1XRFA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
423
structure length
363
Chain Sequence
b'WMLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLDRLALIEGVKRGIIDCFATDHAPHQTMPGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotase
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 127
structure length 363
sequence length 423
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrfA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrfA02
4R88A 4HK5A 4NI8A 4IFOA 1M68A 3S2JA 4V1YA 3EWDA 1K1DA 1ITQA 1PTAA 3IACA 1XGEA 1EF2A 4DYKA 1J79A 3DUGA 2R1KA 2UZ9A 4OFCA 3EWCA 3D6NA 1NDZA 4XD3A 4KIRA 4ERIA 5G4HC 2P50A 4RDVA 3F4CA 4LEFA 3GU9A 4GY1A 1A5LC 3MTWA 2OQLA 2ADAA 4AC7C 2Z7GA 3URQA 4LCSA 3LSBA 3MPGA 4ERAA 4H9VA 4GY0A 1I0DA 3GU1A 3LSCA 3WYZA 4P5UA 3PAOA 2VR2A 3MJMA 4B91A 1KRAC 3F2BA 2WM1A 4B3ZA 2GZXA 3A3WA 3RCMA 1FWHC 2Q09A 4F0LA 1POKA 4C6LA 4CNSA 2E25A 2O4MA 4C6OA 4H9YA 2AQVA 1RAKA 4LALA 2Z2AA 3C86A 3T81A 4GOAA 3T1GA 4QSFA 1K6WA 4CNTA 3PANA 3IJ6A 4ZSUA 1RJQA 1R9XA 1GKQA 3E74A 3CJPA 4C6IA 3NEHA 4H9XA 3AU2A 4XD6A 1DPMA 4G7EB 3ISIX 3E0LA 4PCNA 2VHLA 4EPEC 3TN5A 3IARA 3GIPA 2VC7A 4H9TA 1V79A 2CZVA 4PE8A 2OODA 4XAZA 4IQJA 3GU2A 2ANUA 1EYWA 2G3FA 1FWGC 3GTHA 4NG3A 1KRCC 2Y1HA 3ORWA 3BE7A 2PUZA 3B0XA 3AUOA 4C5ZA 4WGXA 3E3HA 2IMRA 4EPDC 3UR2A 2D2HA 3LGGA 1J6PA 3N2CA 4C60A 4UB9A 4DIAA 1ONWA 3PNZA 4G7EA 1EZ2A 1YNYA 3IV8A 4J2MA 1ZZMA 1A5MC 1VFLA 2D2GA 1ADDA 4LAMA 4J35A 4CEXC 2FVKA 3PNUA 4INFA 4KQNA 2R1LA 1RK5A 1FWDC 3HTWA 2DVTA 1EJSC 4CEUC 3GTFA 4KEVA 2HPIA 1FWCC 2AQOA 1KRBC 4RDWA 3B0YA 4LCQA 2PLMA 4H01A 3WZ0E 2WJDA 4C6MA 1XRFA 2DVXA 3OJGA 4BY3A 2R1NA 2Z26A 2F6KA 4KESA 4TQTA 3TN3A 4DLMA 4GZ7A 3F2DA 4PCPA 4XAGA 3S4TA 4C5YA 1UIPA 3CAKA 4UBPC 1R9YA 2GWNA 3QY6A 4C6FA 3KM8A 2PGRA 4G2DA 4GC3A 3URNA 3CS2A 4J5NA 3G77A 2Z24A 4B92A 1YIXA 2YB1A 4EPBC 1RA0A 4XAYA 3O7UA 4GX9A 2YZ5A 4KEUA 3GIQA 1ONXA 3S2LA 1NDWA 4GY7A 1EJTC 2I5GA 4XAFA 1O12A 2VUNA 2R1MA 5LXXA 1EJUC 1V51A 3K2GA 3A4JA 3GTIA 1R9ZA 3MDWA 3URAA 2HBVA 3LGDA 5AKQA 4C6CA 3E38A 3T8LA 2E1WA 2Z25A 2HPMA 3HPAA 2Z29A 1FWJC 2Z00A 3MVIA 1W1IE 3URBA 2ZC1A 3LU2A 2ICSA 4Z42C 4IF2A 3ITCA 3JZEA 4I6VA 3RHGA 1YRRA 4GXWA 1QXLA 4AQLA 4ZSTA 1WXZA 4M51A 1NDVA 3OVGA 3B40A 4LFYA 3F4DA 3IGHX 4PBEA 5HMFA 2GWGA 1I0BA 3FEQA 1RJPA 3GG7A 1POJA 3TN6A 3NURA 1FWBC 4F0RA 1IE7C 3MVTA 3QGKC 2FTYA 2VC5A 3IPWA 3ID7A 4DLFA 5E5CA 3OODA 4H9MA 4C6KA 1HZYA 4WVXA 5FSDC 1ITUA 3A3XA 4MUPA 4IH3A 4LAKA 4XD4A 4C6NA 2EG8A 3GUWA 4DI9A 2GSEA 2PGFA 4QTGA 1JGMA 4E3TA 4DI8A 3QY7A 4IFKB 4C6QA 2AMXA 1QW7A 3SO7A 2XIOA 1UIOA 4H00A 4F0SA 4GYFA 4IG2B 1FKXA 4HK7A 1K70A 3GTXA 1GKRA 1RK6A 3LY0A 1A5OC 3QGAC 3OQEA 3MDUA 3NQBA 1S3TC 2OGJA 1A5KC 3GRIA 1EJWC 2QPXA 4HJWA 1FWEC 1FWAC 4LAOA 5FSEC 3S2NA 1M65A 1NDYA 4H9UA 4D8LA 2Z2BA 2Z27A 4L6DA 4LCRA 1YBQB 4IFKA 1XWYA 4CQDA 1V77A 4IG2A 2YB4A 2P9BA 4RE0A 4BKNA 1EJRC 1NFGA 4LH8A 4ERGA 1J5SA 2O4QA 1KCXA 4KEZA 3O0FA 1KRMA 2WJFA 2QVNA 1RJRA 3IRSA 3OOQA 5HMDA 4ICMA 3UR5A 4JOMA 5A6TC 2BB0A 1YBQA 1GKPA 4RDYA 1E9ZB 4DZIA 1J6OA 2Z28A 3FDGA 1O5RA 1PSCA 4WHBA 3S2MA 3ICJA 3PBMA 3FDKA 4C6DA 1P6BA 3WMLA 2R1PA 3UPMA 4BJHA 2FTWA 3LS9A 3AU6A 3TNBA 3LA4A 1A5NC 3MKVA 3QY8A 4KF1A 2Q01A 3E2VA 4C6JA 4QRNA 1RA5A 1FWFC 4CNUA 1FKWA 4C6EA 1EJXC 2YXOA 1P6CA 4HA0A 3GGMA 3R0DA 1A4LA 3K5XA 1V4YA 4KETA 4V1XA 2KAUC 4IGNA 4GX8A 2PAJA 2I9UA 4H9ZA 1FWIC 3EGJA 4DO7A 3DCPA 1P1MA 3DC8A 3RYSA 4NP7A 1PB0A 2EG7A 4LANA 4C6PA 5CH9A 2VM8A 4CQBA 4RDZA 3HM7A 3UF9A 3F2CA 4GK8A 2HQAA 2OB3A 1WXYA 2Z4GA 3RN6A 4L9XA 2GOKA 4C65A 4RZBA 2RAGA 4CQCA 4EPKA 3LNPA 2FVMA 3K4WA 3MSRA 4R85A 4C6BA 1UBPC 2HBXA 3TN4A 4KERA 1XRTA 1A4MA 1PO9A 3SFWA 1YMYA 4HK6A 2OOFA 4IFRA 2P53A 4B90A 2HNHA 4GBDA 2BGNE 3V7PA 2D2JA 4XD5A 3E0FA 2W9MA 4DZHA 2DVUA 4IGMA 5HMEA 3OU8A 1E9YB 4QS5A 3UBPC 4PBFA 4EP8C 2FFIA 1V7AA 4QROA 4I6KA 4DNMA 2QS8A 4QS6A 2WJEA 1M7JA 2A3LA 2UBPC 1UMLA 2QT3A 2EG6A 4R7WA 1BF6A 4YIWA 1EJVC
chains in the Genus database with same CATH superfamily
2A7NA 3B8SA 4ECZA 2ON3A 5AYBA 4AX7A 2ZX5A 1VBRA 3SGZA 3APYA 2FYMA 4H7CA 3W82A 6PTDA 5L6UA 4KIRA 4UWMA 1V3LA 4ADTA 3F5KA 3A24A 3I7RA 1JXJA 1Y5WA 1L2QA 4PMQA 2ADAA 2F8QA 3CMFA 3NVTA 1K9TA 5KFFA 3KLLA 1ZNNA 2WKGA 4GY0A 4ECRA 4PSRA 5T91A 1HVQA 1BKSA 1WBHA 1NFPA 4CVWA 4QCEA 1DIEA 5AYYA 5KFWA 2B81A 1CGUA 2VC6A 2FFCA 3LB0A 2GQAA 1FRBA 4W8BA 3O8AA 3G8EA 1TREA 3QMSA 2ZA3A 2XGIA 1NM9A 1EQPA 3TCEA 4C1NB 4UR8A 2WVVB 1JZ8A 4TX9A 1FVPA 2F6XA 2W66A 2J79A 2WM0A 2OQHA 5KITA 2IXVA 1OFOA 1F07A 5JQ9A 4NUWA 4OT7A 4FX8A 1ZQ5A 2RDWA 4JN8A 2OKTA 3KOYA 3J7HA 5MHBA 2VVSA 1JYVA 2Q8LA 1D7KA 1CXLA 1UD2A 5KTLA 4R3UA 1YNYA 2BX7A 1OIFA 4MSSA 4ED6A 5C0QA 1LWHA 3KHRA 3ZR4A 3GFZA 3KRZA 4INFA 3HU7A 3O63A 4R34A 3QC0A 1RK5A 1I4NA 3BQ6A 4XTIA 4JQ2A 1FOBA 1CW2A 3SEPA 3W84A 4H01A 2WJDA 4WR3A 4FSAA 1O5QA 2VFHA 1KBBA 5KFSA 4IRCA 3OZMA 1O68A 3ZT6A 2B0MA 3QZEA 4PYSA 3USBA 4Z2LA 4C5YA 5BYWA 4GIEA 3TA9A 3CHVA 2FZDA 3NYDA 3QY6A 3PZGA 4A29A 2CLMA 1VCVA 2XGPA 3SCNA 4W5ZA 1YIXA 2NQHA 1EC8A 2Y62A 7CGTA 9CGTA 1IZCA 1NARA 3BPWA 1XINA 4CD7A 3PZIA 3ZLFA 4C7DA 4PL1A 4QWEA 1EQCA 3NL3A 1IEQA 2W67A 5E0FA 4NJGA 2FTPA 2RUSA 4AY7A 1PL9A 3HQOA 5DCEA 4EXAA 2A3AA 4GE8A 1T0OA 1EWEA 2R6OA 4D6GA 3RAXA 2EF9A 3FOKA 2WHJA 4KCVA 4RNNA 3AC0A 3S6DA 5LZLA 3EOOA 4X61A 2GOUA 4QWAA 2PF0A 1XLLA 4NIRA 2E5BA 3WDQA 3BV7A 5IM51 1YW1A 2GUUA 3I3EA 3VOJA 1LTDA 2J7HA 3EX6A 4ZQRA 4IR9A 2GWGA 4WD0A 3QSTA 1ZBVA 4FHAA 1KBJA 3VGHA 2CXEA 3CUHA 5F4WA 1SJDA 2JE8A 1XLAA 1VBUA 4LGXA 2TSYA 3IPWA 3ID7A 2PF8A 5DXXA 4S3FA 2XWEA 1F2JA 2AU0A 1GHRA 3RXZA 1DWGM 1FY6A 2OFJA 1VFTA 1DXFA 4HHMA 1AL8A 1SZFA 2ZBTA 2CBIA 4JYFA 3G18A 3W7CA 5CEWA 3W28A 5I6SA 4HSHA 2W91A 3OGVA 4ZENA 4ACZB 1RK6A 4GVGA 3EKGA 3T8QA 3LCIA 1TG7A 1SO5A 3L68A 4JQ3A 2WB5A 4JTQA 2WSYA 2WMGA 4M82A 1OSEA 3G1AA 3WLTA 2QIWA 1XPYA 4MPQA 4J9OA 1JDAA 2NW0A 1XWYA 3UYIA 3H7RA 4WSJA 1LUCA 2YB4A 4JTUA 3LLFA 4JCMA 3DENA 1E1EA 4TIMA 4M3PA 2OSXA 3RM4A 2OGYA 4WXZA 4KIEA 1Q6OA 1US0A 1B1YA 1VJIA 4R9XA 2X1SA 1YBQA 3VCCA 1LL6A 2PWGA 3NFUA 4H41A 3QPEA 2VZSA 3LPFA 4IOTA 4REQB 3ZVHA 3EKLA 5JU6A 5G5IA 4F40A 2PGEA 1QI0A 4DO6A 1OHLA 4MG4A 3T42A 3KHGA 1VBJA 5DMMA 3UPBA 1GJWA 3LS9A 1VB9A 5I00A 2ISDA 2Q01A 2UY5A 1RA5A 5AC8A 4D6CA 5A2AA 3OLIA 3M47A 3NZRA 1UP3A 5LHEA 2Y6ZA 3K8KA 4ED1A 1GCYA 1KGUA 4MYXA 1XLHA 2PTYA 1DJGA 3QLDA 4WY0A 1CZ1A 2QCLA 2VEMA 1W5PA 3SJNA 5CQ1A 3TH6A 2X0HA 4R8UB 4L9XA 1R3TA 4J3SA 3H40A 1NY1A 3W71A 3Q8PB 1C9DA 5F2LA 5C9XA 1XUUA 3FHQA 5LSMA 3LCXA 3MSRA 1SYTA 4LUYA 1JFXA 4YHEA 1UR0A 1A4MA 3EDFA 1VYRA 5K7JA 5KFXA 4NI3A 4IFRA 4RNMA 4AH7A 5CZ0A 1F8MA 3R2GA 3FSUA 1ZFJA 4F48A 3MP5A 3RX3A 3I4EA 1JUBA 4O57A 3WLIA 1OCQA 3C56A 3TUUA 3LMYA 1CENA 5GVJA 3R0UA 1MDRA 2QS8A 3WF3A 1ZP4A 4IXHA 4Z1AA 3QTPA 2GQ9A 3N12A 2EG6A 3C2RA 4IL2A 4DVOA 1JDCA 3E0IA 2POZA 1M68A 4O17A 4Z1CA 4FF7A 2XINA 3NSMA 1PTAA 3P61A 3W7HA 1EF2A 2YJQA 1WNOA 1G5AA 4OFCA 4JTLA 4B9YA 6CGTA 2I5IA 5FIPA 2CC0A 3WLOA 2BXZA 4AF0A 2NQ5A 4DB7A 3TFCA 1ZBCA 3GG8A 4V27A 4NAFB 3FYPA 2OO0A 5E9AA 3WQ6A 1HIZA 4IIHA 4FZIA 4IT1A 4MKSA 4J27A 4GJJA 5BOOA 2EKGA 3NZ1A 2ZE0A 5GJPA 3FFSA 3NQEA 2V69A 1VAHA 2JKEA 3T78A 1W32A 1DBTA 1SQ7A 6REQA 4AIBA 3OZYA 1WQ5A 4NZFA 3AIBA 3KVMA 2PDQA 4GVIA 1WUFA 4IL0A 4IQEA 5EWEA 3B9OA 4Q8MA 4AXKA 3NO3A 2HVNA 2ABBA 5K3VA 1XLIA 1DJNA 2A1YA 3KHHA 3MS8A 1GKQA 2VXNA 2QPSA 4XISA 3EOEA 3PB0A 1PZ0A 1MXGA 3IARA 3W4RA 1S0MA 2GVYA 3TNOA 2C0HA 1SZEA 5GPRA 2PURA 1P0BA 5I3JA 3L2IA 1DEDA 3VIGA 3UZYA 3AIRA 3OW1A 5IXEA 4AIEA 4NXSA 2Y7DA 2D2HA 2DZUA 4N9CA 4XWUA 3E12A 4FXSA 4O1DA 1XCXA 3KP1A 1VKFA 1G9HA 3H8AA 3WBAA 3O3RA 1PTDA 1WAUA 2D3NA 2VFEA 5G4EA 4HPHA 4M1BA 3NEVA 3NOYA 1NSJA 1JPMA 3CUZA 1A49A 2CBUA 1V8EA 3NL6A 4E2BA 3VD3A 1FXQA 1GUVA 2AMGA 3QQ1A 2QDGA 1S9FA 1FHVA 1TMLA 2V5KA 4LT9A 2B31A 5J5RA 1Q6RA 1RSCA 2G3JA 3BMWA 4KPLA 4GI6A 2BZNA 3S46A 3QPZA 4DLMA 3UWVA 4QAWA 3IRDA 3UWUA 1Q63A 1TCMA 1TELA 1XS2A 1TA3A 1EEXA 1ML1A 4IM4A 2A7RA 2PDJA 5E0KA 5LNSA 1VFSA 3LQLA 4Q6JA 3UJSA 4XAFA 3TCSA 4QLKA 4MJZA 3LPGA 1UMYA 2XTKA 5D9PA 5AYXA 1LL4A 2V5LA 4DEFA 3MDWA 3CPRA 4DUOA 3LCWA 2E1WA 2DQXA 5FJIA 4OBSA 2I16A 4WLCA 4WDXA 3N2TA 4A21A 4HMEA 1J93A 2VDIA 2XPKA 4B5XA 2EPNA 5E9XA 4GGBA 1LP6A 4ZSTA 3BQ5A 1Q2RA 4DL4A 2ACUA 3CEUA 1UQZA 5JXQA 1SVDA 1B3ZA 2RDTA 2Z1BA 5C2CA 4K8EA 4KRUA 3OGRA 1KCKA 5ABTA 2Z0IA 1E6RA 2ZDRA 3IGXA 3BLEA 2ZUVA 2NLIA 4AZ7A 1Q7ZA 1Q66A 1QHZA 1FDJA 2FJKA 4IH3A 4LAKA 4YLWA 3HJEA 1XD0A 4DI8A 4JUZA 1QW7A 3VIMA 1SO3A 4UQ9A 5I5RA 1E70M 1LUCB 2CZFA 7TIMA 1VF8A 2ATLA 1E4MM 1XM3A 3IJ9A 5IDIA 3FCPA 3Q8RB 2IXUA 1NWUA 1YXCA 3CZKA 5LNRA 5KZMA 3MHFA 1MYRA 1XYMA 3PPHA 1MW1A 2V9WA 3ARZA 1YBQB 5G1YA 3ZVHB 2HK1A 5JVLA 4FOUA 3BLPX 3CZLA 2ZVIA 2XWDA 2Z7KA 4L61A 4LBUA 4LH8A 2V3FA 5L9XA 3CWHA 4FR6A 4J40A 5I3HA 1IV8A 1KRMA 1V3MA 2WJFA 1U83A 1QNRA 3SUTA 4MNKA 4JV0A 4H2CA 4AW7A 4EKJA 1V3KA 2NX3A 4WXYA 4JOMA 4RDYA 3NZQA 1Q13A 4O8AA 3GZAA 3NA8A 1C90A 3BMXA 3INPA 2WNQA 2VJXA 3HURA 2NQ9A 2YDQA 3WUFA 5K9DA 4WY0B 4BJHA 1Y0EA 1JD7A 4FB7A 3AI0A 3CQJA 2GGHA 1WDPA 4ILSA 1A50A 2CXGA 4C6EA 3GNOA 5FL1A 5CGMA 2VD9A 2QW5A 3UCDA 4HOZA 3TXZA 3EGJA 3DCPA 1QI5A 3DC8A 1DWIM 3MKKA 1BGGA 1SFJA 1L6FA 1PX4A 4PA8A 4B9ZA 4K6AA 3F2CA 1IT8A 2D3LA 3BJFA 4CQCA 2LLEA 1M3UA 5CC6A 3RJXA 4C6BA 2Q3RA 3QW4B 3BQ2A 4O1CA 5FEPA 3RUBL 3TX9A 4I9JA 1ZSXA 3WUBA 3OO2A 5A6SA 1GZ1A 4MY9A 2FLNA 2Q02A 2X41A 3VDHA 1GVRA 3UCQA 2DEPA 3AXHA 1GQLA 4XD5A 3EOSA 4HN4A 4F9JA 2DPJA 4NU7A 4E4FA 4IGMA 3CIWA 1UWQA 1LWIA 4QITA 4FS9A 1LORA 5REQA 3BAXA 3TSBA 1EIBA 1YKWA 3H21A 2E77A 1RYSA 4DNHA 3IK4A 2FGZA 3WF4A 1KXQA 3FLUA 3DFHA 4JR5A 3CAVA 1XHGA 5DRIA 1UJPA 2VX6A 3GHSA 1MEHA 4UQDA 3UWEA 1GEHA 4UTWA 4V1YA 2X8RA 4HMNA 2ZC8A 3KRBA 1J79A 1NAL1 1V93A 2Y85A 3WQOA 4BQ4A 2IKIA 1QW9A 3DH7A 1A3XA 1OF6A 1UZ1A 3TSMA 5XIAA 4AD5A 4GGHA 5AYIA 1I8JA 6REQB 3KAOA 4JTJA 1UP0A 1OFQA 3U8GA 1O95A 3WDRA 3LSBA 4F50A 3GIJA 4GUHA 3N6HA 3B0UX 3GU1A 1F7BA 1Q3NA 1QATA 4I7UA 4JNZA 5FCZA 5BU6A 1Y65A 4KW2A 1DV7A 3SJ3A 3VCNA 1KRAC 5EU9A 3VK5A 5IDZA 2JF6A 2ATMA 2Q09A 3A3HA 4A8NA 5DQGA 1GZGA 2E25A 5IFPA 3KOXA 4LTSA 1A0DA 2AQVA 3WJYA 1YEYA 3UJ2A 1H11A 2YOCA 4A2SA 1XBXA 3CNYA 3MB9A 4GOAA 2Z6JA 4Q8PA 1RJQA 3CTLA 1OZMA 3GYCA 2V2CA 1LQ2A 4MUZA 1TV5A 1W1ZA 4M6VA 3W74A 4PUKA 3W07A 2CZVA 1W5OA 4IGHA 4JTTA 1VCGA 3OHBA 4J3XA 1UR3M 4MMWA 4MHBA 3MR6A 4GFSA 3S83A 3SM0A 2NQZA 3O05A 2VDHA 1ZGDA 3A5FA 1OVDA 4BI6A 4N0RA 2J6UA 3QVQA 1OGSA 1R2RA 5T9CE 3ZJ7A 2DUXA 1X98A 1XCWA 3WBYA 5HMSA 4HMCA 1Y5VA 4L9ZA 3S9IA 3TC3A 4EYHB 1FWDC 3TJXA 4D6FA 5GJMA 4AB4A 5EY5A 1KW1A 1TA3B 4L4MA 1Q4NX 4F9DA 3SURA 3TOPA 3C5QA 1D8CA 3NGJA 1MQQA 4BY3A 2Z26A 3AMLA 1DQUA 1DQXA 3N29A 1P0KA 2C15A 4QNWA 1X97A 5M2FX 2PBGA 2WCSA 1K9EA 3OZPA 5GJNA 1ELSA 1NTHA 1W1TA 3MP3A 3VIPA 1ZU8A 3VILA 5FJJA 4TUFA 4GKLA 4GX9A 3V1HA 4WEVX 2ZUSA 1FQ0A 4K8HA 1QDSA 4IMDA 4IMFA 3R1ZA 3PPGA 3QR1A 5EPDA 3CAQA 4HNOA 2WHKA 3JRKA 3PFRA 4WKHA 2Y2WA 2CFFA 4V15A 2Z29A 1QJWA 3PW0A 1XFCA 4I8YA 3C61A 3EX2A 1FWNA 1FFQA 2QCGA 1S2WA 2P0OA 1IYXA 4IPJA 3QR3A 4AD3A 5KFRA 1BAGA 4XZWA 3DGBA 1NDVA 1TIMA 1MZHA 5A8GA 3F4DA 3UWQA 3HOJA 1BTMA 3NGFA 3EPNA 4MNJA 4H19A 2OMAA 1W3TA 2VA3A 4E2VA 4ZQMA 3MWCA 4FXJA 1H1NA 5A95A 4RZRA 1W0MA 4MZ1A 4CD6A 3COTA 5AFDA 4Z0JA 4YXGA 3GUWA 3QQ0A 3LGEA 2BHUA 2J27A 3RIKA 4RXGA 4ECWA 4HNTA 1IGWA 3VE7A 3GILA 5KT3A 3UWZA 1QHPA 3D3FA 3OIXA 4GYFA 3NPXA 4XQ6A 1CIUA 1JNDA 1GKRA 1UR9A 3MDUA 2QJHA 5IBXC 5TBOA 1A5KC 4ED2A 4RXFA 3LM7A 1Q85A 3B9NA 4R53A 1FWAC 3WK2A 4CNNA 3GC2A 1NDYA 3DECA 4WDWA 2Z2BA 4W84A 2QV4A 4QJ3B 5TIMA 3LHTA 1FWWA 4RV3A 1H61A 5EFFA 8XIAA 1IZKA 3MUAA 2CEQA 3CH0A 4BKNA 3LV6A 1EJRC 1ISZA 3BH4A 2YL8A 4HKPA 3LCGA 4QNEA 4KWOA 4IMGA 2A3BA 2DZPA 2VUYA 4QISA 3IUIA 3AICA 3W2MA 1YDNA 4DJEC 3R7MA 1LZOA 1RVGA 2CETA 4MDPA 3W7DA 1VPYA 4M7TA 3ITOA 4UTJA 3PJWA 4HNCA 2UY2A 1I6NA 1TV7A 4DF1A 4N6EA 4YYCA 3WH9A 1VCFA 5BMWA 1YYAA 4HCDA 5I06A 3GKAA 5I02A 2XVLA 3AIVA 4X9SA 5F2MA 1EA9C 2WC7A 1FWFC 5F9NA 4LVBA 3W2KA 4B15A 4O16A 1W37A 4HA0A 1MZRA 2NX1A 2D69A 1TJPA 2ASHA 3EA2A 2X42A 3EX1A 4DAFA 1YDVA 3U5UA 2V5DA 1AQMA 4ECTA 4JFUA 3KUMA 3LOTA 1RV8A 2DW7A 3AHTA 2WC4A 1WZLA 2WNNA 2XISA 2HVOA 3RPTA 3DFNA 1HJWA 3S1GA 2WANA 4FEZA 4O50A 5REQB 4IP7A 3STFA 2BDQA 3LUTA 3ZT5A 3Q65A 1F9CA 2ISFA 4AZIA 4A8LA 1HL2A 3U2ZA 4U5KA 4AC1X 2C71A 2VZVA 5BROA 4KGJA 5CGQA 5C5YA 1EF3A 2WCAA 3TTSA 1FX6A 1W9XA 3TOYA 1TQJA 3N4FA 3KDOA 2V3EA 2WVSA 3RAOA 4I6KA 5AN7A 2ZZ2A 1H7PA 3ARXA 2A3LA 4WDTA 5SWUA 2EPOA 2A85A 3WD4A 2AQ4A 3DI0A 4RPPA 5KFAA 1F74A 3DFOA 5C2XA 2VCBA 3GE7A 1QTWA 3N6QA 5EB8A 1KWKA 5MKGA 5I7GA 4RL3A 3WQEA 3S5NA 1LM1A 3RU6A 1E9IA 2QHAA 3RM8A 3W85A 1Z32X 3L4UA 2VEFA 3D6NA 1UH4A 4DWSA 2VZTA 1DWJM 4BR1A 1XBVA 4ERIA 2P50A 4QG9A 1ECEA 3C2VA 4JIQA 3MTWA 2BOEX 4MNLA 4AC7C 2R8KA 2Z7GA 3CZ8A 3EWWA 1FWSA 5LNUA 2KZHA 2V5CA 4QM1A 3WYZA 2VEPA 2J8GA 1ZUAX 2RH9A 2QAPA 3RB4A 3DAQA 1BXBA 1OX6A 2ZX6A 4ATWA 3FV9A 1B2YA 1DHPA 3ZS4A 2ALDA 1B3YA 1EO5A 2O4MA 1LCOA 4AVOA 1PDZA 3N34A 3UWWA 3FVDA 5DLGA 1Z9AA 2E8YA 5LHFA 1M53A 2WQPA 2WAGA 1I2NA 2YFNA 2JBMA 1GVYA 3PANA 3RPMA 1T6MA 2BVWA 3FAXA 3E74A 5AZ0A 3K8LA 2J7FA 3AWNA 1JPKA 3UG4A 3E0WA 1CLXA 4RZ6A 3WDIA 3TN5A 3V6JA 2W27A 1QWKA 2XH4A 2G3FA 3BOFA 1FWGC 2ACQA 2E6FA 5KZ6A 2D73A 3EWZA 5DMLA 5AY7A 1PTGA 5AOUA 3KE0A 4DO4A 4W7VA 4WOQA 4UB9A 2Y70A 3EX3A 4G7EA 2IS7A 1RUSA 3VNJA 1W56A 4X3ZA 2AGKA 2PWEA 2DSKA 1EHNA 4S3CA 4NX0A 4GC6A 5A6LA 1FBAA 4O15A 2OU4A 3K8MA 4JTHA 4LYKA 1K7XA 4LVDA 4MJ4A 3OB8A 1E6NA 3RR1A 4Q4MA 1XCFA 5A6MA 2EEXA 5HUOA 5AC5A 1ZETA 2DY3A 4O1BA 4PUJA 3ITTA 2X0YA 3IK2A 1FP8A 3FEMA 4NF7A 1S3HA 3MO4A 4WY0F 1MDLA 4IHCA 2C79A 1UIPA 1I2OA 1U5VA 4ED7A 1WA3A 4AWTA 1ZJAA 1TWWA 1ICSA 1JCLA 4G2DA 3CS2A 3B0VC 2DSUA 4AHOA 3GW3A 2ZX8A 4DYJA 1SM9A 2YZ5A 2YW4A 1C3FA 2I5GA 3WQDA 1PYFA 2VUNA 4U28A 3T44A 1EJUC 1HJUA 1I75A 4C7FA 2WO5A 4RUCA 4FAMA 3W6YA 4XZLX 2VFDA 5TF0A 1GVFA 2XIIA 3BARA 4NZ5A 3FS2A 4KFNA 4E0CA 2C2EA 1JXKA 3G1FA 4W89A 4IF2A 1F05A 4J3VA 1MUCA 3P60A 3G1SA 4N9DA 2DSWA 2X1RA 4QG8A 1G7VA 7REQB 3TZNA 4HOXA 1LBMA 3B40A 4N7QA 3ZFHA 2Y7EA 1B57A 5KT7A 3KFTA 2D2OA 1AMKA 5KFCA 3VPLA 2FB2A 5I23A 1TYGA 5CBBA 1POJA 1W9DM 1AW2A 3SQSA 3MVTA 3H24A 2HE5A 1J2WA 2FTYA 4GZJA 2VMFA 3BW3A 3H2MA 2EXOA 1IZJA 2QCHA 1M41A 1IR2A 3ENLA 4QTGA 1V6UA 1SMAA 1LQAA 3H4XA 4FLRA 4IMEA 1J0HA 4Q7IA 4O3NA 3KS5A 3VFCA 2XIOA 3P62A 1R86A 2X1UA 3GIMA 3E6EA 1CBGA 1W8SA 5KFVA 1XSIA 4GWEA 4RKAA 2P8CA 3QN3A 3UFYA 4M81A 2E28A 1WB0A 4OUEA 1VEMA 3AMCA 1BPLB 1QASA 1M65A 1LLZA 1DE6A 2Z27A 1UB3A 1F3TA 4ZFCA 1OGGA 4UCFA 2C1IA 1GTEA 2DJLA 5LNWA 4UTTA 3GYEA 2ZX7A 2W61A 3ZIZA 2VKZG 2AL1A 3HV8A 4DELA 3G1HA 4PSPA 1D8WA 2BFGA 3ZSTA 3HA1A 3KRUA 1RJRA 4NAEA 4PUMA 4FK9A 4DJDD 2R14A 3CWNA 4DXKA 4QHRA 3LRKA 1ZBKA 1D9EA 1PSCA 3DKLA 3CHDA 3U9IA 3WLLA 5E70A 3S5YA 4DJFD 4GNVA 1BWLA 4LPCA 4BWLA 3K4AA 2WWDA 2OT0A 3SCQA 4UMCA 1V02A 3THAA 2YXOA 1MUWA 4I8DA 1KR0A 3K5XA 3WLHA 4KETA 2X1TA 2PAJA 3WH7A 5DRCA 1M1BA 1ICQA 3M16A 3IGUA 4LANA 4Q8UA 4O8RA 1WXYA 4PBGA 4QJ4B 1IEIA 4ROPA 2QEZA 4OKDA 2FPYA 1T3NA 1QO2A 3PBUA 3T2QA 3CUIA 3GW0A 4NKCA 4B3KA 2BVTA 4Q4QA 3M4HA 3BC9A 4JAWA 1FH9A 4NYYA 3W2NA 3GNNA 5MKGB 3NO5A 2DVUA 4QAIA 4MWAC 1V7AA 1MNZA 2YXXA 3TYAA 5GNZA 4J9NA 4MJ2A 4DWSB 4XKYA 3UG8A 3AHZA 3STGA 2R91A 2ZDSA 2BWGA 3M5XA 1OBAA 4ZA0A 3W7NA 4JN7A 4Y96A 3ZWSA 1OT1A 4YIWA 1SSDA 1Y7VA 1S10A 1NP0A 1Z48A 3MMWA 2AOSA 3S2JA 3U2CA 4B3LA 3A47A 3PBWA 5IOBA 3LDVA 1E0TA 3PW7A 1W2VA 5IFTA 3WELA 5K9CA 1CXEA 3CPUA 2HRWA 2FVLA 2VENA 3P14A 4KH2A 3GHUA 4QQUA 4NJIA 1EUNA 5CPMA 3OTRA 4H1ZA 4XD3A 3OGSA 3CM4A 2ZRXA 3B8TA 3PR2A 3LHWA 1ZJHA 2QJMA 1TZZA 3O06A 3RJYA 1BVZA 1ZPTA 1FHUA 2OX4A 1XYFA 4KGLA 4A3YA 3OA5A 1L2UA 5HAOA 5DO8A 3FNDA 3BAKA 4ML4A 2YR1A 4H04A 2PDYA 3EMCA 4M24A 1XKYA 4TX6A 4DF0A 4CNSA 5MF5A 3M5YA 1KBIA 4C6OA 2FLLA 4ZXLA 1JDDA 4MWAE 2NV1A 3W7JA 2HXUA 5HINA 2POTA 3T81A 3ABOA 4FNPA 1IF2A 3KWSA 3SRDA 3GV8B 2V63A 2ZUWA 3ANYA 1ONRA 4G7EB 1JGIA 2E9LA 2I17A 4ALDA 4JFWA 5D03A 2G96A 1HKWA 4PE8A 1KGWA 2VRKA 4O10A 4IIEA 3AAMA 3ZMRA 1LOLA 5EMJA 4JCLA 1W1B1 5HQLA 2UVWA 2XZ9A 1B3XA 2FGBA 2XSBA 4AD0A 2NZLA 2PCQA 1EA0A 4E5TA 3CUJA 4J3ZA 5L1JA 1X8CA 3ITGA 4PTNA 3GXTA 1UH3A 1BYAA 5B7ZA 3TJ4A 1QT1A 3UR2A 4D8AA 1UD6A 4IP5A 2PRMA 3DG7A 4X63A 3AXXA 1U1HA 1VFLA 2D2GA 2XH0A 3BLOA 5FAJA 4MF4A 3MKCA 4RZ5A 3GNPA 3F5JA 4KEVA 2G3NA 3KCOA 1HGYA 4I5XA 2OLSA 2XIJA 4OJYA 2OWWA 3V5OA 2Z1SA 3HFYA 2YA2A 3OJGA 1YE6A 2PE4A 2RDUA 3FXYA 1IWBA 5FF0A 4IWWA 5HANA 4TQTA 4UQBA 4O11A 6A3HA 5HOSA 1KM6A 3KTSA 4PCPA 3NL2A 2RGLA 1QCWA 5FKYA 1F76A 3UG3A 4UOJA 4NRRA 2GWNA 2GVJA 2VX7A 1ISYA 2PGRA 3URNA 5CC5A 3G77A 1P0DA 1TSIA 3UZJA 4D6HA 2JF7A 4WK9A 1PHQA 1GOIA 3TTYA 5LGZA 2AKMA 1GOOA 3R13A 5BXRA 3V4BA 4ZO7A 4MIMA 1EJTC 1XIBA 1TE6A 1PKYA 1O60A 1OCJA 2I7GA 5D9OA 3LLDA 3EPOA 3RLUA 3WLMA 3URAA 4IIBA 3B8WA 2PDXA 4C6CA 1EFZA 3PG9A 1PKLA 2Y89A 5BW6A 4W93A 2IKHA 4ML9A 4FXFA 3ITCA 4H8NA 2Y5SA 4HD5A 3B4UA 3FJ4A 3N17A 4AQLA 1V3JA 3OLGA 2B7PA 1U30A 5A8NA 4RUBA 3PZPA 5TD4A 1EYEA 3AMGA 3WFZA 1QPKA 3EPMA 3GTNA 3C3NA 2I14A 4N2YA 3NXFA 1KFBA 1OX5A 4KWVA 1M7XA 3ABZA 1R30A 4B4HA 3S0CA 3W00A 4DLFA 5E5CA 3D5HA 1IT0A 3CHCA 4NJJA 1SR9A 2NT0A 3PBVA 2H9AA 2PGFA 4TVCA 3CIVA 5CSRA 3RU8X 1QO5A 2A2IA 4MZ8A 3WCZA 3W53A 3W9ZA 2YL5A 2VGBA 4AMCA 4F0SA 3JS3A 1AODA 1FH7A 2BVYA 3MHUA 2PP0A 1S3TC 3CT2A 1MEIA 3BAWA 3C2YA 4HCHA 1KM0A 2O9PA 4LAOA 3TWAA 2VFGA 2ASJA 3H22A 4D8LA 4E3VA 1GQJA 1VPXA 1BEUA 4GD0A 5C55A 4IJRA 1B4EA 3SCVA 3EA3A 3KP0A 3W72A 1BRLA 4QWBA 4H2HA 4U33A 3WJZA 5DLCA 3S5OA 3HQPA 1KTBA 1L0PA 4PTDA 1MXSA 5AHFA 1NFGA 1Z89A 4ERGA 1J18A 2O4QA 1F6YA 1ALDA 1XLFA 4A35A 3QKZA 4K2SA 4ICNA 5A6TC 1EUAA 1GKPA 1KTNA 1E9ZB 5CZTA 1J6OA 2XN0A 4KRZA 3EWUA 2P76A 4X0NA 1SZRA 3QV9A 3NDYA 1CECA 3N11A 3U0HA 2IPJA 3WK3A 1HVXA 3WMSA 4LW7A 2OLHA 4FMVA 4Q4RA 1K8ZA 3B8VA 4G3IA 4AYGA 1JF5A 3Q8SB 3W1RA 4CUCA 3KBWA 2WTFA 3ZR5A 3EWYA 3WLKX 3ELFA 1NF7A 2VR4A 1P6CA 2E6DA 1KLZA 5KFYA 3RB6A 1LG1A 1XLCA 4J9MA 3BQ1A 1EDGA 1B31A 4V33A 1ZRQA 5FJTA 1FDYA 3MHGA 4AWUA 3TWBA 1FTXA 3RBEA 3I6RA 2J7GA 4I9AA 2BSLA 1MQRA 3PUOA 3TQ0A 4M7SA 4LUSA 4QR6A 1SZNA 3MYOA 3M64A 3R10A 1XYCA 3DHFA 2NSOA 1GORA 2ZRYA 4DWSD 4XKYB 4YMZA 3RMJA 1UOZA 1PO9A 4XIAA 1UKOA 4F0HA 4H7ZA 3QYQA 2WC3A 1E51A 2HNHA 1AQ0A 1GG0A 1K02A 1DTUA 3KW3A 4PMXA 2FZBA 1PZ2A 5I78A 5DY2A 3LERA 1CXKA 4S1FA 1S46A 4JYDA 3SRFA 5HWMA 1V3IA 1A5BA 4DL7A 1CGTA 4J3TA 3SSZA 4NZ3A 1W1A1 3BCJA 3OQ8A 1GONA 3H2EA 4DM2A 2C19A 1O94A 3ZLGA 3GR7A 1VS1A 3EWDA 4LVAA 4KBXA 3V18A 4UMBA 3LTPA 1AJ2A 1GK8A 3BWWA 1QHOA 3C2FA 2E5CA 3R58A 5DQPA 4X9YA 2VP8A 2Y7GA 1A5LC 2NVAA 3VTRA 4ZOAA 3WFAA 3URQA 4ERAA 1DL3A 3QOMA 4H9VA 5F9LA 1FHLA 1E0VA 4W7WA 2CWNA 4WKAA 2QJIA 3GDBA 2VR2A 3CXOA 3W27A 3N73A 4JN6A 4G7FA 2UY3A 1OEPA 1QR7A 1QNSA 1QOQA 5DFAA 1K4GA 2OKOA 3T5KA 3QPYA 3CK5A 5DG8A 3D3AA 2QCFA 3RAQA 1XDJA 4UOQA 3WLRA 1KM3A 3T1GA 5LXEA 1SGJA 4IUGA 1W5QA 4GXMA 1RR2A 5LA0A 3RK8A 2NVDA 2BOFX 4TMBA 3U7BA 4I9TA 2FPVA 4I90A 4PCNA 2VHLA 1JCMP 2XIBA 5U4NA 2GSJA 3KBSA 4GHRA 2OODA 3SY8A 4U10A 3WJXA 4EACA 1RVKA 5EWFA 4NY2A 1X6NA 3KBJA 2ZIDA 4EANA 4JIRA 3KHJA 5FACA 4TQRA 4F4XA 1EP3A 2A6LA 3B0XA 4HSOA 1OD8A 1RQBA 1YX1A 4YL2A 5FJOA 1QAPA 1U1JA 1J6PA 3N2CA 1XIDA 4HIBA 4GIYA 1H7RA 4D9PA 1QWGA 1WKFA 1CGYA 1ZY9A 4DXVA 4O18A 1JIBA 2VELA 4AWSA 3H2AA 2R1LA 7TAAA 4GPNA 4FNSA 5EDWA 3UJRA 1RP9A 4F0KA 5E6YA 1E1CA 3L2MA 1M7OA 1YPXA 2PS2A 2NQLA 1M04A 1R3VA 3GFXA 3L7RA 4GVHA 5A94A 3TE9A 2E8ZA 4Q7NA 1CI1A 2Y24A 4FLSA 4YJ5A 1J10A 1ADSA 4IRDA 4UBPC 1ZENA 1VJZA 3KM8A 1OGBA 1Q6CA 1PVNA 2XZ7A 2GSHA 4EXBA 1G67A 4E2OA 5HUPA 4I7WA 4GUFA 1Z44A 1QBBA 3BAYA 3S2LA 3GXIA 4BCEA 1J01A 4S2BA 4JYEA 4QQ3A 3NWRA 4ZZ9A 1Y5XA 7A3HA 3K2GA 2NXGA 4MTVA 2HBVA 5BOFA 4NYUA 3REQA 3WBWA 3NPWA 2BQRA 3BG3A 5EYWA 2WHLA 1SMDA 2H3BA 2C2RA 4UNKA 3MVIA 2ZTJA 3URBA 4D6DA 3XIMA 3SCWA 3C8FA 3NJ3A 4HZ6A 3UXLA 1KD0A 5HR6A 1IHIA 3CL8A 3N18A 3P0XA 4M51A 4XO6A 2TRSA 3TA6A 4JIIX 1J0ZA 4RE3A 2C3ZA 3P6LA 1H7XA 2CBVA 1Z42A 3ARTA 3GG7A 3IIZA 1EIXA 2PBOA 3NURA 4L6OA 2JALA 2XJ7A 3M0ZA 1Q6GA 2PDMA 1G6CA 3QSRA 3H70A 5BXPA 2ALRA 1EDQA 3OVRA 3WX7A 1XSJA 1V7YA 2ZXQA 2FLPA 1JAKA 2X7VA 3EAUA 3KBVA 3C8NA 3T5JA 1N8IA 1BXNA 5CLWA 4P8VA 1R46A 2IKGA 3NIYA 5C8BB 4A8IA 1RPKA 3BZGA 5KFEA 2QPXA 3FIGA 2V8ZA 3VYLA 2CLHA 3KXQA 1KM2A 3ARWA 3P7YA 2QAFA 3SIZA 2W3ZA 1XDMA 2P9BA 3AIQA 3VOFA 4GH3A 3V36A 5A3HA 3T0DA 3A9IA 2J8FA 3VDAA 4Z2KA 2H6RA 5HULA 3VGDA 1JYXA 1TWDA 2X0SA 3IRSA 1B9ZA 2V3GA 1UD3A 2QV5A 3GR4A 3AIWA 1JAEA 1E6XM 4OTKA 4AZGA 3S2MA 4C6DA 2VEKA 1LROA 4HOWA 1I60A 1VZWA 2W4XA 4YYFA 2PGWA 1U2YA 1OG0A 3MT1A 3RBDA 1K1QA 4LS2A 4LUSB 2NVCA 1XLMA 4BI5A 4QRNA 4F79A 3WLJA 3VOCA 2ISSA 1FKWA 4CQ8A 3ME3A 3UA4A 4TV5A 3ARUA 1DJIA 5C70A 2QGYA 4JD4A 4Z08A 3ITVA 4DO7A 1AQFA 3CBWA 2EPLX 4GZIA 1XG3A 1XIMA 4LAUA 1Z7AA 2V5JA 4GYKA 2CLIA 2WMFA 3CZGA 3T7VA 4TR9A 3ES8A 4PRWA 3MR2A 4S3EA 4ZL1A 4MB3A 3IGSA 4WOZA 3GVQA 1KCZA 4RNJA 3BVJA 2YCIX 4N9EA 3L4VA 3LZ5A 3GKFA 2BQUA 3NNTA 3MUIA 5DXYA 2OYMA 2CZEA 2BNJA 4IPNB 1KQYA 1H49A 1E72M 1TB3A 3TW9A 3B9DA 3ZSSA 2MANA 3M0XA 3FAWA 4RE2A 4GISA 4K8GA 4PBFA 2VYOA 1XSKA 3ZOAA 3MCOA 1XDLA 1XPGA 1TMHA 4QW8A 1X1OA 3M46A 5GNYA 3WQGA 1LBLA 3PTMA 2CKRA 4UFKA 3GY1A 2PRHA 4YTTA 2C28A 3MMDA 3UJEA 2DJXA 4N02A 3WFLA 4YVPA 1OZQA 3AO0A 1NDZA 5FF7A 5HWNA 2RJGA 4JX5A 2DT0A 3DN5A 3O15A 3W26A 3F4CA 1PX8A 1C9WA 5L9FA 4TVDA 2G50A 2P3ZA 4YCPA 4CCEA 1I45A 4PUNA 3MPGA 1S5WA 2QXWA 3PBYA 1OIMA 1AH0A 2BY0A 3PAOA 4H3DA 3OLEA 4D71A 1LJYA 4W5UA 5E0CA 3VM7A 1V08A 2WM1A 4B3ZA 1XR2A 3CV1A 3PW5A 3C0QA 3A3WA 4IMAA 3VIHA 4Q22A 4YR0A 2J6TA 4ZE4A 2VX5A 3W73A 1XW8A 3ALGA 1UKSA 4S3KA 4BZYA 4XBSA 2Z2AA 5A2BA 5C9RA 3BCFA 4D6IA 1BVNP 5EMLA 1E4NA 2RDJA 1US3A 1VEPA 3IIOA 3G6YA 2RHGA 1DPMA 1E5JA 5DGAA 1KFLA 2VC7A 3TK7A 1SR0A 2G41A 2XVKA 5D9MA 2ZADA 3KVJA 1KBLA 1E3ZA 1CB7B 1ODZA 3OIHA 2IQDA 4HZ7A 3H7UA 4HB7A 1E1CB 3G24A 3BUVA 2DIEA 1ESWA 3AYVA 3ZVIA 3P0WA 2R9RA 2X7WA 4RUAA 2PDLA 3IV8A 2DUAA 1DJYA 1E1FA 3T4WA 3W7LA 3S1XA 3U5YA 1FP9A 2VCCA 4B16A 4IRKA 1EEPA 4A05A 5FAGA 3BXWA 3T5LA 3ZT7A 1CB2A 3C0JA 2V6AA 4AEEA 2IUZA 4BK9A 3DXIA 4FNQA 1G1YA 3ZM8A 3ARRA 2AQOA 1A5CA 3LCFA 4HHPA 4RV8A 1JZ3A 4B5TA 3BLFA 2QF8A 4LJ3A 1I9CB 1WAWA 2PD5A 4KESA 4GZ7A 2OPJA 3F2DA 4LBRA 4D6JA 2ZRZA 1Q8AA 1MI3A 3REQB 3HN3A 4DL3A 3VNIA 1H50A 4JQ1A 5CJ5A 4ONVA 1D3HA 1OJXA 1DP0A 1RA0A 4ORMA 4KEUA 1UD5A 2DORA 3APGA 4AIUA 4F4YA 3L5LA 3PM6A 2Z1WA 2XHYA 2J7DA 3P8IA 3DG6A 2HNEA 1T99A 1ZTVA 4LXFA 1JQVA 1IEWA 3LGDA 5AKQA 1OY0A 2FIQA 1IXOA 1WZKA 3KVKA 3PZOA 3IANA 3NQAA 3UY7A 1FWJC 2Z00A 3SR7A 4D6EA 4PUWA 1KM1A 4YTUA 5KT5A 4ECYA 1XBYA 1BQGA 3IIPA 1QXLA 1GOKA 5KFTA 3A13A 4OOZA 4MLRA 2VGFA 5EMMA 3TMQA 2AGPA 5I3KA 1M6JA 1TWIA 1BVWA 3N2BA 3W1MA 4DPPA 4LFYA 1EWDA 4PBEA 5LNVA 3GHTA 2A3EA 1BG4A 1UD4A 3FEQA 1KBKA 4QFUA 3MR3A 1SW0A 4S3JA 4Y9MA 5C6MA 1R3RA 6XIMA 4HNNA 3V5FA 1A53A 2OJPA 1VBGA 3DHPA 3ERPA 4B5UA 1GOQA 1XQLA 8CGTA 4Q8VA 3ATYA 3W29A 4HBKA 4C6NA 3QOKA 1F3EA 3EOUA 3UZ5A 2AGQA 3BL3A 3ZJKA 4PUEA 2QDEA 4IIGA 3TR9A 4H00A 4NNBA 4Y6GA 1EPVA 5DANA 2OWCA 3W01A 3DOPA 2OGJA 2FB3A 3GXNA 4MAVA 2XN2A 3N14A 3SECA 3N2MA 4K1GA 3DU0A 3G1YA 1EZWA 3NQ2A 4U2YA 4GC7A 3A4AA 4PMNA 4LRTA 3EPGA 5EGRA 5AC7A 4B5SA 3TLLA 2YBVA 4IFKA 1ONEA 3G0UA 3EBVA 2E5DA 2ABAA 3G6XA 4PTWA 1C7SA 5I77A 5H8UA 3JU2A 3EDJA 3G1RA 4JIEA 1E0UA 2AGOA 3PW4A 5AHEA 3N4AA 3KCJA 3GXFA 1XD1A 2PODA 4WCJA 2BLEA 3I3BA 3EEZA 3G2GA 4R7OA 2YBTA 3FK4A 4DBSA 1E9LA 2QLYA 3RF9A 1XH2A 1K8CA 4GACA 1N8FA 3OOQA 1BFNA 5D2WA 1WV2A 4H83A 3A21A 4QWDA 4X60A 3MY9A 2AQWA 2Y8KA 4DZIA 4DL6A 1ZHAA 4TMCA 1RYRA 4Q33A 2FDMA 4B5VA 2OEJA 5CJMA 1FWTA 1O1HA 1CTNA 2J7CA 1E4LA 3POCA 4C90A 3UPMA 2V67A 2QCNA 1J4EA 4DEZA 2QDHA 3U48A 3AU6A 3M43A 3WUEA 1KKOA 5HQEA 4PB5A 3LHVA 1MNSA 4DXXA 2EO7A 3B8UA 3M0LA 4GX8A 3NQCA 1OC5A 1G4PA 3HG5A 4ZODA 1B5TA 1UD8A 4FI4A 3KHLA 2QVHA 3V6KA 1W3IA 1YNQA 4L9YA 1WE5A 2E09A 5HA7A 4R5EA 4XVDA 5CH9A 3THUA 3GDTA 4GIAA 3O6CA 2OB3A 3CQ0A 3BQ0A 3RN6A 4PODA 4Z17A 1E40A 1PUDA 4B5WA 2B4GA 3JZUA 2YCKX 1Y8BA 4JZ5A 4GJIA 3BV4A 1S5NA 1GJPA 4EE9A 3VOGA 4LB3A 1S5MA 3TQVA 3W6LA 5A8OA 3VD4A 4GVFA 4HK6A 1AJZA 2G4JA 5U7SA 1TV4A 2DZTA 2R8JA 1LWJA 1TWSA 3N9RA 2J9XA 3MANA 3T07A 3BOLA 3E0FA 2W9MA 5DY3A 5L1KA 1LT7A 3UETA 4EP8C 2FFIA 1Q6LA 2PZ0A 2FGLA 1HF6A 3CMGA 3AYRA 3B0PA 3AXIA 3PZMA 4DNMA 1R7OA 9XIAA 3GIYA 3V0SA 1QW8A 5DX7A 5D2VA 3G22A 4QXIA 4CU7A 3WF2A 3TR2A 4HK5A 3WLPA 4L1XA 1KNWA 4IFOA 2ZE3A 4O13A 2I1OA 3IS4A 1K1DA 1ITQA 1OT2A 1IXNA 3M1ZA 3IEBA 4Z1DA 4MDOA 3FN9A 5ECUA 4PMVA 3GX9A 1XLKA 4P7RA 2WVTA 1FXPA 2CNCA 1AH3A 3O2LA 1DWAM 2JEGA 3LRLA 4Q4KA 1FWRA 5KT6A 5IBXA 3SRKA 4ATDA 4EBCA 2GUBA 3GC4A 2WMHA 3O1NA 4PN2A 1PKNA 3N4EA 4KCUA 1R7AA 1ICPA 2I5QA 3GH7A 1MO0A 3LD5A 5CCZA 2Y88A 3AYTA 1YXYA 3NQMA 4BEQA 1JZ6A 1QBAA 1CLKA 2Y0FA 1JQXA 4LV9A 1I1XA 4CNTA 3MMTA 3IJ6A 1LQ0A 3E5PA 4C6IA 5T9BG 4XD6A 3T09A 4DJEA 3GUGA 2WK2A 1RY8A 3BW2A 2NQJA 3BSGA 1JL8A 1V79A 1X38A 2PRLA 1R2SA 4WKFA 3QZ7A 3GG1A 3LXBA 3C2EA 4PEEA 4A4AA 3F03K 2PUZA 4ZEPA 5DLFA 1YTKA 4K3ZA 1TV8A 3SCSA 3DZ1A 3L23A 4J7RA 2VTFA 1QUMA 1XUZA 4RX0A 1EX1A 4LB4A 3LBMA 1XV8A 1UROA 4R7JA 1GVSA 2CHRA 4O0ZA 1HKJA 1H63A 2DFAA 1VFOA 4KFPA 3RM9A 2OH2A 3KRSA 2CIPA 1LDCA 3SZ8A 3VZZA 3AROA 2DT2A 1V0LA 3QKEA 5TNVA 4RDWA 4PCTA 4XG1A 3EDEA 6XIAA 1HL9A 1XRFA 2DVXA 5T26A 4HGXA 2VNCA 2BQ3A 3CV6A 4ACYA 5D09A 1A5AA 1P4CA 3CAKA 3PK7A 4ZO8A 1UQYA 3MCMA 4O4VA 2PC8A 4C6FA 3VDGA 2Z1XA 4J5NA 1G94A 2J66A 3B9AA 3EXRA 5D37A 5HWJA 1J0YA 3GNXA 3DBPA 1Q2SA 4O3SA 1ZCOA 3VD5A 2VURA 2R1MA 3VKBA 1JNEA 2YA0A 1YADA 3AFBA 1M03A 4ADSA 2XCPA 4YQWA 1IIGA 4RNOA 4QDWA 4S39A 3W2UA 1RBAA 1P0EA 5BRQA 4IPIA 3WNKA 4PCFA 1F6KA 1OB0A 2ZC1A 3LU2A 3GVVA 4NJKA 3VAVA 2ZKMX 3E2QA 1J0KA 3A22A 1WXZA 2Z2UA 5D8WA 3F5LA 4ZTXA 1OK4A 3AHYA 5HMFA 3H55A 1I0BA 1C91A 5CZSA 4E8GA 2EPMX 1RJPA 3UGVA 1U22A 2J9ZA 4YR2A 3AYSA 1K3UA 4M56A 3GDKA 2W9AA 1Q6EA 1WDDA 5AVNA 3AJXA 5D04C 4YTRA 3QH2A 2H90A 3HO8A 4L64A 3ITLA 1H7NA 3PAJA 1DWHM 3AS0A 2EG8A 4IP4A 5TQLA 1KQZA 1XRSA 3GVRA 4IFKB 4C6QA 3T0AA 1Q5MA 5ABFA 1GOWA 5KG7A 3VKAA 3C0LA 3GRIA 4MB4A 2C6QA 3GIKA 4LS0A 4ZBCA 1KFWA 1SJAA 4TQSA 3CQKA 4UXDA 1BYBA 1LOQA 1GYLA 1QI3A 2Q3OA 1PIIA 3OSPA 3LBCA 1X6UA 3PZVA 1S38A 3BJYA 2G95A 1V77A 2D22A 3EPIA 1KR1A 2KX9A 1OCBA 5D4YA 1NWRA 1LBFA 4UZUA 4UTIA 3W1XA 4AYSA 3UERA 2DZBA 1Q6FA 1JUKA 3I10A 3QHOA 1BKHA 5CLTA 4NASA 1B9BA 2E67A 3N3TA 3W0KA 3H4BA 3P82A 5CBJA 2D0GA 4B5NA 2G3IA 2V68A 1VLWA 5KFIA 3TMLA 4JTEA 5BRBA 4MYAA 1EP2A 5I07A 1Q8JA 1B0IA 5F4XA 3M9NB 2YX0A 4UFIA 2X05A 2GQ3A 3UYCA 1TRDA 3ZR6A 2CPUA 3M7SA 4S3BA 4BI7A 1OD0A 4GNJA 4QG6A 5JUVA 1MW2A 1Z41A 4BHYA 1DKWA 2C16A 3EYPA 5CG7A 3RYSA 2V5BA 4I5RA 5E1QA 5A6JA 3CC1A 3AS2A 4C1KA 3HM7A 2PB1A 3CH9A 4AWEA 2R8IA 5KG1A 1WKDA 3UA3A 4D72A 3WDJA 4F2UA 3CLWA 3GVWA 3USZA 1X8FA 4NXKA 4PULA 3UXDA 2YBUA 8XIMA 3V3WA 4UNIA 1HJXA 2QNEA 3FXGA 4H8HA 4AU0A 4ED0A 1ZBWA 4JHMA 1E6PA 3L65A 5KFGA 5A1AA 3QV7A 1S2VA 4HNLA 3VKJA 3PZQA 4XBKA 2GGJA 3TQPA 4RNFA 1HKKA 4MAZA 3QC3A 2Y7FA 4LC6A 3FSTA 3UZZA 3DDMA 1R3QA 1GEQA 4R7WA 1K4HA 4WJ8A 1LRTA 4AZBA 5CBIA 4R88A 3JUGA 3TROA 4LF2A 3SN4A 5KZDA 1ZAIA 3AXMA 5EMKA 4FP1A 4JHOA 3H2CA 2JQXA 2J4GA 4HNVA 4QIUA 4AY1A 5C54A 4XZMX 4EEYA 4YTQA 1RQHA 4WJXA 2Y8VA 5FJUA 4G1NA 3VNMA 2OQYA 5EWGA 4LCSA 4TOQA 1DJHA 4BQ3A 3DC0A 3OP2A 3LSCA 3HG4A 1JEZA 1JZ7A 3MA8A 5KT4A 1GYMA 5CAHA 3GD6A 1DIDA 5KG5A 5I24A 4FLQA 4KWWA 2A7PA 2PU0A 1E73M 5CPOA 2ZZ6A 1M7PA 2Q6ZA 1UA3A 4DPQA 3AZRA 4Z1YA 5FJRA 2J9YA 1RY0A 4Y9AA 1PEZA 2UVRA 5CPTA 7ENLA 4MVAA 3TLQA 3TJLA 3FGCA 4WX2A 1XIEA 2ZYFA 1OADA 3EKZA 3E49A 3NXLA 3KOWA 4A6GA 1XRVA 3PPCA 4QSFA 1W3LA 1RCQA 1E71M 4ECXA 1XISA 4ZSUA 4GABA 5FF2A 5F2GA 5CSUA 4Q8OA 3GIPA 1PXGA 1W3HA 2PLCA 3GNDA 5C9UA 4S3DA 2IPWA 2WKLA 3UXAA 2CESA 2FKPA 2HDJA 4M6QA 1DQWA 2DDXA 1T8QA 1HTIA 4C1LA 4FLOA 4YU1A 1UP2A 3GTHA 2W0UA 3GC5A 4NG3A 2W9BA 1P6WA 1ISWA 3MUXA 4WGXA 3AZTA 3KOZA 2IMRA 4QEHA 4C60A 1N7KA 2R8GA 1OYCA 2GDQA 4GMEA 5EMUA 3FVMA 3TIMA 4IUOA 4FX6M 4JDBA 3SDOA 4Z2JA 4CD8A 4CD5A 4AZCA 4URIA 5CPLA 3SCUA 2QCEA 3VOHA 2SFPA 3PB2A 1O5KA 1RD6A 1T5AA 1H3GA 2DVTA 4CEUC 1VQTA 4W85A 4N6FA 3OBKA 4HNUA 5M03A 1KC7A 1XYLA 2E7FA 4FS2A 1XYBA 1QU4A 4Q8WA 2R8HA 5TAOA 4EXQA 1HUVA 4X2PA 3AIEA 2BHYA 3OG3A 1ZB5A 1TZ7A 3QLLA 2W63A 3D0CA 3RB3A 1JYNA 4GUGA 3CTTA 4GUJA 3S4TA 4OUIA 4UFLA 3OLDA 3PVXA 1E43A 3VNKA 4HZ8A 1LOSA 2GL5A 3QZ6A 5D38A 4B92A 3V75A 5D02A 2ZX9A 1KFCA 2ZWYA 2YB1A 1EOMA 3MSGA 4UFMA 4DBWA 1QI4A 4MWAA 4O12A 1JPHA 3M0MA 3MUZ1 3U6WA 3QQWA 3CLMA 3BJTA 3VGBA 3VIJA 3ZYZA 1H2JA 3MI3A 2HPMA 4X0VA 1P48A 1W1IE 4MB5A 1O4UA 2CITA 1PS9A 3TJIA 2X30A 3M7WA 3RHGA 1GHSA 4GXWA 1KXTA 4IJCA 4Y2WA 3GHRA 2OELA 2OZTA 5E09A 3KLKA 2XFRA 3HPXA 3BSMA 3SUWA 1RALA 1JPIA 4QW9A 2D24A 8A3HA 4EAMA 3CPGA 5ABFB 3QZAA 3SY5A 4AHPA 3PTDA 3W70A 1CCWB 4E6MA 3UWYA 1ODUA 4DJDA 5K4ZA 4P8UA 3C2OA 2OLAA 3F1QA 4C6KA 1ITUA 3LQGA 3KDNA 4RZ4A 3W37A 5H8MA 4DJFA 3PZTA 4XB3A 5M5DA 3SO7A 3W88A 1J5TA 4FA3A 4ZXOA 2HS6A 2C22A 3TQ1A 1HN1A 2ZTKA 4IJBA 4W88A 1GG1A 1BG9A 4CCDA 1W5NA 3N25A 3U7VA 4AZ5A 4GI4A 3AOFA 1QNOA 3VUPA 4AF0B 3N1AA 2CBJA 3ANUA 5F4SA 2CLLA 2BY1A 3FDSA 4IG2A 1V0KA 4GQQA 2NWSA 1W31A 5ENLA 4IMCA 2FZMA 4UQCA 3MO7A 2XFFA 1ITCA 5C9WA 2VQTA 3E0VA 1S1PA 2IQTA 5HNNA 4ICMA 3QRHA 3CYJA 3WQ5A 4DF2A 2J75A 3H2OA 5DN1A 4PTMA 2Z28A 4PMOA 2WSPA 1V3HA 1D2KA 1O5RA 5AC6A 2R24A 4ZQCA 3FDKA 4L4OA 4IXXA 3GG0A 5CXPA 2XVPA 3I4KA 2PDUA 3ABRA 3OSNA 3VIFA 3ABXA 1RPXA 2Y63A 3FYYA 2HE8A 5DQIA 2ZUUA 3E2VA 2G0WA 2QR6A 4DHGA 1TO3A 4ATLA 3S8HA 1A4LA 2CKSA 4KWUA 4V1XA 3TONA 4POCA 1L8PA 3L0KA 1WOAA 1AD4A 1IR1A 1EC7A 3MMUA 3H4GA 4GG9A 3VNZA 2PFHA 4C6PA 5CPNA 3PR4A 2A3HA 1W3JA 3NQ7A 3RITA 3Q37A 2ZZ4A 4AHQA 4DUXA 4UUIA 3LNPA 2ZICA 3CMJA 1XX1A 2J88A 2WCGA 3HG2A 4NZJA 1XRTA 1X6LA 3H26A 3PJUA 3SFWA 2YIHA 1JRCA 5T8GA 2VA2A 1GT8A 3EX4A 4ZR8A 1P7TA 3U2OA 2C14A 2QUTA 1MQPA 2ZQ0A 5EFDA 2RDXA 1JIHA 4JY8A 2FLIA 3W7OA 1VFUA 1L6YA 3ALFA 2QUVA 3GK0A 5HNUA 1MVYA 2FMNA 4WUIA 1R3YA 3STCA 4W8AA 2YXGA 3W1UA 4D2JA 4EWJA 1G01A 3HB9A 1UPMB 3GO2A 1J11A 3N2XA 3LHYA 4PFHA 3L67A 4DYKA 2CLPA 3BJSA 4R9OA 5C7HA 4AFYA 2WMIA 4TU1A 3HPZA 4JL2A 3FX4A 1XL9A 5G4HC 4DJED 4RDVA 2XSXA 2XVGA 1OC6A 2P10A 2C1GA 4BF9A 1UZ4A 4L7ZA 1TUFA 5HPOA 1F8IA 5BRPA 1GQKA 2V82A 1X39A 2ZA1A 1TRIA 5KFPA 1AA1B 5A69A 3MJMA 1NOWA 3ZO9A 4ECVA 1UG6A 2IMWP 1CLVA 3PSWA 5KT2A 1W3NA 3T4CA 4GYPC 4IGSA 1EC9A 4OQVA 5AZ1A 4WJEA 1T40A 3TQKA 3OA3A 3VNLA 1H0IA 3VOIA 4CCCA 1XGZA 1B54A 3WUGA 1VIZA 3SCOA 2W9BB 4UTHA 1CPUA 1YE4A 3E9AA 5I3IA 5KINA 3UJFA 1R9XA 2VGIA 3GVGA 3AU2A 5CKSA 3THCA 5K4XA 2EJ1A 3TYDA 1BYDA 2ESCA 1N2VA 1PCKA 2Y1HA 4H4IA 1U5JA 3AUOA 4L80A 1MFUA 5JBEA 4DIAA 5AHNA 1ONWA 3A4XA 4LOCA 3CGTA 4DL5A 2WZTA 4CN6A 2XVNA 3ECQA 4CEXC 1LLOA 1E15A 3H53A 1OQFA 5DEZA 1V6XA 5KFQA 4Y9PA 4LCQA 2X40A 1HXJA 2A5HA 3VD7A 3R8GA 2IW0A 2HCVA 4MWAB 5D2TA 1VENA 4QDMA 3WJWA 2B7QA 3OBEA 2V30A 1R9YA 2JGQA 1GW1A 4FXRA 4XVEA 2ZUNA 3V5CA 3BZJA 1S2TA 3PN8A 2YA1A 3CHEA 2P0IA 1DWFM 2V3DA 2ZUMA 5FEWA 4NT0A 5KMYA 1MWOA 4KEMA 3PTKA 2OG9A 2VFIA 4UFHA 3MV01 1YTEA 4ZB5A 4QGCA 1F4AA 1S97A 2FHFA 4NAFA 3M0HA 3UQNA 5KFUA 2CHOA 2WZMA 3W81A 1J96A 5LIKX 1KA9F 5I03A 1WKEA 2EQDA 4Z2HA 1JZ4A 2D0HA 1QOPA 3JVAA 4G9PA 3LTSA 3WEZA 3QV6A 3BICA 1W1VA 3W1NA 3M0YA 3UY8A 2FH8A 2OWXA 4WDUA 3LHUA 4LSBA 3OVGA 1UASA 4HN8A 3W25A 2XGBA 3NPVA 1O7AA 1KTCA 2I9EA 4GJ1A 3E5BA 3F4WA 1P0NA 3H4WA 4J2PA 4O3RA 2PDNA 3GQYA 2P88A 4WVXA 1S2CA 3W7IA 2ISWA 4ZE5A 3H7VA 4J9LA 4MOZA 3VGFA 4E3TA 3PR5B 1BF2A 1EXPA 1DIOA 2AMXA 3MYPA 1SW3A 2J7EA 3R89A 3AIUA 4IG2B 2XFWA 4HMDA 2HROA 4O1FA 3ZWTA 3LY0A 3OQEA 4Q3MA 4HA1A 1FCQA 5D9NA 2XIQA 1FFRA 4GQ0A 3LI1A 5FSEC 2DGAA 3WJSA 3QZ8A 4QJ1A 2TODA 4U4MA 4WRHA 4JIHA 4FIRA 1HNYA 5G2WA 3LXCA 4AEOA 4LCRA 1PE1A 1BXCA 2D20A 4NNCA 4RPQA 4ADUA 5XINA 2O7SA 3MFHA 3WLNA 2J78A 3T55A 3HGRA 3RDKA 3EB2A 5IHRA 4GH1A 4RW3A 3ZXWA 4DQWA 3RR4A 4ZQOA 4V2XA 2DT3A 4XUGA 4UCGA 1AMYA 3G0XA 4XV0A 3FDGA 4ROQA 1UUQA 2GYIA 3LM3A 3VCRA 1OF8A 5AHIA 5CG0A 1TJ1A 2NX9A 2RJHA 2Y61A 1PIFA 4L1WA 4DYEA 2FTWA 2OYLA 4IISA 1EDTA 1Z8AA 4R27A 1EGZA 3LEPA 1UKQA 1QPQA 5JH1A 2TAAA 3HFTA 4E8CA 2A79A 1TVLA 4E4UA 2CWXA 3DESA 3PWAA 5G2IA 3P84A 4H9ZA 3L4YA 3GSMA 1P1MA 2J74A 5LA2A 3WBEA 4O0KA 1P7TB 1PB0A 5AECA 2QMJA 4W7UA 3DKJA 4GK8A 1S0OA 1IT7A 1SPQA 2BGQA 4IQLA 4JBRA 5HJXA 2I56A 3HG3A 2CYGA 1S1RA 2X2YA 5HJYA 3I7QA 5G4WA 2AGTA 2J7BA 3RCYA 3BCDA 2W8KA 2ZZ1A 4B90A 3K1DA 3WMCA 1AK5A 4GBDA 1QK0A 5I3DA 3IVUA 3QYSA 4EBDA 4J4KA 4ZQPA 3V7PA 4DZHA 3IJ7A 3WO8A 3Q67A 3OU8A 5H2ZA 2HVMA 1Q65A 1WPCA 5XIMA 1KKRA 2WMIB 3SUUA 3W7GA 5KG3A 3BANA 3MUCA 5CJNA 5C71A 2GDUA 2QJNA 2V9DA 4G5DA 4UTKA 3W1PA 1BSLA 4D1IA 3RLGA 2J24A 1TVPA 4HTYA 1CXIA 3JW7A 1ITXA 3UR8A 1E6ZA 4LYRA 3BO9A 2C1HA 5CGTA 2ASLA 5DELA 3AQUA 4G1KA 2ASDA 1A0CA 3PZ9A 2VD8A 1VGAA 3L4ZA 3WK0A 3N2OA 1VC4A 3MBDA 1KWGA 3GU9A 4H6EA 4DAIA 1UR4A 4CKQA 1E6QM 4YNGA 5JH2A 5KETA 1HJSA 1TPUA 4XTDA 4GIRA 1VR6A 1W9UA 1RQEA 1JJKA 3P80A 5DCDA 1IGSA 2GGEA 4ZB0A 4UR7A 1JCXA 3B06A 4B91A 3GH4A 2G8ZA 3NO1A 1GOXA 1YDYA 3DFSA 3BGGA 2WQDA 3KCLA 1B3OA 2E9BA 1EH9A 3NGDA 1ZL1A 1XYAA 5CZKA 4K7YA 4WIWA 1KGXA 1RAKA 5FI8A 1O1ZA 4U3AA 4RK8A 4U5IA 2DT1A 2Q8XA 3LENA 1JCJA 2DZWA 1KXHA 2QQ6A 3L4WA 5B80A 1JRBA 4L65A 1E5NA 1T96A 3B03A 1UKPA 1NOUA 1H0GA 1R85A 1MUMA 2P8BA 4Z2IA 1ZJIA 1LT8A 4HZMA 4C5ZA 4H6RA 1LL7A 3L0NA 4CD4A 3AHXA 3N13A 5DG9A 4MWAD 1ZZMA 3VI2A 3TYCA 1SZGA 3LG3A 1PWLA 4J9RA 5DBUA 1GPFA 4LF1A 2DQWA 1WZMA 2BMBA 4BF7A 4HA3A 1XBZA 1SFTA 2BY2A 3EDDA 3CL7A 1SJBA 2FQIA 1KRBC 3AMDA 2IA6A 2PC4A 4FO4A 1XIGA 1SO6A 3RGTA 3BDKA 1EKOA 4QE5A 3CO8A 2FZNA 4AAJA 4NSBA 4MGGA 3EMQA 4XAGA 2CLOA 4AD4A 4WSKA 3S42A 4RNHA 1BGAA 4YTSA 4M80A 2PDCA 2BS9A 3H2NA 2PU1A 4YN5A 5D05A 1V6TA 2ZZ7A 3WD1A 2R94A 4OBRA 4WF7A 4XSMA 2WLZA 3CEPA 1E6SM 5A6AA 5DT7A 3RMEA 1XIFA 2QCCA 1H5YA 1Q7QA 2QUUA 1K6AA 1WO2A 3SBFA 3S1VA 4ASTA 1E0WA 1ZP3A 3RFAA 3PWGA 1R9ZA 1QNPA 3CUXA 3BLIA 3QEZA 3L0GA 4HQVA 3KS6A 1TPVA 3S2CA 2AAAA 3FY1A 4PMYA 2VWTA 4XX6A 4YS1A 3SAZA 1CYGA 2OX1A 2ZOXA 1W9PA 2GFTA 1YRRA 3MI6A 1KCLA 3R0KA 2DP3A 3CUGA 2W5FA 5D30A 1U33A 2OOGA 1PHWA 4N4QA 3QBUA 4A22A 4HT3A 1GQIA 2BXYA 4Y8FA 2J6XA 4LWWA 4OIFA 4F0RA 4OECA 4W87A 1ZAHA 3M41A 3NPUA 2QIIA 3CASA 3WN6A 3A3XA 3A5VA 4XD4A 2PWVA 4H8VA 3U2EA 4FPSA 4QWCA 3R8RA 3PJXA 5HBFA 2OT1A 1K9DA 2YDSA 1HP5A 3L4XA 3NAVA 2VL4A 5G2HA 2X2GA 4MKNA 3M0JA 2INEA 3CWOX 1FKXA 3T2OA 4ZOEA 5H91A 1JUEA 3AALA 1HKVA 3QGAC 2NUXA 4EBEA 2WNZA 2BV9A 4JXCA 4FBUA 4UTLA 4XSLA 3KZPA 3STPA 1TPEA 4PR4A 2INZA 2EAWA 1UWUA 4GLEA 4H9UA 3MV11 4Y90A 3HPFA 3VZYA 4PRRA 2XM1A 4EF8A 2WV8A 4CQDA 3DG3A 2WSQA 3O6AA 1CXHA 4HPGA 5KG2A 3GBEA 1F4HA 3EZ4A 1I2PA 3G1DA 1J5SA 3IIXA 9XIMA 4O14A 3T9PA 1H5VA 3HPSA 4D8ZA 2C8NA 1MSSA 1ME7A 2ZZ3A 4FX7A 3GIIA 3GQCA 2EHHA 5FF3A 2FMOA 4LC8A 1H41A 3ICJA 1TPH1 3QXBA 3VNDA 4LVGA 3PBGA 4EK7A 2GVGA 1JPDX 3QY8A 2PCEA 4C6JA 5LKYA 3MU7A 1UZHA 5DG7A 1K7EA 1NQ6A 3TTQA 1EJXC 3R25A 1NP2A 1VFHA 4F3HA 2O9RA 3TZFA 2GJPA 2XYLA 1V5XA 3KVLA 3VIKA 2JEFA 1OYBA 1TR9A 3ITXA 3BLKA 3WD2A 4QP0A 4RLIA 4MFEA 5IRPA 3DFQA 3QFWA 4OU1A 4CN1A 1W8GA 5HNRA 3ONBA 5C7VA 4QLJA 3FJLA 1Q6DA 3N19B 4JDYA 5HPCA 3K46A 3C6CA 3PHAA 2GOKA 6ALDA 2VOTA 3RO8A 4K38A 3G5EA 3KEHA 4ZTYA 1UCWA 4YVXA 1K03A 1J0JA 1DHKA 2WPBA 3V1PA 1PDYA 4UNLA 2WPGA 4HSNA 2YLAA 4P8WA 2MUCA 1TPC1 4K39A 3WQCA 4FBTA 3VKKA 5FD0A 5KFMA 2OTDA 1LLWA 3DFTA 2VZOA 4S38A 4M0XA 2NT1A 3HF3A 3SY1A 1E9YB 1Q6QA 4PL2A 1XC4A 3AJ7A 2HEJA 5DGBA 4UTMA 1P43A 1XF0A 3ZQ9A 1JCTA 2HTMA 5HK4A 4B2DA 1EL3A 2PTWA 1Q7MA 3Q94A 3W2LA 3W38A 1EJVC 5DMYA 4GO8A 2QCMA 2AKZA 2X16A 2FH6A 4UTUA 4OOUA 3T0TA 3DFYA 1XGEA 1K9FA 2UZ9A 5DQHA 3WD0A 3O07A 3Q2DA 2E1DA 1QK2A 4JTGA 2Z6IA 4UTFA 1KFEA 3ZZ1A 3ABSA 4PTXA 3R11A 2OQLA 4ZOCA 4GINA 4GCAA 4Y8EA 5J8LA 1SU5A 1SUXA 3BURA 1RCOB 1GW9A 3VX0A 1E0XA 1KM4A 4O1EA 1B3WA 1FCVA 5M1TA 5LGXA 3RCMA 4BEUA 3C4UA 4HYVA 4C6LA 1A3WA 2DV0A 2DZXA 3HQNA 2PWHA 1THFD 1ME8A 4QBXA 1WX0A 3SB0A 3FW6A 4MKVA 3DHDA 1US2A 4Q8TA 3B04A 4GFIA 1W1YA 4ZCWA 1MEWA 1SFSA 1TX2A 4H9XA 1C8VA 3EXSA 1G0CA 3W7QA 1JFHA 5ABEA 4HJFA 5G1MA 4ENLA 3GNRA 1I2RA 3R12A 3QTGA 1UPPA 2G97A 3WIJA 2ANUA 1EYWA 1OFDA 3DYOA 3QMTA 5KEZA 1LRQA 2Y8UA 3E3HA 2H8XA 5HR7A 3QHNA 4LV4A 4Q4PA 3LGGA 4G8TA 1HO1A 1HX0A 3ARPA 4XZNX 1AD1A 1ISXA 4GQBA 4KWSA 1UWAA 2BXVA 2OZ8A 1XC6A 4HP5A 4KQNA 1F61A 4W9TA 5A5WA 1D3CA 3UNTA 3OYZA 2OZ0A 4BF5A 1UA7A 2HPIA 1OM0A 2DH3A 1AH4A 2BASA 4OGZA 4C6MA 2R1NA 3S6TA 2OSWA 4NAEB 3RG6A 3ES7A 4ED8A 1RLCL 5EKYA 3S9YA 3VMOA 1EOKA 4KFOA 3LI0A 2VRQA 4JEJA 3ITYA 3IAQA 3OZOA 2XCAA 1TQXA 3B3DA 3ARQA 2Z24A 4DUWA 4EPBC 1LRNA 2RFGA 2VO5A 3NZGA 1MRQA 3H6OA 2O7QA 3G8RA 3GIQA 2F2KA 3OVPA 2D0FA 4GY7A 1OG6A 1TE1A 3TTOA 1UR8A 4XZIA 2W8LA 3XINA 1DVJA 1UYQA 3B8DA 4Q4OA 2PTDA 4LNCA 3SCPA 3WNOA 5IHSA 2E9MA 2Z25A 4JHZA 5KFOA 1K77A 3SSJA 2VEGA 2HJPA 2ICSA 3SUSA 1PAMA 3WH6A 1TIWA 3M0IA 3SCTA 4PMZA 1DJXA 1OWQA 1W54A 3OVQA 3MI2A 1QPOA 1TJ2A 1AL7A 3A6OA 5JIWA 4JV2A 1JCYA 3T5HA 1XLDA 2WVUA 1ME9A 3NQFA 5K2ZA 4DL2A 2E40A 5CPSA 3LX9A 2WXDM 3TN6A 3HMJG 1G4SA 3SI8A 1FWBC 1XLJA 1O66A 2VR5A 3S6OA 2V81A 2QF7A 1PCWA 2YZRA 5C5JA 3WNNA 2XIMA 1W9VA 5FSDC 4JTRA 3O9NA 3TKFA 3KL0A 5H1WA 3O6DA 4NLGA 4QEEA 4DX3A 3T0BA 1VRDA 2JEJA 4DBUA 4GNKB 1G69A 1UIOA 7PTDA 2DSVA 3VX1A 4Z1BA 3GTXA 2YFOA 1X96A 4HYKA 2VVNA 2V2DA 1W3KA 3VU2A 1FWEC 2IPFA 1DOSA 2GGGA 3PULA 1R38A 1RCXB 5E93A 1RZMA 1TKKA 4PUDA 3Q45A 4LY8A 3VDBA 1NWTA 3MC5A 3TC7A 3SIMA 8RUCA 3HGOA 3IAPA 4DY1A 3DEQA 2W7PA 1Q4WA 3NQDA 1AZ2A 1KCXA 3W6MA 3OHIA 4AVNA 4M8UA 4LEQA 4UZSA 4PMUA 4PMDA 3SN0A 4HHLA 1A0EA 1QOXA 1QFEA 1GNXA 3WNPA 1EXBA 2WNWA 3BAIA 1JDEA 2G5WA 1FCUA 4RU9A 2F2HA 2JEQA 4V28A 2XSAA 5BCAA 1E56A 3TXVA 4A3UA 4ES4A 2QDDA 3MKVA 4ZVJA 3UU0A 1ZCCA 2IQ0A 4HYRA 3GGMA 4ECQA 3W3OA 1Z3NA 2E3ZA 4LAZA 4PMRA 3N15A 4S23A 3P67A 2YPIA 3W76A 2I9UA 3K1GA 1PKMA 1FWIC 4A3QA 3F7JA 4H6KA 4AD1A 1QNQA 2JEIA 3N9SA 1M01A 2EG7A 2REQA 3KL5A 4PB4A 3T2PA 2BHZA 3UF9A 2CU0A 3RB0A 1WDRA 5I79A 4EPKA 3NZPA 2XGZA 3S47A 4MB1A 7REQA 4R85A 2J47A 4GC4A 2HBXA 4PRTA 1S2UA 4LU0A 3TN4A 4N42A 5KG4A 4B4FA 2C13A 1YMYA 2Y5EA 5KFBA 3AS3A 4EAYA 1NH6A 1DTNA 3G3MA 1GTHA 3CAWA 2BR0A 4GCXA 1UJQA 3LCLA 4TTGA 1HT6A 4FR1A 4OV9A 4L6HA 2TMDA 5LYRA 1NEYA 2H3DA 2F61A 3R4IA 3P2VA 4GQGA 4QS6A 4N4PA 4AD2A 1M7JA 2HISA 3R5EA 4ORIA 1KXVA 1BF6A 1IXPA 4PFMA 3UT0A 2GJNA 2NWRA 2JIEA 4NZ4A 5BWFA 3N9KA 3L4TA 3IACA 4UMAA 3KTCA 3I7SA 1HKMA 2PLKA 3W87A 3W7MA 2W6RA 3QF0A 1TV3A 4LEFA 1CEOA 3VMNA 4Y9NA 2WBKA 2WKJA 2OEMA 2C18A 3HMCA 3L21A 5AVHA 5CZJA 1CWYA 3BSHA 3WK1A 2F7FA 1EO7A 3NUKA 3L12A 4EOUA 2PP3A 1TVNA 2VI0A 3H54A 2ZFAA 3WDPP 3NL5A 2VRJA 2IKJA 4WQ6A 2WW5A 1W1PA 2HWGA 2CW6A 5F2IA 2DIKA 4CNPA 3IWPA 5LIXX 5BU9A 1P1XA 1AJ0A 3NQVA 1TCDA 3C86A 1JVNA 3SFKA 4Q32A 1H51A 3IJQA 1NU5A 3EEGA 5HDRA 1PWMA 4W8LA 3OHMB 2PDHA 2I57A 3CJPA 1UUOA 3KOFA 3Q8QB 5FEZA 3ISIX 4EPEC 2H9AB 2OZ3A 1H60A 4F2BA 3W1QA 4XUYA 3G6VA 1KLYA 3W7EA 3WMBA 4PB3A 3VNYA 4JX6A 1GYNA 4PZVA 5GQBA 1K1SA 3LPPA 1TPWA 4D1JA 3WQFA 3GZ3A 3BE7A 1LG2A 3TEVA 1VLIA 1VFMA 5BZAA 3S1WA 4DWDA 1JD9A 4LX4A 1XYZA 3BGAA 3HJZA 3SI9A 2NV2A 2WWCA 1VHCA 4AUBA 4LAMA 4J35A 5DT5A 3P5YA 3L5AA 1BRLB 5HJLA 1SW7A 2NUWA 1AUSL 2PTXA 3HTWA 2GVEA 3E1F1 4XBJA 3QW3A 1JZ5A 3B0YA 2PLMA 4MPKA 2BVDA 4XZHA 3RLHA 4GYJA 4FIQA 1HW6A 3K30A 3I3DA 5F1VA 3V0TA 3D47A 3NDOA 5FOOA 3HGSA 2WZHA 1TJ0A 1ENUA 2C0AA 4KMQA 2GJLA 5K9XA 3SGUA 3VIOA 2V4RA 2O9TA 3BW4A 3LXAA 4LUIA 3TAKA 5KG0A 4XAYA 1ECQA 4TX8A 1NDWA 4AVFA 2OYKA 1S39A 1O12A 2D23A 1V51A 2WMKA 3W1TA 1ISVA 4YP3A 1QI2A 4YHGA 2O92A 1T41A 3I6EA 1SO4A 4JFSA 3RCNA 3T8LA 2GPTA 1W91A 3HPAA 4JGDA 2VCAA 2E6AA 3EXTA 3M9MB 1UKTA 4HU3A 1N55A 1EPXA 1PZ1A 1JI1A 3W7KA 3FKRA 4AXNA 3F4VA 3N6JA 4RNIA 3RNDA 4NJHA 4JFTA 1XGDA 1B3VA 4K7VA 1XQKA 3R79A 3OYXA 3KL3A 1EB3A 4HU0A 3FA5A 3VE9A 1DYSA 4US5A 4HU4A 3ZLHA 1O6IA 3HIJA 3PG8A 1KV5A 3MFIA 4H9MA 5A8QA 1UW9A 2FHBA 2GSEA 1TZ9A 5C2GA 3W1LA 2WZIA 2R82A 3GAKA 5H6HA 3M9OB 2V0TA 1QVBA 3WKZA 4F2TA 1K70A 2JKAA 1A5OC 3ZJ6A 3O6YX 2CLFA 3WEOA 2W62A 4ICCX 4JPGA 3WF1A 4EF9A 1RBOB 1EJWC 2YDRA 3GM8A 1R3SA 2ZZ5A 4O3OA 4NILA 3VZXA 2ZWZA 5A6BA 1BTCA 3HBLA 5BXSA 1WUEA 3DGRA 2YDAA 1XLBA 2YCEA 3HV9A 4YWIA 4YPJA 3RLVA 4JQ4A 3T40A 2Y5JA 3UGRA 1T7LA 2EPHA 2XFYA 3SQLA 5FF4A 4UR9A 2NXIA 1WBJA 1GWJA 2PDIA 1YHTA 1IXQA 1TV2A 1IEVA 2QVNA 3VA8A 4M5PA 2IBKA 1R87A 4J9SA 3UR5A 4HTBA 1X7IA 1U5HA 4P61A 3H12A 3DYMA 4TTUA 4U7CA 3K4DA 4ZO6A 4F0MA 3VFLA 2MNRA 2PDKA 3EOLA 4JEQA 2REQB 3TNBA 3A64A 3LA4A 4KF1A 3PPFA 3GXMA 1RD5A 4HVXA 2PWDA 5T14A 3GFYA 4B2DD 4JIPA 1FCBA 4PC8A 2E0PA 4H8UA 1ZS2A 1WDQA 4CQ9A 5M3WA 2NLYA 1XFBA 1NF0A 4LUJA 1JX4A 3OBAA 1OC7A 1XIHA 3EA1A 2QGHA 2VM8A 3ARYA 3L66A 4YR3A 5D2XA 2GGIA 4JTFA 3D46A 1V6VA 1YXDA 3VKCA 1S5TA 1EJ7L 2CERA 3T05A 3K4WA 4JS3A 3V35A 1UBPC 2PDPA 1CGXA 3TYBA 1W9BM 4JNYA 2VFFA 3M0KA 1J0IA 3LMZA 4O28A 3NSXA 2OOFA 1EP1A 4YWSA 2GUYA 3A23A 4XKMA 2RDIA 2P5NA 4PGLA 3KZSA 3RO6A 2PDWA 1D7FA 1SFLA 3MSDA 2DW6A 4HU8A 4PEKA 1UC5A 4QROA 3M07A 5DCBA 3P93A