3O07A 1VBJA 4QTGA 4MM1A 3HG4A 3BG9A 2WZTA 2V81A 3LPOA 4CKQA 3IGHX 3BUVA 4S3GA 4UFJA 4HA4A 2WTFA 2Y8UA 3DIPA 3O6CA 1M1BA 8XIAA 3IANA 2DSWA 5M03A 2ZC8A 1MQPA 4DLMA 4M5PA 2EPHA 4HNLA 2Q71A 3IJDA 1XD1A 3V4BA 3FYYA 4JY9A 3BZGA 4OWGA 1CX9A 4RDVA 1SU5A 5I79A 4HPJA 1QNOA 4I7WA 4GLEA 3U0HA 1S5VA 1SQ7A 4HN4A 2PDGA 4AY8A 2CZDA 4DJFA 1KGWA 3AZSA 5H6HA 4W7UA 1UUMA 3PBUA 1L6GA 3CXOA 4FK9A 4RXFA 2NVDA 1TA3A 1TG7A 1EGZA 2GZXA 1TMHA 3DFHA 4I9AA 4CNTA 1FH7A 4HT3A 5KG2A 1GHRA 4JTCA 4B3ZA 3SY5A 4Q8PA 5CGTA 1JGMA 5EKYA 1FA2A 3PZOA 5DLGA 4JN6A 4PMQA 3SADA 1NFBA 2VKZG 3H23A 1W1B1 3BLLA 3PVFA 4M1RA 4DVOA 3VGFA 1LLOA 4DHGA 4K7VA 1K4HA 3EPIA 3Q2DA 4NVTA 2VC9A 3QLLA 1SSDA 3NDYA 3VILA 3VM5A 4KIRA 2FPVA 3GE7A 2Q6ZA 3PBVA 3ITTA 3ZFHA 4WDXA 3OGVA 3DN5A 2FVMA 2ALDA 4J3VA 1ZBVA 4DQWA 3RK8A 1ICSA 3S1GA 1FWTA 4IRCA 5IXEA 3OHMB 5KFEA 4LNCA 2JGQA 4MLJA 4V28A 1WZAA 4I7UA 3CAKA 3KZPA 4H9XA 4GI8A 2D20A 1CGYA 3CWOX 4N9DA 4J9PA 2E6FA 1Q5MA 4B4HA 5L9XA 3AIQA 2YSWA 3AQUA 3B8UA 3IARA 4LAKA 4H3DA 2BGSA 5D8WA 3RX2A 3VDAA 3ZT7A 3MO4A 5HOSA 1HJUA 1YDNA 3MBDA 3CAWA 2QDGA 2XIJA 4AF0A 1UIOA 1T41A 3AUJA 4ZQMA 4A3YA 2YDRA 2WNQA 9XIMA 4J3SA 4NG3A 3GKFA 3G0XA 4B9ZA 1EP1A 4XV0A 4U3AA 2QGYA 1ADDA 4QFUA 3LHYA 1IIHA 5CCZA 4O53A 3PWAA 1KFCA 4HCHA 5A1AA 3PS7A 5K9DA 2OVLA 1N55A 3LM3A 4FAMA 4G3IA 2GVJA 5I00A 1A5AA 2O0TA 1A5UA 2DQWA 2E0PA 2TSYA 2BVDA 4LUIA 3WQ5A 3MY9A 3CHEA 3D46A 5KFUA 1E4NA 1SR0A 2HNHA 4UTFA 3WK2A 2REQA 3QYSA 3TYCA 5CC6A 5TBOA 5HMFA 4RE3A 3IGSA 3NEHA 4P7RA 4UTJA 3I4EA 3TXVA 1HJVA 2G4FA 1CGWA 3WH5A 2ODOA 1UR4A 1TJRA 3PZGA 3GC5A 1C93A 1F6YA 1EDTA 4HMEA 3MJMA 3N17A 4H6RA 4JNYA 4PUKA 1Z7AA 3KHJA 4IQDA 3AWOA 1A47A 1FWWA 3D6NA 1S10A 4GWEA 2WMHA 3UJFA 3IGUA 1XHGA 1YX1A 3HGRA 2RDJA 3L5LA 4CCDA 5ABGA 3PNZA 3RLVA 4GGBA 2J7FA 1HW6A 4Q8VA 3PM6A 1M7XA 1XLAA 2EXOA 3CLMA 5D2VA 5E6ZA 2Z25A 5FSEC 2F8QA 3W7JA 2YA0A 2BXZA 5K7JA 3SN4A 3LU2A 1EYWA 3GNXA 6ALDA 2YCEA 2P76A 3WEMA 3IJIA 1C7TA 2A3HA 2WMGA 1FH9A 1UCWA 1U5JA 3THUA 3W84A 4TUFA 5KZ6A 4D6DA 1WCGA 4U28A 4ECSA 1MFVA 5U7SA 1A80A 4ML4A 2CWNA 2FFCA 3DBPA 4QWBA 4AD1A 1GORA 5LNVA 4GZJA 2WVUA 3PPGA 3NJ3A 4ZSUA 4FHAA 4GH3A 2VVNA 3PZ9A 3TR9A 4LX4A 4OGZA 1K03A 4L4OA 5LXEA 3LA4A 3RR1A 5HULA 2DT0A 1GVOA 3WNLA 4JTLA 4O0ZA 4D6CA 1E5NA 3GRIA 1GQLA 4M56A 1RCXB 4GI6A 4AXKA 5KG6A 4PB5A 2E5CA 4N4PA 4F0RA 1KFEA 2WM0A 5KFYA 2XGIA 4YVXA 1TFVA 2CZ5A 2BP1A 5LYRA 4UOZA 1E9ZB 1AL7A 3SQLA 5EWEA 1W3JA 1E4MM 3NYDA 3LUTA 1ISWA 5AHFA 4ICNA 5C9UA 2WXDM 3BMVA 4PULA 4QJ4B 4I5UA 1KB3A 4QSFA 1T99A 5FACA 3I7SA 4IHCA 5LIKX 3AHTA 1U1HA 1DJXA 2JEFA 3KTCA 4CD7A 2J77A 2PRMA 4O16A 3THQA 3NZGA 4B5SA 1RQBA 2FLPA 1ODUA 1LORA 4GUFA 3TJLA 3UG5A 3PHAA 1N56A 1E6PA 2E68A 2NSXA 4QG9A 3N12A 3U8GA 4D2JA 1XH0A 3FA5A 5FJIA 3ZIZA 2E6DA 4NIRA 4XIMA 1ME7A 3EA1A 4BWLA 5D9MA 4J9NA 2XJ7A 1QWKA 1W1IE 3A3XA 1VR6A 3EKGA 4O12A 1IZCA 2V5BA 3A21A 1QU4A 4J3XA 5C9XA 3LCGA 5LIUX 5LXXA 4H9YA 6XIMA 3B8TA 4Y6GA 5MKGA 4NYYA 3F5KA 4TIMA 4HU4A 2B0MA 3BXWA 3GVVA 4ECUA 5I07A 1FUYA 1E70M 1DIDA 1MNSA 1VPYA 2RDWA 4ED7A 4EBDA 3GHUA 3LCHA 4UTIA 3ZZ1A 4KWOA 4WD0A 5C2XA 4C6EA 2IKHA 4D6JA 3AAMA 5CBIA 3WNKA 3PZUA 2OEKA 5FJUA 4PMVA 5CG7A 2GPTA 4A3HA 1G4TA 2GVLA 2OZ0A 2NSOA 4ERAA 1Q6GA 3OLGA 4Q4OA 4YR3A 2R82A 3L2IA 1LT8A 4UTWA 1W2PA 1X7FA 4LEQA 1J9YA 3L0KA 1HF6A 5ABFB 4AD0A 3QOMA 2D24A 2X16A 3VKKA 1AJZA 4H2HA 4QDWA 2G41A 3CUFA 3TQ1A 4D6IA 4L56A 2DPIA 3RG6A 1JUKA 3WJXA 3RPDA 3AWNA 4HJWA 1R2SA 4IX2A 5BXRA 3KX6A 4XZ9A 2OKTA 5M2FX 1H0IA 3UG4A 4S3EA 1JI2A 1VFLA 5CPSA 2R8KA 7REQB 3P84A 5M3WA 2BASA 2AMGA 1ICQA 2DH2A 1RK6A 2DEPA 1W9VA 1UG6A 2X0YA 2X30A 4PCTA 1XW8A 3TTYA 5KFBA 4FX6M 4IOTA 5K4XA 4LYQA 3C2YA 1X1ZA 2B31A 1RAKA 5KG1A 3V6JA 3VD3A 2I9UA 7PTDA 1BXNA 4HD5A 3M6YA 3N73A 4FBUA 1R3QA 5AECA 3KOFA 2XDFA 1QI4A 4ZQCA 3ARTA 3O6DA 1TREA 3V6KA 1Q4WA 1DWJM 1ZGDA 3TC7A 2C7FA 2AQWA 1BD0A 1SR9A 1TR1A 3TJIA 4QW9A 4ZGYA 2CHNA 2GK1A 1BLIA 4WLCA 2H6RA 3MZ2A 1DWIM 5D09A 4A6GA 4G56A 4F48A 3NQDA 2QDEA 3W7GA 1CB7B 2WV8A 1OCBA 3W74A 1FWDC 4Q43A 3QGVA 3F4VA 2PZ0A 2BV9A 4NKCA 2XU2A 5REQB 3FEMA 3S83A 2VX7A 4Y7EA 4J3WA 5I3GA 1LQ0A 3EDJA 3CU2A 4XAFA 1WA3A 3SSZA 3NA8A 2XVGA 2NXIA 4M24A 1B5TA 3ARRA 4NAFB 4J7RA 1JQXA 4MNLA 2P0IA 3PB0A 4P7LA 3MR5A 5CKSA 3H7RA 1GZ1A 4W5ZA 4UTUA 3PSVA 4OBTA 4H00A 4P5UA 2PDLA 5MHBA 2UZ9A 1RXOB 4WIWA 2Y88A 1HO4A 1JCLA 4EXBA 2W8LA 1E0VA 5KFCA 3WL0A 2X7WA 4IG2A 1J5TA 1JG9A 4QAIA 3PZPA 3EKLA 3RU8X 2HV5A 2Y70A 4H9MA 5I3KA 3BVJA 5DLCA 1NWUA 3SCSA 4UNIA 2DH3A 3VDCA 4XZNX 1NQKA 2ASJA 1F6PA 1EH9A 5CSUA 5I02A 1L8PA 3N9KA 5G2IA 4GI9A 2QCLA 3DEQA 3NQ6A 4O18A 3S1UA 5F7UA 3G8EA 4P61A 1HKIA 1A5SA 3FEQA 4PRRA 1EC9A 3EDDA 2OOGA 4I6KA 2BXYA 1VCVA 2YW3A 3HIJA 2QPXA 5AY7A 4UFMA 2WW5A 4WXYA 4XZMX 1XQLA 2O9RA 5CPQA 1O66A 2E5DA 3EDFA 5E0KA 1F7BA 5F4SA 2PRHA 1E6ZA 1LRTA 4NT0A 1I75A 3NQAA 3W7DA 3E0FA 3T44A 1EWDA 2DQXA 3RO6A 3NURA 3B3DA 3MR3A 3TN6A 4QE4A 1I9CB 1E6QM 1P7TB 2SFPA 3QV8A 2H3BA 5CBJA 2EF9A 2ZUTA 1UD6A 3USBA 7ENLA 3WMLA 4HTYA 5F9LA 3P7YA 5HPOA 3TONA 1DOSA 3KVMA 5F2IA 2PRLA 1N48A 3OLDA 2DZXA 3VM7A 5KFRA 4X0VA 6TAAA 3CUGA 2G37A 3MCOA 3NEVA 3BCFA 4YYFA 4LQ1A 4CD8A 5GNZA 1H1YA 1DJIA 3OTRA 1QK2A 2ZVIA 1TYGA 2PGRA 1YPXA 3A47A 2OT0A 2HS8A 4O1CA 2PGEA 3CHVA 1UMLA 4A29A 1GW1A 2GYIA 2ISSA 1S5TA 2NUXA 4H6QA 3EX6A 2NWRA 2C2EA 1A5LC 1WXZA 3IIXA 1UMYA 4L80A 2VFGA 4F8XA 4H8UA 3PJTA 5FD0A 4QAWA 4MJ2A 1B9BA 2QYGA 1RBLA 3CHCA 1UR2A 2YZRA 4GQRA 3L4WA 3M0VA 3E0IA 4G9PA 3WD4A 2CLIA 1TX0A 3G1XA 4ES4A 2J9YA 3WDRA 4LVDA 4PTXA 2ALZA 5TQLA 2OJPA 1K6AA 5XINA 2Z00A 5TF0A 1HT6A 3OQEA 2A7PA 4J9RA 1E43A 5LNSA 1PV8A 1RSCA 4ZFMA 1ONRA 1NP0A 1XD0A 2BOGX 1O12A 4RZ6A 3COTA 5D05A 1BGAA 4ZFCA 1H1ZA 5KZDA 3MZNA 3UR7A 2WCSA 1S38A 4HU0A 5JBFA 2PDHA 1DYSA 1SFLA 2WMJA 2XCPA 4L1GA 3SUUA 3AHZA 4GMEA 2PWGA 1EPVA 2R1PA 3QH2A 4GYPC 4I9TA 4IMDA 5BYWA 4E6MA 2W61A 4LOCA 1L6WA 1VFTA 2ZX5A 3AICA 4D8AA 2XH2A 1YBQA 3BLFA 4YLWA 1R6WA 3LHTA 1JPHA 2TYSA 4C6DA 1TMLA 5FI8A 4JN7A 3PW5A 3TTEA 2R1MA 2J88A 2QUMA 2YDQA 3E0VA 2BFGA 1GOXA 4MB3A 5IDIA 4K8EA 1GVFA 3MKCA 3SCUA 3QGKC 2FDSA 3OBAA 2BZNA 2NUYA 2VO5A 3GZAA 4IFKA 5BCAA 1OVDA 3TYZA 1XC4A 3GVRA 2WLZA 3CV6A 4X60A 1BQGA 3VMPA 3M9NB 2FVLA 3MP3A 4RCXA 3SCPA 4DO5A 3CQJA 2DP3A 5IDZA 2HMCA 3QQWA 3CZJA 4KH2A 1K7XA 3AIVA 3UWZA 2UV8G 2GQ8A 4ASTA 1ISYA 4J9MA 1PE1A 3NOEA 1BAGA 3BH4A 3C2VA 3JZEA 4TU1A 5L1KA 1KCZA 5HJXA 3WQVA 3N2MA 3O1NA 3I10A 4UMCA 5E1QA 4B5XA 4OQVA 2V5KA 3V1PA 2JIEA 2Q01A 2G3JA 4AFYA 3OA3A 2VP8A 3SJ3A 2B7PA 2ZUSA 4J9OA 1R3YA 2YBVA 3AMCA 4NXKA 4GK8A 1W9BM 4NILA 2ACUA 3G3DA 1EJWC 1NIUA 3DYOA 4I90A 3T0TA 3QC3A 3UG8A 1UJQA 3QHNA 3DH7A 2V67A 4UTMA 6CGTA 1O5XA 1P0KA 2CZFA 4NRRA 2PBGA 4BEQA 4Z42C 3W2JA 1WNOA 3WLMA 4GIAA 2WSRA 4X61A 3GXTA 4YR2A 2JEGA 4LC6A 2E28A 4UQ9A 5E0CA 2EJAA 1UKPA 1AMKA 3WUBA 3TSMA 5AYYA 4L6HA 3GO2A 4IPIA 1M01A 1C92A 3RRAA 2PDFA 3BPWA 1H5VA 2AU0A 2J7DA 1IM4A 2XPKA 2VX5A 1H51A 2WJDA 4WEVX 3QC0A 3WKZA 4IIHA 1PZ3A 4X2RA 4F4ZA 2J6UA 4FR1A 4DJFD 5K9XA 2QMKA 4MNKA 2OCZA 4IFOA 2I16A 4JHOA 4O15A 3ARXA 3A64A 1IR1A 2J75A 3L4UA 3PTMA 3R43A 4E8CA 4C6BA 2XWDA 1KC7A 4YS1A 4P8XA 4U5KA 4Y9MA 5M5DA 3ECQA 2ACQA 1HUVA 1TWWA 1QI3A 2HPMA 4NAEA 1GZJA 2WHJA 3W4RA 1YDVA 3PPCA 1DWAM 4OVXA 2Y7DA 1WKEA 1ONXA 1Q6DA 4O8RA 1V5XA 3VNIA 2NQ9A 3W38A 4HZ6A 1XIIA 1I0DA 2ICSA 2NV9A 2CXGA 2I14A 3PZNA 3LBCA 3G1SA 4RKAA 3I3BA 5EWFA 3WQ4A 5EWGA 5ABTA 3JRKA 4JQ3A 4K6AA 5C2CA 2OTDA 1OF6A 1TELA 3GIYA 4S3DA 4L65A 4L9YA 2YCLA 4PCNA 3G6MA 4QQUA 8XIMA 4HMNA 2NZLA 4IP4A 1JYXA 4JEQA 3OVRA 3A12A 2IMRA 1B2YA 1R3TA 3K2GA 3PB2A 4M1BA 1LUCB 2DW7A 4CNSA 1DORA 5HUOA 2OWCA 2EPKX 3LNPA 2JEJA 1QHZA 3LDVA 3UBPC 3OLEA 3APYA 3F2DA 2EPMX 4IGHA 4QIUA 4UTKA 2TODA 1UD2A 4D9PA 3CB8A 4FXRA 3RN6A 1YW1A 5KITA 3MCNA 2ZRZA 3U5YA 4KRTA 5DF0A 4BF5A 2VYOA 4GO8A 1TA3B 2NVCA 3A6OA 3GDLA 3NSMA 1AH4A 3WJSA 1T6MA 2BB0A 4JCMA 4Z1AA 2E5BA 4O10A 5A8OA 5EA9A 2J6TA 1LT7A 1MRQA 2BX7A 4UTLA 1UC5A 2GQ3A 3B9OA 3IWPA 3M7SA 4QJ5B 1GQKA 4JBRA 2DT2A 2X8RA 3QF0A 4O28A 3ICJA 1IV8A 1UW9A 3BAWA 5F2LA 4BQ3A 3H6OA 4WR3A 4H19A 3O16A 1B57A 2QV4A 3GLCA 4IGMA 3WLOA 4BQ5A 3DXIA 4TXEA 2ZDRA 3EA3A 3SECA 2V63A 1A4MA 3B9NA 4I3GA 3MSDA 4JTEA 5E6YA 3NL3A 1W3LA 3M07A 1FHUA 5GNYA 1KGUA 4C5YA 3ELFA 3GU9A 4CD6A 5I7GA 5KT5A 1X1NA 1R9YA 5KETA 4XTIA 3DU0A 3FV9A 1R9ZA 2Y85A 2PA6A 3GIPA 2QNEA 2W4XA 4TV6A 1WYIA 1I45A 4FB7A 3KXQA 4JYDA 1EQPA 3DG6A