1XRFA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
423
structure length
363
Chain Sequence
WMLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLDRLALIEGVKRGIIDCFATDHAPHQTMPGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Dihydroorotase
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 127
structure length 363
sequence length 423
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrfA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrfA02
3E74A 3A3WA 1GKPA 3PAOA 4IQJA 4EPEC 2PGRA 3IACA 4GK8A 4ZSTA 3MSRA 4KEUA 4LCRA 1A5OC 4BY3A 3UF9A 4ERGA 2Z29A 3TN5A 4G2DA 2FVMA 4PCPA 4C6BA 2P9BA 4GXWA 3CAKA 3RCMA 1EJVC 3UBPC 4RE0A 1R9YA 4C6KA 2FTYA 4XD5A 4IFRA 4XD6A 2OQLA 2Y1HA 4QSFA 3K2GA 5G4HC 3G77A 2GWGA 4DI9A 1PB0A 2OGJA 3JZEA 1R9XA 1POJA 2W9MA 1YRRA 3K5XA 2XIOA 1A5NC 5A6TC 2WJDA 1EF2A 1M7JA 4CQCA 3ITCA 2HPMA 3QGKC 1FWBC 4RDWA 3LY0A 2ZC1A 2D2GA 4KERA 1RA5A 4AQLA 4H01A 4B92A 2BB0A 1GKRA 3ORWA 5FSEC 4RZBA 1K1DA 1WXZA 4M51A 3OOQA 4BJHA 2YXOA 1PSCA 4YIWA 4F0LA 2HPIA 4LH8A 4DNMA 1RJPA 1WXYA 3S2JA 3URBA 3F4DA 1RA0A 3AUOA 2O4QA 4C6OA 1RK5A 3ID7A 1V51A 3T1GA 1E9ZB 3V7PA 4GX9A 3MKVA 1KRMA 4H9XA 1UIPA 3GIPA 4KEVA 3QY7A 1UBPC 4PBFA 4IGNA 4EPBC 4C6LA 4LAOA 4CNUA 1J6PA 3URQA 4QS6A 1YNYA 3CS2A 4R7WA 4EP8C 3OJGA 3A3XA 2Z4GA 3OVGA 4KQNA 3B0YA 4NP7A 5HMEA 4LFYA 1FWJC 4L6DA 2Z28A 3IJ6A 2R1LA 1ONWA 4ICMA 4C6CA 3OODA 1ADDA 4B3ZA 4IH3A 1FWEC 1PTAA 4IFOA 3FEQA 4C6IA 2UZ9A 3MJMA 3IV8A 4MUPA 4DI8A 4IFKA 3EWCA 2EG8A 1A4MA 2PAJA 1FKWA 1YBQB 3F2BA 1O5RA 3WZ0E 1K6WA 3IGHX 1A4LA 2WJEA 1FWAC 3F2DA 1KRCC 1YIXA 1KRBC 3CJPA 3DC8A 1V77A 3LNPA 3QY8A 3HM7A 4KESA 4PCNA 3URNA 2F6KA 2HBXA 4JOMA 3PBMA 2CZVA 1M68A 4XAFA 4UBPC 2FVKA 2ADAA 1FWHC 3EWDA 2D2JA 5E5CA 2AMXA 4CEXC 3E0FA 3ISIX 2RAGA 2Z24A 2Z27A 1GKQA 3KM8A 3GGMA 1ONXA 4GY7A 4IGMA 4QROA 1XRTA 4V1XA 3GTFA 3NURA 2PUZA 3OQEA 4ERAA 2HBVA 2Z2AA 2ANUA 1O12A 4XD3A 2Z26A 4DZHA 4H9YA 4CQBA 1M65A 4LCQA 3MVTA 3PNZA 3A4JA 2OOFA 2Z25A 2O4MA 4C6MA 3E3HA 4IG2A 3UPMA 2EG7A 1FWFC 3MDUA 2A3LA 3UR2A 5HMFA 4G7EA 4CNSA 2YB4A 3LU2A 4GY0A 4XD4A 3DUGA 1NDWA 3F2CA 4R88A 1EZ2A 1XWYA 4NI8A 4DZIA 2OODA 2E1WA 1FKXA 2QS8A 1YMYA 4WHBA 2I5GA 4ERIA 4P5UA 4C6JA 4F0RA 3B40A 3WMLA 1KRAC 1V4YA 2Z00A 3FDGA 2QVNA 1ZZMA 3MPGA 1EJSC 1RJQA 1FWIC 3GU2A 3S2LA 3S2MA 1BF6A 1IE7C 3TN6A 3E38A 4C60A 4DIAA 5AKQA 4IG2B 4BKNA 5LXXA 3MDWA 2PLMA 2VC5A 1NDZA 2YZ5A 4NG3A 4EPDC 3GTHA 2R1PA 3PNUA 3C86A 3LGDA 3R0DA 1P1MA 1S3TC 1RJRA 2VC7A 4EPKA 3D6NA 4J5NA 2D2HA 2Z7GA 4GC3A 3S4TA 3S2NA 4LCSA 3OU8A 4C6PA 4WVXA 2FFIA 1J6OA 3AU2A 3GUWA 4TQTA 2R1KA 2HNHA 3NEHA 3RHGA 2DVXA 3LSBA 4GOAA 1POKA 1J79A 3LS9A 4RDZA 4WGXA 4LALA 2G3FA 4H9TA 1E9YB 4C6EA 2AQOA 1EJTC 4I6KA 1EJRC 2KAUC 4LAKA 4F0SA 1HZYA 1ITUA 3E0LA 4C5YA 2OB3A 4I6VA 2WM1A 3K4WA 4C6QA 2GWNA 3LGGA 1RK6A 1DPMA 4H9UA 1NFGA 2VM8A 1A5MC 3F4CA 4Z42C 1EJWC 2ICSA 1EJUC 3AU6A 4DYKA 3HPAA 1V7AA 3TN4A 2GSEA 3MTWA 4HA0A 4XAYA 4H9VA 4D8LA 3PANA 3BE7A 2HQAA 4C65A 3T8LA 3T81A 2VR2A 1A5LC 1FWCC 1NDVA 2E25A 5HMDA 4GZ7A 4IFKB 3RYSA 4DO7A 1FWDC 1EJXC 4GY1A 4UB9A 4V1YA 3IRSA 2QT3A 4KIRA 2FTWA 4KETA 3WYZA 3SFWA 3GTIA 3GU9A 4INFA 4PBEA 4B90A 1A5KC 2WJFA 3MVIA 1P6BA 3O7UA 4H00A 5FSDC 3UR5A 1EYWA 1I0DA 1XRFA 4GYFA 1UIOA 3URAA 3GTXA 1NDYA 4QS5A 4QRNA 3N2CA 4RDYA 3GG7A 4QTGA 2P50A 3EGJA 1I0BA 4H9ZA 4KEZA 2UBPC 1K70A 3GU1A 4GX8A 3TNBA 4XAZA 3GRIA 3E2VA 4XAGA 4RDVA 3HTWA 2IMRA 3LA4A 4C5ZA 2Z2BA 4HJWA 2DVUA 4KF1A 3LSCA 3ICJA 2Q01A 1XGEA 5CH9A 1J5SA 4AC7C 1R9ZA 1UMLA 1PO9A 1ITQA 2GZXA 4G7EB 2Q09A 2R1MA 4HK6A 4PE8A 3NQBA 4GBDA 1QXLA 4J35A 3SO7A 1RAKA 4C6NA 2AQVA 3FDKA 3DCPA 1VFLA 1QW7A 2VHLA 3QGAC 2YB1A 2VUNA 4C6DA 3GIQA 2GOKA 2BGNE 4LANA 4B91A 4LAMA 2I9UA 4CNTA 1W1IE 1FWGC 4L9XA 1KCXA 4IF2A 4ZSUA 2QPXA 3O0FA 4LEFA 1JGMA 1YBQA 4H9MA 4DLFA 4J2MA 1P6CA 2R1NA 4DLMA 3IARA 4HK7A 4HK5A 3TN3A 4CEUC 4R85A 4CQDA 4E3TA 2DVTA 3RN6A 3QY6A 4OFCA 2PGFA 3B0XA 4C6FA 2P53A 1V79A 3IPWA 2EG6A
chains in the Genus database with same CATH superfamily
2RFGA 1JULA 4HZ7A 4LY8A 2CESA 4OIFA 4UTWA 3MSDA 3O1NA 4KWSA 4Z0SA 3TJXA 4DBEA 3GKAA 1F5ZA 5LKYA 1VPXA 3TQPA 3VOFA 1X98A 1R9YA 5HUOA 3UZYA 5I3JA 4WD0A 3IEBA 1XLLA 4LYQA 5J8LA 2DZAA 1VYRA 3S8HA 2C15A 3STPA 1HL9A 2QNEA 5G4HC 3WLNA 3JZEA 1R9XA 3R94A 2V67A 2BVTA 1A5NC 3EWXA 4CN4A 2A21A 3O3RA 1A5CA 4F8XA 4AHPA 3JU2A 2CLLA 1VJSA 3SJNA 1DIDA 2ZC1A 1ZJIA 3PPHA 1FUYA 4PMXA 4CNPA 4JV2A 1RBAA 4H01A 5F7UA 5D38A 1JDAA 2Z1BA 5G2IA 4GQRA 4M29A 1WXZA 3CAWA 4Q6XA 3ERPA 1PSCA 6ALDA 2RJGA 3PZQA 3H12A 1KLZA 3SW6A 3THQA 4JTRA 5G4WA 1JZ3A 3GDBA 2PPGA 4ZO9A 1I1XA 1R3SA 3U2CA 4LUTB 2W67A 2PDXA 2OYMA 2FGBA 3W1XA 2W91A 3T0BA 2YCJA 3AI0A 3TX9A 3OZPA 6XIMA 1TTPA 2Q8XA 2JEGA 1EPVA 1A50A 2NVAA 3EMCA 5F9LA 4KCVA 3PW2A 2XIQA 2XHYA 4PTMA 3U8GA 2P10A 2Y89A 3TTOA 1T5AA 4MTVA 5TBOA 4QQ3A 1K8CA 3OA5A 4J3UA 1OZQA 4Q43A 9XIAA 3WLPA 2YPIA 2H90A 2OTDA 3GFZA 4IFKA 4GNJA 4DJEC 2ISSA 2G5WA 3S5OA 4MM1A 3PN8A 4HZ8A 2ATSA 4UNLA 3I7RA 3URNA 2FZDA 1SO3A 3QYQA 1NQ6A 4J3ZA 1UPPA 1A0CA 7REQA 1OZMA 3MUXA 2G50A 1AH0A 3P67A 1R46A 3VK5A 3ARXA 3V16A 3P0WA 5JIPA 1PDYA 4K7YA 1Z41A 2RAGA 4RZ4A 4FIQA 1CBGA 4WLCA 1WDDA 2HCVA 1AJ0A 1EFZA 4IUGA 3AZSA 4H2CA 5F2LA 2QCCA 4ECXA 1U2YA 1F6KA 1W32A 1O12A 5M17A 4CQBA 2FPVA 2YW3A 3GHTA 1IEVA 1NWRA 3DFOA 1H7WA 4C6MA 2DDXA 5HMFA 1L6WA 4GXMA 2YJQA 2ATLA 2OODA 1SU5A 3R10A 3TWBA 3VD5A 3PAJA 3UYIA 1W8GA 3GNPA 1KFEA 5BOFA 4F0RA 2W4XA 3B40A 3GC4A 1DYSA 2E3ZA 2FHFA 4AWSA 4CD6A 4RPPA 4OUEA 1R7AA 2MANA 1PVNA 3CMJA 4C60A 3W74A 3LHYA 1R3QA 3KCOA 4A21A 3TNOA 5LXXA 2J6XA 4I9TA 1WO2A 4E8CA 1JVNA 3IJ9A 2R1PA 2Y8KA 2I9EA 3G8RA 1W91A 2J9XA 2VDIA 4H8VA 1VAHA 1XSKA 1P1MA 3OSNA 4JV0A 4IPIA 3SUSA 4P7QA 2VI0A 3EMZA 4GGBA 4QDPA 4HSHA 3B9EA 1XUZA 4MJZA 1V02A 4RX0A 1EO5A 1TV4A 3O2LA 3RITA 3T44A 2XVGA 1J93A 4GOAA 4NYYA 5DQIA 3AIRA 3USZA 4WX2A 1WNOA 5FA5A 4PA8A 1FXPA 1EJTC 1B3VA 3BG9A 5I3FA 4C5YA 4DL6A 1UJQA 4DJFD 2YFNA 4DL5A 1CECA 4IXHA 2QPUA 3ZS4A 3BSHA 4K36A 4BF7A 3VKAA 3QHOA 1XPGA 1CYGA 3WBYA 2NT0A 2WKLA 2V30A 4ED3A 3SIZA 1XIMA 4R3UA 3VZYA 4I9MA 2PP0A 1GW9A 1L6FA 2DSZA 2A6LA 5PTDA 2QT3A 2HVOA 1WAUA 2NX9A 1CB7B 1CGYA 2DW7A 2WJFA 4AIBA 1P6BA 4B15A 1F6PA 2RGMA 4AZ6A 3HQ1A 3WEZA 1NFBA 5REQA 1GVQA 3CUXA 3NOYA 5IBXA 1E6RA 5ABTA 2WVVB 1RQEA 3GTXA 3U4AA 4QRNA 2P50A 3SCPA 3WCZA 4H9ZA 3LTYA 5HWMA 1TSIA 1AZ2A 3T7VA 2NQJA 4MHBA 3LBOA 1KXHA 4JTLA 3RXZA 5BXPA 3WL1A 3GV7B 3WEMA 5D30A 3CEUA 3C2VA 4HMCA 5CZJA 3U48A 1E6SM 3AJ7A 2CZDA 3LCXA 4J35A 4UMBA 4PFHA 3OHAA 3DCPA 3UJFA 3NIYA 1UCWA 5AYZA 3Q8SB 2PS2A 1OGSA 4J9NA 3GIQA 1ZBKA 4AFYA 4ML4A 1W1IE 2ZX9A 4LAZA 4NZ1A 2EXOA 4JFWA 2VOTA 1RY0A 4RV3A 3L68A 3EOLA 2GDUA 5BWAA 2UVVA 3N17A 4AWEA 4RCXA 4L1WA 3EMQA 3BLFA 1XINA 1KM4A 3V36A 4BQ2A 1TA3B 2DT3A 3VU2A 3LERA 1LQ2A 4WUIA 3G1DA 3GXDA 4LBRA 4QNWA 1V6UA 3CHCA 3TKFA 4RNNA 3GXTA 2FPTA 3BJFA 4ATWA 4CD5A 4WK9A 4FIRA 3TN5A 3W1MA 4C6BA 2UY5A 3KBSA 1UH4A 5KG1A 4LU0A 2VEGA 4IIGA 4GI9A 2QDDA 2CBUA 2INZA 4XSLA 4A4AA 3D3AA 3ARTA 4QAWA 3V4BA 1B30A 2NQLA 4RNOA 4IR9A 2VXNA 3AMCA 4H19A 4TMCA 3SIMA 3V3WA 4GQ0A 2GJXA 2VURA 2G41A 3QQWA 5D2XA 4RK8A 2CXEA 1O6IA 4AU0A 1C8XA 1M7JA 2NQ9A 3N29A 3DFYA 3RMEA 3NPXA 2PDLA 2OMAA 1MMFA 1JAKA 5CLWA 4BWLA 3K8MA 2QF8A 1T8XA 1Z7AA 3BTNA 1WBHA 1QATA 2UVWA 1TQJA 4AW7A 1GORA 3EEZA 1BG9A 2WZTA 4ZO7A 5HWNA 2XTKA 1BWKA 1IT8A 3AALA 3L4TA 4V33A 2OVLA 3BG3A 3TMLA 1WXYA 3S2JA 1XCWA 4D6IA 3AUOA 3V6HA 4RNIA 5DQHA 1WOAA 1XFBA 4ED7A 3TSBA 4LEQA 3HG3A 4KEVA 6A3HA 4PBFA 1SFTA 1I2NA 4CNUA 1SMAA 1YQ2A 3KRSA 4GNVA 2VELA 4AD1A 3WQGA 1KBBA 3GR4A 3GG0A 1EQCA 4NIRA 5C9ZA 4TV6A 2PTYA 3A5FA 4HVXA 3CZEA 3S42A 2PSNA 4MNMA 3DESA 2X1TA 1OEPA 5AYBA 1B3WA 4AVFA 2PZNA 1FWEC 2OPJA 2Y5JA 5EWGA 4E6MA 3DI0A 3ES7A 1BWVA 1TWDA 4Q8QA 1OADA 1W9DM 2IQDA 1KFJA 1Y8BA 2OR2A 1FWAC 4PCNA 3ZIZA 3LG3A 2HBXA 3KTSA 1DXEA 2GJLA 1E6QM 4AEOA 3EDEA 3M7WA 3QMRA 3LZ3A 3WLRA 2VEMA 2Z24A 3DKLA 3APTA 3GQCA 3TP4A 3WF3A 4IPJA 1K7EA 1QHZA 4HKPA 3VNLA 3GBEA 2VMFA 1XYLA 2Y6ZA 5LNVA 1HTIA 2Z25A 3E0IA 3GYEA 3V35A 3UPMA 3AXXA 4MB4A 3MDUA 3CZKA 2O92A 4DEZA 3T07A 1ZUAX 1E4LA 1P7TB 3F2CA 1NWUA 1EZ2A 1HO1A 3W2NA 2E1WA 4ASTA 4M5PA 4DWSC 4J9SA 3Q94A 4O13A 3CPRA 4IM4A 4DF0A 3DG6A 3CT7A 4A8IA 3GU2A 4CQ8A 3RB3A 1W17A 1PX8A 3E38A 1R3RA 1HL8A 3IK4A 3LNMA 4IG2B 1DXIA 3DFQA 2VVNA 1RCXB 1QO2A 3DIPA 3QZAA 3WBAA 3PNUA 1N48A 3C86A 2V8ZA 1IYXA 2PP3A 3PBYA 1IXQA 1VJZA 3OBEA 3RJYA 3QHMA 1QHOA 2ZOXA 4C6PA 4UCFA 1G9HA 3SDOA 5FJUA 4DBSA 3CQHA 2EPHA 5HBFA 4O0ZA 2YBVA 2DVXA 1ZNNA 4TUFA 1JYVA 4NNCA 4REQA 4UTHA 3UWEA 3WQCA 3CO8A 4H9TA 4B9ZA 1MEIA 3TROA 3NZQA 1IGSA 2A3HA 2FHCA 1VENA 1ECQA 5G2HA 1BD0A 3NG3A 3HJEA 3MCMA 1BLIA 3GHRA 2DSVA 5CC7A 5BOOA 3C6CA 1XLMA 3GKFA 3SZ8A 4DYKA 2TAAA 5AB3A 3AYRA 3L0GA 1VR6A 3PANA 1D9EA 4F79A 2VVSA 2E8YA 2X7VA 3L67A 3MT1A 1KM1A 4XZBA 1Z3NA 1XS2A 2Z2UA 4LAUA 2CZFA 3H22A 4HHLA 4NJIA 4AIUA 3W73A 4AMCA 4FB7A 3S47A 3ZM8A 2VRQA 2WB5A 5DXXA 4PBEA 1XLBA 4NYUA 3AIBA 4D6HA 3QPYA 4P7NA 1KNWA 3P61A 1RVGA 1UWRA 2GSJA 3KX6A 3W6MA 1E6NA 4CN6A 1RP8A 3W9ZA 2Y5SA 1Q6CA 5EWFA 3GHUA 3GW0A 4N6EA 2BVDA 4JD4A 4WY0A 2FGZA 4JIIX 4CD4A 2DVUA 3UWWA 2FQIA 3CQJA 1RR2A 1K8XA 3IGUA 3AIWA 4O3QA 3W83A 3QV9A 5KFMA 3TAOA 3GR7A 2WOQA 4GH1A 4PE8A 4NQ1A 2UV8G 1G67A 4FP1A 4DZAA 5BRQA 1PKLA 3UR8A 1FWRA 1C8QA 4NNBA 3Q8RB 2D23A 3I3BA 3QR1A 3CZLA 1S2UA 4K68A 2ACRA 1LUCB 1TJ2A 2CEQA 2A3EA 4UR9A 2Z1SA 4FLQA 1W1PA 2XH4A 5H6HA 1V0LA 1FP9A 3BLEA 1V3IA 3G1VA 1LOSA 1Y5XA 2XFYA 1X6NA 1P6CA 1ZBVA 5DBTA 3OSPA 1VLIA 3MI2A 1U30A 4YQWA 3MU7A 4AY8A 1E0XA 3GG1A 4P2VA 3N6JA 3VZXA 1UD4A 2DZPA 3W1NA 1NAL1 2XIJA 5A6MA 4C7FA 2PGRA 2YCKX 4ZSTA 2PC4A 1BKSA 2QHAA 4F4RA 1OF6A 4PB5A 5KG5A 4ERGA 3CH9A 4Q8EA 2PDYA 4PCPA 3OP2A 4JAWA 1EJVC 1NF0A 4NXSA 3WNMA 1KFBA 1S0NA 4H1ZA 5D8ZA 3LK6A 1RP9A 3CMFA 3TYBA 1PXGA 3PSVA 1P0NA 2AL1A 2ISWA 3K2GA 3GFXA 4DJDD 1X7IA 3UJ2A 2W9MA 1RPKA 1UZ1A 5I3HA 4IZGA 3LCWA 4MOZA 5LHFA 3NUKA 5J5RA 1I2QA 3ZLHA 3TDFA 3EX4A 3O06A 3W2KA 2YSWA 5I0DA 4ZR8A 1A80A 1GKRA 1U1UA 3IGXA 3W07A 1FDJA 2ZRYA 1CTNA 3CLMA 2V4QA 4TX8A 2QULA 1I9CB 4US5A 3CYJA 2AL2B 2YL9A 5GNYA 4JYFA 4YVVA 2XIIA 2VEFA 1WXJA 1Q6RA 4LH8A 4DNMA 5I6SA 3VNJA 4DZ5A 3O6AA 3WJZA 3BV7A 1GW1A 3VFLA 4HA4A 3BJTA 3WBWA 1UBPC 3ZMRA 5K9XA 2IW0A 3CLWA 4GVGA 1EEPA 4HYVA 3GH4A 2WPGA 1V6YA 3A3XA 4KH2A 3EOUA 3KHJA 4BR1A 1KO0A 3AZTA 3NL3A 3PZPA 5XINA 3C2OA 2PDMA 2Z28A 2C28A 3GR8A 2CLFA 4DF2A 4YR0A 3NO5A 2R8KA 3IV8A 3MJMA 3VCCA 3EX1A 3RB6A 2CC0A 4AUBA 4PULA 1ODUA 1MSSA 3W76A 7CGTA 1H49A 1KRCC 2QDHA 1Q2SA 5BXTA 1OWQA 1EP3A 4MYXA 1XD1A 3DXIA 1TCMA 1TWWA 2IPWA 4DUXA 1KQZA 3ARSA 4X60A 1UOZA 2ADAA 2NQ5A 3B4YA 3ISIX 5C7HA 3KM8A 1TPWA 1ONXA 3KE0A 3MR5A 1F05A 1B0IA 3FKRA 3CK5A 1QW9A 3A22A 1B5TA 1EHAA 3A9IA 4MWAA 3ZZ1A 2V5JA 4GMEA 1PWLA 1R87A 2D3LA 1XG3A 5AY7A 3A4JA 5JBFA 1VCFA 4JIQA 2W9AA 2XZ9A 3O63A 2EJAA 1A5UA 5CXPA 3UU0A 3FYOA 1Y65A 2A6NA 1Z8AA 2VZUA 3R11A 2PLKA 3TYCA 4RJEA 5LIWX 5G2WA 1R47A 1TPH1 1YTKA 4KGJA 1U5JA 4LGXA 4QCFA 2HEJA 5CBBA 4ZEPA 1DJXA 5F2MA 2YDRA 1EDGA 3GNRA 4HNLA 4H3DA 4W5ZA 3H2NA 3PW7A 3GTHA 1ME9A 3KLLA 5C9RA 3QM3A 5AC8A 5IOBA 1V6XA 2EEXA 1J0IA 5K3VA 2WV8A 2BVWA 4JFTA 1TR1A 4TO8A 4IRCA 2ZXAA 3H7RA 3L4VA 2FFIA 3RRXA 3WFAA 2CCRA 1E0WA 5TNVA 5DO8A 3OEXA 4IPNB 3GZ3A 2PDJA 1W5NA 2JEJA 3DFSA 4IL2A 3H23A 1I8JA 4HMNA 3LM7A 1SFSA 3NZGA 4IGHA 1J0JA 3LCLA 2FYMA 5AN7A 4UR7A 4JPGA 2PDHA 3PHAA 3NQEA 1CXFA 3M6DA 4DBWA 2W7PA 1T41A 3NDYA 2D20A 2AQ4A 4FEZA 4B2DA 2GK1B 1IWAA 3RAQA 4N9DA 4AD5A 2QV4A 2WMFA 2VA2A 2RDJA 3W7LA 3HGSA 3W3OA 3W7MA 3PZOA 5IXEA 1KBIA 3F5LA 3LI0A 2GVEA 2GUUA 3I65A 4A3YA 3T55A 3G8EA 4DO7A 1SMDA 2QCDB 3ZJ7A 2WVUA 5TQLA 4A2RA 1THFD 3KHRA 1ISXA 1CPUA 3BOFA 1O5QA 2DIKA 1CLKA 5CLTA 4PB3A 1ELSA 1JD7A 3C3NA 1N55A 3VO0A 1ICSA 2BWGA 1TMLA 1TTQA 4IIHA 3KZSA 3N25A 2BY3A 4UMCA 5TD4A 4RNMA 3HQOA 3SY8A 2VRJA 3LCHA 4PSPA 3MSYA 4A22A 5D37A 4NF7A 2WLYA 2CHOA 5KFCA 4GVIA 3M5ZA 4ZZ9A 1QAPA 4JQ3A 4LJ3A 2RKXA 2GZXA 2QGHA 4NLGA 3QHNA 4GBDA 1DJQA 3G1YA 5A2BA 2FFCA 3M9OB 4AZ5A 3IV3A 5EMKA 1LG1A 1BGGA 4JFUA 1VKFA 4GIEA 3FLUA 1TTJA 3U0HA 3JR2A 3I68A 4OQVA 4PL1A 2G97A 3VIIA 4ZQMA 3C4UA 1H50A 4HIBA 2SFPA 5CSUA 2A3BA 3O0FA 2ZX7A 3BQ6A 1I60A 2X0SA 3A23A 2INEA 1TQXA 1PX3A 1T0OA 2VGFA 4WJXA 3FA3A 3PBGA 4KWOA 4A29A 2PBGA 3W24A 3QSRA 1SW0A 1BHGA 2C1HA 3GXFA 4Q44A 1JFHA 4JL1A 1P0BA 3ABOA 3TQKA 2B4GA 5U4NA 1BYCA 3ZSTA 1K4HA 1KM2A 2CZEA 3FSUA 3HGJA 3TR9A 3DU0A 3WG6A 4RZ6A 2OWCA 1G0CA 3VDCA 3BAWA 4BCEA 4PTXA 4JHOA 4IFRA 1R5YA 1L6GA 3VZZA 4F50A 1VFMA 4HSOA 3EDKA 4LV9A 4IMDA 5EGRA 1XLKA 8XIMA 4H2HA 2PDGA 3FX4A 3L7RA 3N15A 4I3GA 1GUVA 3KRUA 4HB7A 4NJJA 3K4DA 4GI6A 2HPMA 3L21A 1F2JA 2JF7A 1F74A 1XLCA 3DFPA 3CUGA 3LBMA 4DVOA 3TTYA 4AAJA 1P0EA 1KV8A 3AUJA 3SURA 3O15A 4X22A 4AQLA 1F7BA 4JTGA 4B92A 1X6UA 1SUXA 4RXGA 3BUVA 3TVAA 1KD0A 2I14A 2YXOA 4I7WA 4DWDA 4ICNA 2YKKA 3I10A 4F0LA 3PZVA 5D9NA 3VM7A 4KPLA 3R0UA 3W29A 3N04A 2EKGA 4K1GA 3UA3A 2V82A 5B7YA 1HP4A 4QISA 1XHGA 3RAXA 3HN3A 2QJMA 3W25A 3W86A 1BXNA 1X97A 4GC6A 4H6EA 3WKZA 4MZ1A 4XZHA 4QS6A 4EYIB 2WMGA 1UZDA 3NDOA 1MNZA 4HD5A 5TIMA 1JUKA 4I5RA 2W8KA 1UBSA 4KEMA 4MJ2A 4IJCA 4C6CA 2QR6A 4GUGA 3VC6A 3GXNA 4YJ5A 3F4WA 1PTAA 3FEQA 1L8PA 1VBUA 3SJ3A 4ORMA 1XUUA 3VD9A 2BY2A 3P0XA 5HR7A 2VGBA 1ECEA 4WKFA 2ASLA 2GGJA 3WZ0E 3IGHX 4DXKA 4AVNA 4JOMA 1F73A 1JQVA 4ECTA 1SO6A 1VCGA 3KRBA 1SZRA 4KCWA 1AQFA 3KOFA 4XIMA 3CUFA 4AEEA 4PMYA 1FX6A 1XLAA 1CGUA 2OJPA 2HVNA 1YXCA 3W7EA 1EA9C 4R33A 3UPBA 2PBOA 4K6AA 2H6RA 4DO4A 2HVMA 4GY7A 5CJ5A 2C18A 1R2RA 4V1XA 3P2VA 4Y6GA 3L2MA 4E2OA 4GD0A 4DWSB 2J9ZA 4KIEA 5DMNA 1R2TA 2J7CA 1BVNP 3AHTA 3KLKA 1AL8A 4D8ZA 1KFKA 1J5TA 1VYPX 3NO1A 1O4UA 2TMDA 3DH7A 1ZHAA 3LU2A 5CQ1A 3UVAA 4PRRA 3UG8A 4O57A 2UY2A 3WBXA 3S5YA 2WHJA 4RPQA 2J8GA 1HGWA 3WMLA 3ZR4A 3O9NA 2VX7A 1QR7A 3S1WA 2QMJA 3N4EA 5KFAA 3SN0A 2V3DA 5A2AA 3YPIA 2D0GA 1H5VA 1QWKA 1VJIA 4CQ9A 1P1XA 2BS9A 4AVOA 1T8QA 2JEPA 3KWXA 2W9BA 2J6UA 3ZJ8A 3SQSA 1VEMA 4J5NA 2P3ZA 2XCAA 1JCNA 5D32A 3AS3A 4WVXA 1JG9A 5CAKA 4X9YA 2YYTA 2VR5A 1HJSA 4FNSA 2AGQA 4F2UA 1QNSA 4ZGYA 1YTDA 2R1KA 3LSBA 3R5EA 3EPNA 1C8YA 2R82A 3WBEA 1K6AA 5KFXA 3TTQA 3WN6A 3TW7A 2E5BA 3VA8A 4PMDA 1EUNA 1P4CA 1D8CA 1OK4A 3FVMA 1GVSA 1U1HA 2XG9A 2KAUC 4FALA 4O8AA 4L6HA 4JUZA 3PBUA 1UQZA 5CG7A 3ONBA 1QPQA 2W0UA 3SRFA 4LXFA 4HZMA 1OD0A 2GPTA 5A3HA 1UMYA 3NVTA 4BI7A 1J0YA 4XZNX 3AWOA 4AZBA 1N8FA 3VOCA 4BEUA 2E67A 5KETA 3P82A 4AC1X 4UB9A 4UTIA 4JTIA 4D1JA 5IFPA 1GEHA 1M03A 1FWTA 4KIRA 1S5VA 4W93A 3WUGA 1QNQA 3SN4A 3T08A 5KITA 1DWFM 4XISA 4JTEA 3GU9A 3O7UA 5DT5A 2F6XA 2DORA 2Y61A 2JEIA 2PI6A 3WMBA 4IMEA 5GJMA 2OZ8A 4GZIA 3TXVA 3GY1A 3I4KA 5KFWA 3T5JA 2HXTA 2PWEA 3TE9A 1Z89A 4U28A 4GX8A 3Q67A 4ZOBA 3W7IA 1MRAA 1OG6A 1GQNA 2IMRA 3GSMA 3KL3A 3HBLA 1TKKA 2Q01A 4LYPA 4AH7A 1UMLA 1OFDA 3BCDA 1LYXA 4E5TA 2WZIA 3Q37A 3WD3A 4HA1A 1O1HA 2AQVA 2ZUNA 4OV4A 4C1LA 4S39A 3RFAA 2ALDA 4LTSA 2VHLA 2JKPA 3RB0A 2XH7A 2WKJA 3R2GA 3H2CA 3GFYA 2QV5A 2C2DA 2G96A 2ASHA 1FCQA 4YCOA 1UWTA 4OE7A 3NGFA 2ONEA 4L9XA 4ECSA 4A3HA 2BTMA 3PJXA 3QLDA 4HTBA 1JYNA 3GHSA 2PC8A 2Y24A 3M47A 1N2VA 2V3EA 1Q6LA 1VIWA 1EYEA 5DLFA 1XM3A 1JCXA 3KDOA 2VYOA 1EIBA 2GDQA 1AUSL 1FFQA 1UD6A 2Z7KA 4FX7A 1E0UA 4AEFA 1JNDA 1E6PA 3ITLA 4RDZA 3M0JA 2B7OA 5AYXA 4MWAE 3RCYA 1WOBA 4ADSA 3QLLA 4QWAA 2IQTA 2AOSA 5CBIA 3RG6A 2QUMA 2BX7A 4RE0A 3G1RA 2XJ7A 1CXIA 5LYRA 4QSFA 5M3WA 3G77A 4N2YA 1QI3A 2BHZA 3FS2A 1GOWA 5GVJA 3OZYA 2XIOA 3ITCA 3DBPA 1AW1A 2OWXA 2B7PA 3WD4A 1BSIA 2XN2A 3T40A 3SQMA 1MQPA 4RDWA 5JUVA 3KHLA 3E9AA 4D6FA 3M9YA 1BF2A 3QTPA 5JU6A 4UC5A 3VDBA 4DJED 3OB8A 5FSEC 3P6LA 3TYAA 5CSYA 3WDPP 5I07A 3VX1A 2XFFA 2P0OA 4WDTA 4ACZA 2GJPA 1TZ9A 1BTCA 3NL2A 1F8MA 4DUVA 2BQUA 3WH7A 3B03A 2KZHA 4W87A 3M0LA 1GYLA 1E71M 2A7PA 4IPPA 3MJYA 4AISA 2XVKA 1JX4A 5FJOA 3N6QA 3QRHA 4KCTA 4C6LA 3Q2DA 3FXYA 3U2ZA 2VX4A 3ATYA 3UZWA 2ZUTA 4PMOA 3ALFA 3NFUA 5M5DA 5LSMA 4B5XA 1KXVA 4J40A 1VYSX 2NQZA 2J4GA 3ZWSA 2ZUSA 5CC5A 1M01A 1VEPA 3ZSSA 5DANA 3IVUA 2ESCA 3W1PA 2NT1A 3AISA 5J5DA 4GUIA 1GOXA 1T3NA 4NU7A 3UETA 1DWGM 5HULA 4M6UA 4M6QA 1PIGA 3ZYZA 3W02A 2WCAA 4F4WA 5LIKX 4TV5A 1NWTA 2F2HA 2DH3A 4MAZA 1MW3A 2H3BA 1A4MA 5A6BD 1YBQB 1EH9A 2A85A 3V75A 4M7SA 5LIXX 2QIWA 3TMQA 1K9DA 1KV5A 1KM3A 2VX5A 5KT6A 2J74A 2ZUVA 5D2WA 5BU9A 3EOOA 1UD3A 4KT2A 3NQDA 2GGEA 1U22A 2VRKA 3CC1A 2VR4A 1I1WA 3BL3A 3A13A 3AXHA 4F3HA 1REQA 2DT2A 1VLWA 2QLYA 3TQ0A 1GYNA 4Y90A 2Z26A 4GYKA 3ME3A 2XGQA 4UTKA 4K8GA 2OEMA 4IG2A 4F66A 3FA5A 5A1AA 3WLIA 4YHEA 1MO0A 1Q7ZA 4JTTA 5FEPA 5DLGA 1NDWA 4YS1A 5FAGA 2BXYA 4RNFA 4UTWC 5LA1A 4GIYA 4WHBA 4ZA0A 2E1DA 1AW2A 1MXSA 1RVKA 3RF9A 3E5PA 2KX9A 3S5NA 1FH9A 3UESA 3IN5A 4S3JA 1MNSA 5D2YA 4MZ8A 2CBVA 3T05A 3LCFA 1XLFA 2PLMA 4ZOCA 3GVVA 4NG3A 1JZ7A 5FL0A 1ZPTA 1BG4A 5F2GA 4E2BA 4F2BA 4ES4A 4WIWA 3VPLA 3WDJA 5A6SA 3Q45A 1YE6A 2DSKA 3AIEA 1UWIA 1YLVA 1BYDA 3WL0A 2I56A 3H8AA 2QCFA 3NEHA 2PD5A 1XQLA 3TJ4A 3Q8QB 4OTKA 4O52A 3TONA 4HMEA 1CNVA 2VEKA 4TQRA 4R9XA 3AIQA 2CBIA 3HJZA 5T9BG 2WBKA 1B3OA 1HZYA 3CH0A 4I6VA 4E2VA 2B7QA 4LOCA 1NP0A 1XR2A 1NFGA 3QFEA 1EJUC 5JBDA 3TN4A 1GOKA 2Y2WA 3N9RA 1KLYA 4TVDA 2PDWA 4QJ4B 1PAMA 4KRTA 2J75A 3GK0A 1HJXA 3SGGA 1ICQA 3UXDA 5JXQA 1JCMP 3P14A 1JF5A 1UWQA 2AGTA 3UXIA 2WSYA 5BWFA 5LA2A 4ZTXA 1MXGA 3QSTA 4FXSA 5CPSA 3LDVA 1EL3A 3KBNA 3NCOA 3M41A 1K8YA 1YNQA 4BS0A 3L4YA 4W4QA 1EO7A 1OFRA 4LS2A 2IS7A 2YLLA 3VMNA 2J66A 4YN5A 5C5YA 5I23A 2CITA 2FLIA 4GJJA 4ZOEA 3U57A 3M07A 1PTGA 1TVLA 3P81A 4FXFA 4XX6A 5CC3A 2NV2A 1W3IA 4XAGA 4RDVA 5J04A 4HJWA 3ICJA 2HTMA 1LOQA 1Q45A 4D72A 1TRIA 1VBRA 3INPA 4UQAA 5F2IA 3PZTA 2Y5EA 1ZP3A 3ARRA 3RM4A 3TA9A 2ZZ5A 2PDFA 1AA1B 1A47A 4J9OA 1Q66A 3W2LA 3AHZA 3ABRA 4N4QA 1P48A 3WDRA 4O1EA 2AMGA 5DT7A 3MMUA 3RR4A 3NEVA 2R8WA 1ZL1A 1GVEA 3PWAA 4WF7A 5DBUA 4N0RA 1GQLA 4W85A 1NOWA 4Q8NA 1EHNA 5KINA 3M0KA 4PL2A 1IV8A 4MZYA 4GINA 4PUMA 3TYZA 2RJHA 4ECLA 3VKJA 5HMSA 2DIEA 3L66A 3WD2A 2OXNA 3HPSA 3F7JA 3W22A 4QLLA 1CGVA 5FF2A 4YVXA 4C6FA 1HJUA 4JZ5A 3HF3A 3E74A 3PM6A 2I5IA 4QIUA 4JS3A 4EPEC 1PKMA 4JTJA 5KFTA 1RQBA 3RBDA 4LCRA 5EFDA 4UCGA 2HK1A 2TODA 4DM1A 2Z29A 4FR1A 1RD5A 3MP5A 3FW6A 4BI5A 3L12A 2CLIA 3VNYA 4I7UA 3CHFA 3MCOA 5CPTA 3TTSA 4UTTA 2BHUA 2CHNA 3BSGA 3WK2A 3ZR6A 1TTIA 3RB4A 1GZJA 4DO6A 5D8WA 1HJVA 3W01A 4B5TA 2ISDA 2BLEA 2ZXBA 3NTYA 3CAQA 4L1XA 1GT8A 4WJEA 3FKKA 3LY0A 2XPKA 3HPFA 1RA5A 3C8NA 1QCWA 3AICA 1BAGA 3K13A 4ML9A 2UY3A 3H2MA 1K1DA 3OBKA 3VD7A 5EL1A 3GO2A 4PRWA 1JAEA 3LENA 3CNYA 2CLOA 5KFDA 3CWHA 3UG4A 1RK5A 5EMJA 5DEZA 2J77A 1QHPA 4H9XA 3PPFA 4OZOA 3WF2A 2BBFA 3T8QA 1S2CA 3BW4A 3TFXA 3W84A 4H7ZA 1GHSA 4NILA 3PUOA 4FXRA 5IBXC 5D9PA 4O3OA 3UD6A 2VT0A 1WBJA 1HFBA 3CIVA 2QJGA 4M0XA 4NP7A 4RR4A 5G1MA 5CJNA 5C70A 3A4XA 5KFYA 3NDZA 2ODOA 2E40A 3UZ5A 2FH6A 3QKZA 1LL6A 4DWSD 1X1OA 3MHGA 4JNYA 1Y0EA 2UZ9A 3OHMB 2BP1A 4BZYA 3MMTA 1PZ0A 3BMXA 1TE6A 2YA1A 2PWGA 3AMDA 3VIKA 2C71A 3BAIA 3E96A 5HAOA 3F2DA 1YIXA 1KRBC 1IIGA 2OOGA 4Q8FA 5FI8A 1TPUA 3PUEA 2YL8A 2J6SA 1Q4NX 3L5LA 4YVPA 4Q8OA 1VGAA 1EPXA 2OELA 4CEXC 2D0HA 1N82A 2V69A 1J2BA 2ZE0A 1HGYA 3W26A 1XJBA 1MZHA 4XWUA 3AXIA 3EWYA 3P8IA 1XIDA 1F3WA 3LCIA 4ADUA 4UFIA 2Q02A 4UOJA 1M5WA 4YWSA 3QMTA 1Q2RA 3M16A 4H9YA 4XVDA 2E9BA 4AYGA 3MW7A 4ECZA 2O4MA 4HMDA 1NOUA 3G0SA 1E1CA 1F8IA 4NI8A 4DZIA 4ROQA 3AS1A 2XVLA 1VFTA 4NSBA 5DF0A 1JIBA 3HFTA 2HISA 4OV9A 2Z00A 1XSJA 5KFEA 3MPGA 1ZALA 2FMOA 2J7EA 4Q22A 4YYCA 3M0XA 1ZGDA 3DOPA 2J7GA 4GKTA 1CENA 4QEHA 3GB6A 4F2TA 4HHHA 4XZWA 3UG5A 1AMKA 5G1YA 2V5CA 4L9YA 1V5XA 4MLRA 2WC4A 2FDSA 4YTSA 1NDZA 4DXXA 5LNRA 2QJHA 3HO8A 1W54A 1PBGA 4B5VA 3R13A 2OQHA 3B0VC 4KMQA 3SUWA 4MAVA 1E3ZA 5D2TA 4M81A 3M44A 3ZWTA 5KG2A 2V81A 3IANA 4H83A 1W31A 4UQCA 1GPFA 1V6VA 2V68A 1TV2A 3G5EA 4MVAA 3WQFA 4AB4A 1JYXA 4R9OA 4QWBA 1KM5A 2P5NA 1N8WA 2V2DA 2DUAA 4B16A 2VGGA 1W9XA 4K7VA 4ZQPA 1S5NA 4YP3A 1S2VA 3NGDA 1N7KA 1UD5A 3G6VA 4N7QA 2BXZA 4ZODA 3VD3A 2GVJA 2Z1WA 1C90A 3PFRA 3E0LA 3GIYA 2UY4A 4O19A 1CXLA 3HPAA 3SFKA 1JCTA 2J27A 2BG5A 2XSBA 4J3XA 5HDRA 1M1BA 2ZWZA 3BURA 2F6UA 1UOKA 1PTDA 3BE7A 1JUEA 1B9BA 4R8UB 3B8UA 3AFBA 1R2SA 4JTDA 3BLIA 5TF0A 4V1YA 2JEQA 3WF4A 3SCRA 4P61A 1XDJA 4PTVA 2CKSA 3EOSA 3ZVIA 4F9JA 1OX4B 4MB5A 1JCJA 3IIZA 4CD8A 1WPCA 4CCDA 1I0DA 2YDQA 3R89A 2F2KA 3EPMA 1DV7A 3URAA 4CVWA 1W3JA 5EKYA 1EGVA 4Q4KA 3EGJA 4KEZA 3EWBX 4HJFA 3WFZA 3REQA 4ZB2A 4MIMA 3TNBA 1FCUA 2ZADA 5CZ0A 3H4XA 2ZZ4A 5AHIA 4LUSB 4JTHA 5HA7A 3VINA 2VFIA 2ISVA 2PU0A 3MI3A 4AC7C 2OEJA 2ZRUA 1FCVA 3I3EA 2W7OA 2CBJA 5I3GA 4G7EB 4HK6A 4RNHA 3SY1A 3BAYA 4W7UA 1Q6OA 2XGIA 2GVGA 4NVTA 4DL3A 3SCQA 2V2CA 5KMYA 3TLLA 3PJUA 1CW2A 5E1QA 1IR2A 1NTHA 4MNKA 1XYZA 4O11A 4DUWA 2BGNE 3GILA 2PF0A 4O15A 1LLZA 4XKYA 2Q6ZA 2OLAA 1A5AA 4J3VA 1H0IA 3VGFA 3NPVA 2J6VA 1K8ZA 2QDGA 2FJUB 1JZ5A 1JCLA 4DLMA 4HK5A 1A5SA 4CQDA 4W84A 2BNJA 3N19B 4LVGA 3QY6A 1H63A 5FF3A 1LT8A 4U3CA 4K1WA 2WANA 1UKQA 4V27A 4A2SA 2P53A 3U4FA 4WY0F 3WENA 3BMWA 1TR9A 3A3WA 5B80A 4ZE5A 4IQJA 3RLGA 3ANVA 4DO5A 4UOQA 2DQWA 1AG1O 1A5BA 1ZAIA 2VZOA 2FZBA 3O8AA 3EAUA 2P9BA 3VVGA 4UR8A 2D0FA 3AXMA 4L61A 2POZA 1DP0A 4GG9A 5E9AA 5L1IA 3POHA 4H6QA 5LNWA 2J7BA 4Q8MA 3E0WA 3VABA 3KOWA 1JDCA 4UQDA 4DBUA 5A8MA 4P7RA 3VGGA 3WUFA 4DI9A 4O3RA 1BRLB 5AYIA 1POJA 2NSXA 2YXGA 3UT0A 3QGKC 4O1AA 1FWBC 3EDDA 1SJDA 1TFVA 1TMQA 4XZ9A 2RDWA 2VFGA 1JPIA 5EMMA 4F0KA 3NWRA 3SSZA 3AC0A 4S2CA 1GVYA 3H2AA 5HJYA 4JTQA 3VFCA 1KBLA 2YR1A 5LXEA 2UWFA 3W53A 1HP5A 4JHZA 1KCLA 1SQ7A 3JZUA 3CPUA 4LQ1A 4LPCA 3OO2A 2TRSA 5D04C 3ITOA 4IMAA 3JS3A 1OVDA 4Y96A 3GAYA 4AMAA 1FWNA 2QEZA 2V4RA 4CD7A 1YNYA 3G0UA 3WF0A 1SZEA 3S1GA 3CV7A 2Z4GA 4KQNA 4D6DA 1O66A 5DRCA 3UCDA 1BKHA 2ISFA 4IXXA 6REQA 3FCPA 2I17A 1YDOA 1RPXA 1HQTA 3V1PA 1SGJA 3BOLA 4C6IA 4JR5A 4AZGA 1EBGA 1LTDA 4J3TA 1E15A 1V0KA 3EWCA 2DT1A 1HNYA 1XKJA 3M0YA 5BMWA 4LC8A 1K6WA 1ZY9A 3T0TA 3VILA 3GV5B 3LBCA 4H6RA 4BQ5A 1TV3A 1GJUA 1PCKA 2RDTA 3U7BA 3ENLA 3CUZA 3LHWA 5KZEA 1DTNA 3C2YA 1E4MM 1UH2A 3E0FA 2XGBA 3P5ZA 3WH9A 4AZHA 1GKQA 4YR2A 3PZMA 5DMLA 2G37A 1RQHA 3AHVA 1V3MA 1A53A 1XRTA 3GTFA 3NURA 5K9CA 1EF3A 4RNJA 3CXOA 1ZJBA 1GCYA 1BYBA 2H8ZA 4XD3A 2ALRA 4DZHA 1TELA 3PZGA 1XIBA 2WC3A 1OYAA 4M7TA 1W1B1 3DFTA 1L9WA 2INFA 2EG7A 1D7FA 4JQAA 2IKHA 2ZUUA 5CGTA 3EWUA 1F3EA 3W81A 3V5CA 7ENLA 3CZJA 4H8NA 1G69A 4FF7A 5JMUA 3D0CA 1PDZA 3GS6A 1XDLA 3RK8A 1TIMA 3W71A 2QKFA 1XBZA 4GIAA 2DEPA 1DJHA 1MWOA 4NXKA 2PGEA 5F4SA 4Z2HA 3MDWA 3E0VA 4IISA 3VNIA 1SFLA 1B31A 4U5IA 1TV7A 8TIMA 4L4LA 4EPKA 4QAIA 3N9KA 1F76A 1XLHA 4N9EA 3RPDA 3SR7A 5KZMA 1ZBCA 4E0CA 1UR3M 1J6OA 2PDBA 2XN1A 4TQTA 4HA3A 3TYUA 4DEFA 3TR2A 2HNHA 4ONVA 1ML1A 3GNXA 1EXBA 4WGXA 5C0QA 4LB3A 1KWGA 4C6EA 1EJRC 1OCNA 3CO4A 3HV9A 4KBXA 3RM9A 3GDLA 1XX1A 1VRXA 4XZIA 4FMVA 4Z42C 2VGIA 4I5XA 1V7AA 2EQDA 2YBUA 3MKCA 2ZX8A 2VZVA 2W79A 1NELA 4ILSA 1RBOB 3ABXA 4W7VA 4IFKB 4Z2LA 2EF9A 2QUTA 3RYSA 2ACUA 2JK2A 1VZWA 4PMVA 1TZZA 1LCOA 3R7MA 3LM3A 4NT0A 5KSWA 1UWSA 3QN3A 5AHMA 3E2QA 3SFWA 2Y7EA 2DSWA 4B90A 4ECVA 1J11A 7REQB 4HPNA 2PWFA 2X30A 3P62A 4K37A 1B4EA 1XLEA 2ZXDA 2ASDA 3GG7A 4GQQA 1WP6A 2QCGA 5DG7A 4NX0A 4Q7IA 1XRSA 1JZ2A 3W0KA 4YHGA 5EB8A 2V5LA 4XB3A 5CH9A 2VWSA 3TYDA 1J5SA 4UQBA 3FHQA 4U5KA 1Z48A 1I2RA 3FIGA 4XBSA 3QW3A 2J13A 3WIJA 2H9AA 2EPLX 2MNRA 1W2PA 1F61A 5FJJA 3THCA 3E2SA 4XAPA 3HU7A 3W7QA 1UPMB 4YR3A 4MWAC 4X63A 4XUYA 4Q4MA 1OM0A 4E4UA 4YMZA 2GOKA 3LOTA 1IEQA 4MMWA 5KFOA 3MYPA 1B3ZA 3KS6A 3NQ8A 5AC7A 1I45A 3B97A 4LW7A 2AU0A 2VFDA 3OVPA 1FH8A 4R7OA 1CGXA 1MDRA 4HK7A 1CGWA 4CQAA 1F4HA 2JF6A 1S3HA 1PHQA 2PMQA 5XIMA 1B4KA 4HHMA 1NOFA 4DM2A 1XIHA 5FOOA 1KTNA 2VDHA 3P7YA 4H7VA 3TXZA 1V3JA 4N6FA 3DC0A 4F4YA 1Q7MA 4LV4A 1OCQA 1LG2A 2YZRA 3EKGA 4Q6JA 4YXGA 3LV6A 2J7DA 4HPGA 1LQAA 1WDRA 2CHRA 2QYGA 5B7ZA 5CG0A 1XYBA 1ZQ5A 1U1JA 4GFIA 1PE1A 3UJEA 4XD5A 3ITGA 1JR1A 1BEUA 1F9CA 4V28A 2OQLA 5EYWA 1O94A 3QVQA 3NQAA 3THUA 1E40A 1KKRA 1KR1A 3ZXWA 1U33A 4ZB0A 5KFKA 1TPEA 4O17A 1ZTVA 1MRQA 5BRPA 3AROA 1KC7A 4S2BA 1P5BA 2XZ7A 5E9XA 1PPIA 4O1DA 3AHXA 2WWCA 2CPUA 1KGXA 3KUMA 2VEPA 1B1YA 3SAZA 3C2FA 2W3ZA 4Z1CA 4FOKA 5IDIA 5F1UA 2HZGA 4K38A 3UG3A 4EVZA 2OSWA 2O9RA 5REQB 3T2PA 1LM1A 1J0HA 3URBA 4MKNA 1G01A 1JDEA 3CTLA 3FDSA 3L23A 4PMZA 2GQ3A 4IOTA 5HINA 4JKKA 3UXAA 2IXUA 2Y88A 3UZXA 2VNCA 3FK4A 3QZ8A 1GK8A 4Z2JA 1DJZA 1DIEA 4R7WA 1BYAA 1UC4A 1QT1A 1JXLA 2Q71A 3B0YA 1TWIA 5LZLA 3KZPA 1XYCA 3TCSA 4GQBA 4UFLA 1W1ZA 2BOGX 2GDVA 1QVBA 5BCAA 3IJ6A 1ZCCA 1Q7QA 1EUAA 2VKZG 1K3UA 4PUKA 4MNLA 4FS1A 3OODA 3FAXA 3Q65A 3WJXA 4OJYA 3IIXA 3QGVA 3BQ0A 4UUIA 1ISYA 4Y2WA 1JDDA 2J79A 1DIOA 3TJIA 2WVTA 4ZFMA 3LNPA 5CZKA 2E0PA 1KR0A 4AY7A 3MUZ1 4UFMA 1VS1A 3NNTA 4QM1A 1S0OA 4EYHB 2WNQA 4L56A 2VQTA 3VNKA 1XI3A 1V93A 5EPDA 2HE5A 4BA0A 1EWDA 2WSKA 1Z44A 4QROA 2X1UA 2WXDM 2PFHA 4EK7A 3S46A 2J6TA 4J9KA 2W62A 4PTDA 4JYEA 2I1OA 4LC6A 4GJIA 3RX3A 2PDIA 3GX9A 3T5HA 2CFFA 2VUYA 1TJ1A 2XM2A 3N4AA 3UY7A 5C54A 4PR4A 2W61A 1WX0A 4CNSA 2HMCA 2DUZA 2R91A 5K9DA 5KFJA 2QZRA 4J9PA 4QGCA 2QS8A 2CU0A 3OBAA 2GJXB 4TU1A 4JEQA 3PSWA 1KRAC 1HKKA 2IKGA 2G0WA 1ZZMA 3WLQA 4ZQOA 3TN6A 2XFRA 3N2XA 2PTWA 1AK5A 4A3QA 3UYCA 5M1TA 1ZLPA 3K1DA 2YZ5A 3L2LA 4BQ4A 4UZUA 3B0PA 4IIBA 4UQEA 1IM4A 4DPQA 3RRAA 4MG4A 5KFVA 4EWND 1AZ1A 4WR3A 3IUIA 3S2NA 3M0IA 1K9FA 2VJXA 2X2YA 1LOLA 3GUWA 3TOYA 4UNIA 1LORA 6PTDA 4JTAA 4Y9AA 2ZE3A 4O10A 1CGTA 3IUHA 1J79A 3IUDA 1ENUA 2FH8A 5A69A 3G1SA 5G5IA 5KG7A 3RLHA 2BR0A 1OX6A 2VC6A 3MMWA 3DYPA 3EB2A 3T2OA 4ECRA 2PDNA 4PUEA 4MFEA 3WJSA 3KP1A 2J24A 2R6OA 3S6DA 4BFAA 2YCLA 3G6XA 2P76A 1X1ZA 1ZAHA 2VDGA 5ABFA 3A6OA 3M64A 4X9SA 5DELA 1L6SA 3W75A 4GYPA 4H9VA 2EPOA 1IR1A 4F4ZA 4C65A 3VKCA 2J8TA 5HMDA 3TH6A 2XWDA 3RMJA 4F4XA 4X0VA 2YLAA 4CKQA 2IQ0A 3IVSA 4MY8A 2ZTKA 1H62A 3GUGA 2BVYA 3SRDA 1CWYA 2A7RA 4Q32A 4H00A 3BMVA 3B8VA 2DPJA 1XLJA 4XSMA 1UC5A 4IRKA 5CPMA 4MYAA 3G3DA 3HA1A 3LPFA 4HSNA 3U2EA 4O1CA 1BXBA 1WKEA 4K8EA 4FSAA 4KS0A 5G1TA 4XAZA 4P8VA 4CN1A 1X39A 1YPXA 3AMLA 3L4ZA 5HOSA 3TC7A 3LSCA 1S0MA 4OECA 2ZUMA 1PO9A 4IJRA 1CI1A 4TTUA 4JTSA 3R43A 4Q33A 3GBDA 3IJIA 3SO7A 3KS5A 1E9IA 2V9WA 4ECWA 2C0HA 4CNNA 3PG9A 1PEZA 5A6KA 5A8PA 3IAPA 3BANA 2PWDA 3W6YA 3AIUA 8CGTA 3GNOA 3EB4A 1TVPA 3RR1A 3F4NA 1F3XA 2WMIB 1ZETA 1NIUA 3DHDA 1Q8JA 5KFUA 2WMJA 4JIEA 4J2PA 3DEQA 4FI4A 4DLFA 3UPWA 4JBRA 2PZ0A 2J9YA 4IMCA 3C56A 1UUMA 5CGQA 3BLOA 4O1BA 1CXHA 4WEVX 5T91A 3IIPA 5E0FA 4UMAA 1QOQA 2Y62A 2C13A 3JRKA 4DF1A 2DZXA 4WDXA 1S39A 3W2UA 3KHGA 3WJYA 2NW0A 1KGWA 2Q3OA 4LB4A 1OQFA 1V7YA 3CQIA 4M8UA 4Q3MA 1W8SA 2EPKX 4RUCA 4AWUA 4HCLA 1E1FA 5D03A 3T4WA 3EA1A 1VPYA 2Y1HA 2Y7FA 4QW8A 2WBGA 4ZL1A 4WSHA 3MS8A 3A24A 5FJRA 1V3HA 1A3XA 4M24A 3KFTA 3H7VA 2ZTJA 2YGYA 4JY8A 3MR3A 1ODZA 3R58A 2Z1VA 4PUNA 3C8FA 1Z42A 1DTUA 5FJIA 4XVEA 4HU0A 4R7JA 3U7VA 3HZ3A 4KERA 4UTJA 3HMJG 4AYSA 1A0EA 2PURA 2ZYFA 2F7FA 4GA8A 1K1SA 1PIIA 4ORIA 1Q4WA 1X6LA 3MZNA 4P7LA 3BLDA 2PRHA 4M82A 3THAA 3RM8A 5KFNA 4LY4A 1R3VA 1DJWA 1N8IA 3KVLA 3SCSA 5HQMA 2ALZA 2GGGA 2Z1KA 2ZX5A 3ID7A 2B81A 4W8LA 1TPC1 3AHYA 4WY0B 1W37A 5DN1A 3QY7A 2D2OA 3CIWA 4IGNA 2W9CA 3UWUA 3DHPA 4HU3A 3HOJA 3N14A 1E70M 3QKEA 3SCWA 1UD2A 1XCFA 1DOSA 3FA4A 4QE4A 3MA8A 3WQVA 3URQA 1RH9A 2PB1A 1V3LA 2G3JA 4ZB5A 4DX3A 2FKPA 3W85A 4LFYA 4Y9PA 4L6DA 4QG9A 2ZZ1A 3OPSA 2QCNA 4QG8A 2LLEA 2FLPA 2V2HA 2VX6A 3VCNA 1N56A 5D02A 1LWIA 3PWGA 1V0NA 4DUOA 4XBKA 4GUJA 3BO9A 3QH2A 3OGRA 1KWKA 1BSLA 4NUWA 4ZQNA 5AYYA 3W72A 4I90A 4PUDA 3W7DA 3TOPA 2C19A 3I7SA 3CJPA 1M53A 4GO8A 4XUGA 3HM7A 4WQ6A 2F6KA 4OVXA 3L4WA 1M68A 1I2OA 3BJSA 3FY1A 1VB9A 1PZ2A 1HVQA 2X09A 3EWDA 4DJFA 3OZOA 1TB3A 3TZFA 3LV5A 5FIPA 3UCQA 3VX0A 5CSRA 1GGOA 1QRQA 1V6TA 3VNZA 3RX2A 1IXNA 3UVIA 4ERAA 2Z2AA 2ZUWA 4GISA 4TTGA 3CHDA 5FJTA 2PF8A 2OKOA 4URIA 1UR9A 3NYDA 2QUUA 3LQLA 1XISA 5E6YA 3L2IA 4ZO8A 1HKVA 3V5FA 5KFQA 5KT3A 2WMKA 4IUOA 1PKNA 1TUXA 2VCBA 3G1AA 1S46A 1DBTA 2BQ3A 3MANA 2QVNA 1S38A 3V0SA 3S2LA 3WDQA 4YL2A 3OIHA 1XIGA 2DJXA 3CL8A 1CIUA 1RYRA 4MB3A 2PODA 4FBTA 4ALDA 1VC4A 5E70A 7ODCA 2DW6A 4NHVA 1MW0A 5AZ1A 1VFOA 1UKSA 3NYZA 4EKJA 2OYLA 5LNSA 2ZDRA 3LGDA 3QW4B 1LBMA 4DL4A 3B9OA 3D6NA 5XIAA 5LIUX 3W1TA 4GC3A 4NZ4A 1ITCA 4AD2A 1XF0A 3VMPA 3VGHA 1C3FA 2B0MA 2AGPA 1SW3A 3M0MA 1MVYA 1W6TA 4FNTA 4Q8WA 4HN4A 1E9YB 4OOZA 4R8UA 1TPFA 3PW4A 2ZIDA 2HSAA 4MJMA 5A6JA 3LHTA 1J12A 1EC7A 1GG0A 2GGIA 3FGCA 4IIDA 4R53A 1XLDA 4J3SA 2W8LA 4X61A 2CXGA 5C8BB 1ZB5A 5BMXA 3AU6A 4CLMA 4K39A 5C5JA 2NWRA 2OT0A 2GUYA 1ITXA 5JBEA 1EOMA 2CLHA 3BV4A 3VIJA 5KG6A 1EGMA 4ED1A 5CZTA 2WC7A 3QZ6A 5L1KA 3C52A 4JNMA 2YDSA 1UZ4A 4GY1A 3E5BA 3E6EA 1E5NA 1XRVA 1W3KA 1GNXA 3QV8A 2ZRWA 3W1AA 2E28A 3ANUA 3GTIA 4PFMA 3NQGA 5D9MA 4MFDA 4OUIA 4NAEA 1XH0A 3CYVA 2X7WA 3VOIA 1BVZA 3UNDA 4HNUA 4M3PA 3PZIA 3CAVA 4NZ3A 3IVTA 3MMDA 4PYSA 1G4TA 1WQ5A 2UBPC 3S9ZA 1K70A 1KTCA 6CGTA 2RH9A 1HVXA 4QHRA 4EWJA 5K4XA 4BF9A 3T2QA 1FFRA 2OO6A 3ALGA 4BEQA 4I5UA 3HG4A 3EDJA 4PEKA 1S1PA 4H04A 4Y8FA 3DZ1A 3ZO9A 2R1MA 1E6XM 1XYAA 3NZRA 4GACA 4PCSA 3SUVA 2DV0A 1K02A 4Q4OA 4Z1YA 6TIMA 4QLKA 4TIMA 3OIXA 3QPZA 4M56A 2C8NA 4NAFA 1OT1A 3CWOX 3ZT6A 1JPDX 5I3IA 1MDLA 4GABA 2QPXA 4D8AA 4WXZA 1Q8AA 3KVKA 1R3TA 1JGMA 3DENA 2YA0A 3ZR5A 7TIMA 1EDTA 2FJKA 3RDKA 5MHBA 1A0DA 4BK9A 5ECVA 2G4JA 4CEUC 2G3NA 4R5EA 1C7TA 3VGEA 2PGFA 1U5HA 4AIOA 1VF8A 4JYDA 1S97A 1V08A 2CLMA 1IEWA 2VOMA 1EGZA 1RV8A 1GKPA 1WZAA 3MUCA 1M7XA 4OKDA 3R79A 3I7QA 4WDWA 2C14A 1JFXA 1MUMA 1E4IA 1TPVA 4QBXA 1TWZA 2BASA 3QOKA 3CQKA 5A8QA 2GJRA 3VIOA 5A94A 1S9FA 4LRSA 3DKJA 3VGBA 5KFGA 4WJ8A 3H53A 1PCWA 2XN0A 2CKRA 1R3YA 5CZSA 5TAOA 1KW1A 1L2QA 4AF0A 2OGJA 3BZGA 1R3WA 4FR6A 4TVCA 1DE5A 1WV2A 3XINA 1YXDA 3G24A 3O0KA 1V3KA 4QSHA 5H1WA 3M46A 2OEKA 4LF2A 1Q63A 3PK7A 4LBUA 5CAHA 4XBJA 3M5XA 4WSKA 5AC6A 1WDPA 2VFFA 2ZFAA 4KCUA 2F38A 3T9PA 4PMQA 4QG6A 1I4NA 3NQFA 4J9LA 3TA6A 1UR0A 2QQ6A 2P8BA 2FZ9A 2EJ1A 3ATZA 3V7PA 3VDAA 3P5YA 1E73M 2V6AA 3QZEA 3ARZA 3UXKA 4P8WA 5ENLA 4DELA 4RV8A 4YTTA 1KFCA 1QU4A 4IX2A 1RXOB 2GQ8A 1QI5A 2HXUA 2GOUA 3ANYA 3U6WA 3DHUA 3LXBA 3GIKA 3WK0A 4ATDA 1TG7A 4KGLA 3RUBL 4JL2A 3OVGA 2PRLA 3K4AA 4HOWA 5KG4A 3EYPA 3N3TA 4JKMA 5KFZA 3BQ1A 3G22A 4L9ZA 4AZIA 4PCTA 1YDVA 2DUXA 2NV9A 4OU1A 2Z6IA 4PMRA 5BROA 2PCQA 1ADOA 3CU2A 1DJIA 3I4EA 2VD9A 2CNCA 1TPB1 4NZCA 1W9BM 1AW5A 3H4WA 1A4LA 4YU1A 3PTQA 3TSDA 1QNOA 5HQEA 3VOJA 1S5MA 3BDKA 1XL9A 4M80A 1EKOA 4UBPC 4MPKA 5F4WA 5E09A 1Q3NA 3BC9A 2FVKA 1XIIA 3GDMA 2CZ5A 1FWHC 5EMUA 4LBSA 5IRPA 1XD0A 5E5CA 2I5QA 3MFHA 1MEWA 3GC2A 2FZMA 3GGMA 1AH4A 2HV5A 2WO5A 3N34A 1S2AA 5CSSA 7PTDA 4O3NA 1HT6A 2XYLA 1HF6A 3OQEA 4Y9NA 1Q6FA 3T0AA 3EEGA 2I16A 3N2TA 4HOZA 1FWFC 4B9YA 3ITXA 2Y0FA 3IS4A 1M9HA 2ZRVA 1HN1A 3AZRA 4JTUA 3WF1A 1KTBA 3N4FA 4M1BA 3MHFA 3S1XA 3FVDA 2JQXA 2DJLA 3F5KA 4B5NA 2V9DA 1RJQA 4G5DA 2J25A 5HNNA 3QQ0A 3S1UA 1TMHA 4UTTC 4ED8A 2D1ZA 4L4PA 1W5QA 2C7FA 2XC9A 1XG4A 5E6ZA 4X0NA 3M0VA 3DYOA 5T9CE 3KDNA 1KA9F 4DBDA 1XYFA 5LGXA 3B8TA 3GIJA 3C5QA 3CMGA 1J2WA 3GAKA 1EEXA 1VQTA 5T26A 3MO4A 1XGDA 2WVSA 3DN5A 3ELFA 4UTFA 4Z2IA 3B06A 1AVAA 3S5SA 4FNQA 4H41A 2O0TA 1XIFA 1VBGA 5H8PA 3IGSA 1VP5A 2BFGA 1FWWA 3CPGA 2E77A 2G3FA 4D6GA 4I6KA 3RILA 3NA8A 4LAKA 3WFLA 4F0SA 1W5OA 3OYZA 1KXTA 5EY5A 5ABHA 3U2OA 1KKOA 4GNKB 2CETA 1EJWC 4JGDA 4EEYA 2E9LA 2ZZ6A 3Q4DA 3UWVA 4HA0A 1T96A 2R8GA 3MB9A 2HWGA 3CZGA 3BW3A 4DHGA 3N18A 3R12A 1FWDC 2J7HA 1VH7A 3MQTA 5C9UA 5FESA 3LHVA 1CXEA 1RYSA 3NJ3A 1JIHA 3H40A 2A3AA 4Z17A 4E38A 4NKCA 3UR5A 4Y8EA 1XRFA 5KFBA 3W27A 2V3FA 1B54A 4LRTA 1OYCA 1Q6QA 4GH3A 1XV8A 1TVNA 1Q6DA 3ARWA 2X8RA 3CGTA 1I0BA 1FWSA 4DJDA 4HHPA 4LUTA 3KL0A 1EQPA 4LYKA 3LTPA 4TX6A 4Q4RA 5CGMA 4A3UA 2JFEX 4KFNA 3BCFA 5EBUA 4J28A 4KRZA 3UJSA 2IBKA 2PD9A 3VIPA 1R38A 1VBHA 3PZ9A 2O56A 4KRUA 4ED2A 3WQPA 2I7GA 1LF1A 1R9ZA 2V38A 2WQPA 4FO4A 4D1IA 1H5YA 2FTPA 3UEQA 5DLCA 3A4AA 5AHNA 6TAAA 3KL5A 3MUAA 1GVOA 4H7CA 1AD4A 2VUNA 1NSJA 2DIJA 1LBFA 3AIVA 1O68A 4AXNA 3DI1A 1BWLA 2DH2A 1A3WA 2VC9A 4LAMA 1OFPA 5A6LA 5DX7A 4DY1A 2CW6A 4XZMX 3DHFA 5HNRA 3A47A 5JUMA 4H9MA 3W7OA 3LUTA 1JYWA 3TQVA 5KFPA 3IARA 1E0VA 3PBWA 2W9BB 1EDQA 4L5ZA 3RN6A 4NI3A 1Q6GA 3D3FA 3F1QA 4OFCA 1CT5A 3G0XA 3ITTA 3O07A 1JI1A 2NVCA 3DGBA 3LHUA 3NL5A 3MZ2A 4MJ4A 3VUSA 3M7SA 2ZRZA 3UY8A 3D5HA 4C1NB 4GK8A 4KEUA 3W2JA 4BY3A 2WAGA 1KGUA 4O4VA 2P0IA 3LZ5A 1HX0A 2PDKA 3ZQ9A 3N12A 1Y7VA 2VL4A 4XD6A 1OYBA 1JRCA 1O95A 1JUBA 2GWGA 3MBDA 4OHQA 4W8AA 3E49A 3IJ8A 2VTFA 4DYEA 5FF0A 3HG5A 1UW9A 2WJDA 3CL6A 5A2CA 4CQCA 5EWEA 3MYOA 3UWQA 2CLKA 2IKJA 4MPQA 3QV7A 4XIAA 3W4RA 1V03A 1QBAA 3BAXA 2JGYA 1DJGA 3SRHA 3LEPA 3P74A 2DZWA 4JV1A 4RZBA 2O7SA 3WNPA 3OOQA 3FHAA 3GQYA 1YEYA 3WK3A 4US6A 1UKOA 5KG3A 4AG0A 4Y9MA 2J47A 4O8RA 4L80A 1PHWA 2YA2A 4FZIA 1UJPA 5EDWA 3W88A 4MKVA 1GZGA 2E09A 1SPQA 1WDSA 4EPBC 4QEEA 5EFFA 3OGSA 4FS9A 2Q3RA 1FP8A 3LMYA 1OK6A 2WHKA 3EA2A 1X8FA 2YCIX 3B05A 1GJPA 2PWHA 3TIMA 4B5WA 2QJIA 5KFSA 3BAKA 1JDFA 3CBWA 4NZJA 5ABEA 3EZ4A 5C55A 4NL1A 4BHYA 1ADDA 3PTDA 4HYWA 4B3ZA 1YPFA 4U31A 3H2OA 5HJXA 5JQ9A 4RXFA 2FHBA 1IEXA 3OLEA 1XC6A 2WNZA 5HK4A 4RL3A 3SCUA 2PAJA 1FKWA 3NL6A 1JF6A 3KW3A 4KESA 1V77A 2JIEA 2ZRXA 2QUNA 4F0HA 2RGLA 1G7VA 3V6KA 1ZU8A 3FYPA 1ME8A 2ZICA 2XVNA 3A5VA 1YDNA 3C0LA 1LJYA 3OG3A 3EX6A 1OC7A 2WVVA 1TJPA 2OKTA 1P0DA 3EX2A 4L4OA 1BQGA 3LLXA 5HJLA 1E0TA 2HBVA 2IUZA 2C2RA 4S3KA 1NM9A 4US5D 3VUPA 5F1VA 4X3ZA 4WRHA 4EOUA 2JKEA 2FDMA 4HYRA 3SUTA 3A4WA 4HPJA 4GY0A 2Y7DA 3DUGA 4I8YA 1G7UA 2QJNA 1XWYA 5I79A 3H54A 4S3FA 1LL4A 4U3AA 3MHUA 1W1A1 3K46A 2WCGA 4JTKA 1TIWA 2V3GA 4E8GA 2ZC8A 4J9MA 2F84A 3V0UA 3AJXA 1VCVA 1IQ8A 4B5UA 3IRDA 1GYMA 4MADA 3SB0A 4NJKA 2RHGA 4FNUA 1UH3A 3W6LA 3R1ZA 3W7KA 2RDIA 4DIAA 5AHEA 1LQ0A 2FB2A 4YNGA 4HQVA 1ONRA 5I5RA 4AHOA 3IIOA 3I3DA 4EAMA 3FOKA 3BQ2A 4ACZB 1TA3A 3NQ7A 4YYFA 1EP1A 2I57A 3S4TA 2ZZ2A 3EWWA 4IR1A 3MUIA 4ENLA 5AC4A 3N73A 2WZMA 3AU2A 5KFHA 4GQGA 3MWAA 1WKYA 1ISVA 3C2EA 4IICA 3QR0A 1XBXA 4D6JA 3LTSA 3GC5A 1POKA 3B9AA 2W5FA 4EXQA 4CNOA 5C71A 4LSBA 3XIMA 3L4XA 2DPIA 2OGYA 4Q8TA 3TW9A 3PC0A 1JPMA 1H4PA 4W7WA 3UERA 4RKAA 4PUJA 1Q6EA 3EX3A 4FLOA 3QZ7A 3PUGA 3PZUA 1QOPA 4NX5A 4N4PA 2VO5A 5HANA 4F40A 2QMKA 4AZCB 2VM8A 1A5MC 3PR2A 4RE3A 2ICSA 4FOJA 3C3UA 3NSNA 1WDQA 3SQLA 2GVLA 5KZ6A 2DSUA 4CU7A 3MTWA 3QOMA 3N11A 3WY1A 3R8GA 4I9AA 2C0AA 4MWAD 2BY0A 1TV5A 3W1RA 1YPIA 2QAPA 3TC6A 4GIRA 4QFUA 1PYMA 1EJXC 4K3ZA 1ONEA 5CEWA 4JIHA 4ATLA 5DMMA 1QPRA 2YL5A 2NUYA 3TTEA 3PULA 4Q4QA 1DIKA 4NRRA 4ZXLA 1YX1A 4GKLA 5JH2A 2NQHA 1SR0A 3VDGA 2NX1A 3LPGA 3FNDA 1P6WA 3S6OA 5H8UA 4HYKA 5CPNA 4DRSA 1REQB 2ATMA 2X0HA 3LA4A 1R8LA 1TREA 4AIEA 1TE1A 2NUWA 4KF1A 1X38A 2ZA3A 1XGEA 3TC3A 1Q5MA 4JEJA 3CHEA 1C7SA 2WMIA 3P84A 1ITQA 1YW1A 5HXMA 2A0NA 3EOEA 2O9OA 3LRLA 1LWJA 4RU9A 1YKWA 4FK9A 4L65A 3BXWA 3NGJA 2GSHA 5FEWA 3NZPA 3HGRA 4IWWA 3QGAC 4CCEA 2NXHA 1KB3A 3P80A 3EXTA 2I9UA 5LNUA 4CNTA 2HS6A 2JALA 1Q85A 1OY0A 2GYIA 1FWGC 5I03A 4PTWA 3CM4A 4H4IA 3FYYA 5DMYA 2BMBA 1TO3A 4HPXA 4RUBA 1D8WA 1SR9A 2BOEX 2OSYA 3NQCA 4ZOAA 5CPOA 4B2DD 4XK2A 1F07A 1IHIA 1WE5A 3UWYA 4E3TA 5D4YA 1QJWA 2ZXQA 4UTMA 3NQMA 5GNXA 2FLLA 3N1AA 3VTRA 1CDGA 2ZDSA 3UR7A 4LNYA 4IPLA 1KFWA 2EAWA 1PWMA 2E5CA 2Y4SA 4J7RA 4D71A 1IT0A 4G7FA 3OLGA 2QDEA 1QPOA 1ISZA 2A5HA 1J0KA 3M4HA 4RW5A 4S38A 5C9XA 4GBUA 3RAOA 3UF9A 3SN1A 2D69A 1SVDA 1H41A 3MO7A 1R6WA 1UA3A 1J96A 3HGOA 2AGOA 3W7HA 1NWSA 3N2MA 3BK0A 4U33A 1ZSXA 1W1YA 2E9MA 1P7TA 3OQ8A 2BODX 1CEOA 3OVRA 4EF8A 1NH6A 3S6TA 4EX4A 3II1A 3NPUA 4MY9A 3NR0A 2XGZA 1VIZA 1B9ZA 2ON3A 3OYXA 4JX4A 3WH5A 3K5XA 1FCBA 5A6TC 4AXKA 1RCOB 2NLIA 1XPYA 3EB3A 4YCPA 3ABQA 4ZO6A 2O7QA 3CEPA 3AAMA 4DAIA 4IIFA 3M5YA 4B4FA 4TMBA 1UP3A 4O0QA 3WSUA 1OIMA 1F3TA 4Q7BA 1XXXA 4HBKA 4HGXA 5U7SA 1E4NA 1OIFA 1L0PA 1HJWA 5GNZA 3A64A 3VE9A 4TXEA 4ECQA 1GQIA 2VZSA 2D73A 3F4DA 4GPNA 1RA0A 4GGHA 3GIMA 2HS8A 1H1YA 1V51A 1J0ZA 2ZZ3A 3WDIA 4QR6A 3UQNA 3GIPA 1LZOA 3VIHA 1H7PA 2G3MA 3SGUA 1XIJA 3S83A 1ZJAA 3CL7A 1EOKA 2VD8A 1W2VA 3VCRA 1NP2A 3ABSA 1L2UA 4HNVA 5DGBA 1KXQA 4N02A 5HPCA 9XIMA 5AOUA 1XQKA 1UG6A 4ZQCA 5JIWA 1RBLA 3TV8A 4E2DA 3SY5A 3K1GA 3PB2A 1TUFA 4UZSA 1BVWA 8XIAA 3VDHA 3S2CA 4U2ZA 4IH3A 4OBRA 2NWSA 1TWSA 3HURA 4P8XA 2VA3A 4AY1A 2YL6A 3C61A 1G4PA 2E5DA 4DI8A 5I24A 1W9VA 2WZHA 3PFMA 3DYMA 4S3BA 4F0MA 5I09A 1DJNA 4S3GA 3CQ0A 2PDPA 1LRQA 1DQWA 2PTZA 1XBYA 1UP0A 1T40A 2PEVA 1WKFA 3ZT7A 3H6OA 4O18A 2DZTA 3K30A 3MWCA 1OD8A 5I77A 1IZJA 1GQKA 3K8LA 1D7KA 1TX2A 4M19A 2Z27A 3EWZA 1W1TA 2DQXA 3LX9A 4AHQA 3T0CA 4J1OA 4AX6A 5A8OA 1QI0A 3IJDA 2OX4A 4HNNA 2L5HA 2Q8ZA 1NJJA 9RUBA 3MVTA 2QF7A 3PNZA 4V15A 2QCEA 1H51A 3AYSA 1OJXA 3W7JA 3UR2A 1RCQA 3STCA 5I06A 1HJQA 4I8DA 3G3MA 1H7NA 2PE4A 2I5GA 3B9DA 4GI8A 4C6JA 5BXSA 1V02E 4ADTA 1JZ6A 3FDGA 4G1NA 1W9UA 3PG8A 1LUCA 1EJSC 4JQ2A 1C29A 3CB8A 3RCNA 4L1GA 1HO4A 4O14A 1E43A 3VYLA 2YXXA 1GJWA 4BKNA 2JBMA 3M9NB 1KQYA 3N9SA 1K1QA 2HRWA 1X1NA 1KBKA 3UGVA 5EA9A 4B3LA 1S3TC 1VHNA 3VC5A 2VC7A 3H4DA 5JH1A 4DNHA 2FIQA 1JD9A 1TJ0A 1KBJA 1PS9A 7A3HA 1DHKA 1DQXA 4GJ1A 2QCLA 5T8GA 2BDQA 4GXPA 3GW3A 2E8ZA 3APYA 4IP5A 5L1LA 2OT1A 4GFSA 7XIMA 2NXGA 3CZ8A 2ZQ0A 1Z9AA 3AWNA 5C2GA 4JNZA 5FEZA 1GPWA 4G9PA 2NVDA 1W3TA 1MUWA 4MUZA 4WSJA 1H7XA 4RUAA 3HV8A 1HL2A 2J78A 2QXWA 6ENLA 5K2ZA 8RUCA 5E0CA 4EF9A 1KCZA 4C6QA 1HIZA 2Y85A 1DPMA 4H9UA 5FEXA 2QAFA 4U10A 2A7NA 1IXOA 4IHCA 2XDFA 2AKZA 4YLWA 1OFEA 3SBFA 3NO3A 1SO4A 2R8IA 1JXJA 2HQAA 3T8LA 4FNRA 5FKYA 1B90A 4FS2A 1C93A 4JN8A 3E2RA 1GWJA 2FTWA 2JGQA 4ECYA 1HW6A 5HNTA 4DAFA 5IHSA 1UD8A 1AL7A 3OW1A 3L0KA 1A5KC 3WMCA 4I9JA 2AL2A 3W70A 1W3HA 5HNUA 1UIOA 3ECQA 2E6AA 5EMLA 1X96A 2IPGA 3LHZA 4QS5A 2C6QA 1JL8A 4GO9A 4JN7A 5BXRA 2BY1A 3HTWA 3KCLA 3AOFA 1UWUA 1ISWA 2VWTA 3PUDA 2OU4A 1D3CA 1CZ1A 4J9RA 2GLKA 2XCPA 2C79A 2DZVA 2OZ3A 2X1RA 1VBJA 4WKHA 2YIHA 3NQBA 3HPZA 1E1CB 4DJEA 1QXLA 3WLLA 3BZJA 3P8JA 4C6NA 4PH6A 2XU2A 1ZP4A 2YB1A 4DL7A 1E55A 2XISA 4PCFA 2NUXA 4L4MA 2PRMA 1XIEA 5KZDA 4NY2A 1EWEA 5CKSA 1EBHA 1HXJA 3MP4A 3IWPA 1C9WA 1QPKA 1EA0A 1E72M 2BGSA 4XTDA 3WD1A 4J2MA 2PDCA 3PPGA 4ROPA 4YTRA 3TN3A 4LUYA 3VIFA 2QVHA 1DWIM 4ED6A 1FHDA 2X42A 3V18A 3SI8A 3GYCA 4JTCA 3WLSA 5BZAA 4GZEA 1DWJM 1JI2A 1UUOA 3PAOA 4JX6A 3O6YX 4PMJA 3PPCA 3DBNA 4N42A 3SCOA 1PZ3A 4OBSA 4B4HA 1FDYA 1B2YA 4W88A 1IGWA 2AQWA 2J7FA 4GXWA 2CERA 5HUPA 1BTMA 3RU8X 5A6BA 2HK0A 2WJZA 4DXVA 3TUUA 3CIXA 3LB0A 1O5XA 3MC5A 1TCDA 4UIOA 3OLIA 3E1F1 4ZTYA 5KFIA 4WCJA 5C2XA 5DCEA 4IGSA 1TV8A 3KBMA 1G94A 2VENA 2VFEA 1U83A 1EF2A 2CIPA 4TVUA 1H0GA 3KTXA 2PDUA 3P93A 3GE7A 1UR2A 1NF7A 3N6HA 4C90A 3SECA 4TOQA 4G6CA 4Z0JA 1DVJA 4DPPA 2P3EA 3EA3A 3ORWA 2Y8UA 3O05A 6XIAA 4GYPC 4BJHA 2WHMA 2YCEA 1BPLB 4A8NA 1FA2A 5MKGB 2DZSA 2WLZA 3H21A 1ESWA 2C2EA 3REQB 5EMYA 1IZCA 5DFAA 3STFA 3PJWA 3NSXA 5AHLA 3R8HA 2WSQA 3QQ1A 3EKZA 5IM51 3WLTA 4R34A 2CLPA 4CVUA 2IXVA 3GH5A 3PJTA 3PS7A 3GM8A 2DZUA 4S3EA 3TLQA 3A3HA 3COTA 4YPJA 3DFNA 3CS2A 4I7VA 4EP8C 1QBBA 4WXYA 2DFAA 1LP6A 3UZZA 3JUGA 4UNKA 2GK1A 3JW7A 4ZQRA 3WQOA 2EGZA 2R1LA 1WUEA 4N9CA 3CUJA 2E6FA 4XKYB 1P43A 3N2OA 3SM0A 1K7FA 2EG8A 1W5MA 3HIJA 2QCDA 2PWVA 4E4FA 1GOIA 3EXRA 1EXPA 1O5RA 4ECUA 1XP3A 3QY8A 4XO7A 1RALA 1E3XA 4D6CA 4HNCA 2PP1A 1WAWA 4LX4A 5DY2A 3EBVA 4PUWA 4A6GA 2D2JA 4JFVA 1UR1A 3OZMA 3WO8A 3ZOAA 3PVXA 2WSRA 5GPRA 4CGTA 4RZ5A 4QW9A 4IGMA 3B9NA 5BU6A 3A9BA 3SI9A 2QJJA 3GNDA 3W2MA 1W3LA 4LVAA 2J88A 4EIVA 2QGYA 4FF5A 2CYGA 1S5WA 3T4CA 1FKXA 4ERIA 2XH0A 4HNTA 3GIIA 1I75A 3C0SA 1W1VA 3M43A 5FF4A 1V4YA 3CV1A 4UWMA 4LVBA 4QX4A 4O12A 1UR4A 1FWIC 2FB3A 4IL0A 4JICA 1IE7C 2FMNA 4DQWA 4XO6A 5AKQA 3VXGA 3KHDA 3PTMA 3PB0A 3WLKX 4M6VA 4O54A 3EPOA 2TPSA 4MF4A 1UROA 2BSLA 3FSTA 3HB9A 1JXKA 4KFPA 3M0ZA 4TQSA 1M7PA 5HWJA 4LCSA 3OU8A 4IQEA 4J4KA 5LHEA 4LUIA 1D3GA 1GOMA 4IMGA 4G3IA 2POTA 2R24A 3MV11 3W7NA 3KVMA 1FH7A 2PA6A 1VD6A 2W66A 1PV8A 2AQOA 4UFJA 1SSDA 3W7RA 3SCNA 5D09A 3MFIA 2OB3A 1W9PA 2VQUA 1DKWA 2WM1A 3K4WA 1GVFA 5HQLA 2D3NA 1XW8A 5M2FX 3F4CA 2IPFA 6REQB 4QJ5B 5DG8A 1H60A 4IRDA 4FNPA 4W8BA 3ITYA 1EB3A 4WDUA 4D8LA 1GVRA 2PLJA 3AQUA 2FGLA 3FJNA 1OCBA 2BQRA 1FWCC 4KW2A 3KOZA 4JY9A 3ITVA 3L0NA 1AQMA 3BQ5A 3N13A 3BLPX 4LVDA 3WNKA 1BQCA 3NZ1A 3QFWA 3UXLA 1H11A 4FAMA 2OSXA 3W7GA 1GONA 4KETA 3MY9A 4INFA 3MVIA 4RZRA 4CUCA 3NPWA 3QC0A 4ZXOA 3PF3A 4L6OA 2BXVA 1TRDA 3HFYA 3LI1A 3KTCA 1DE6A 2YX0A 3GVWA 4QDMA 4QTGA 3T5LA 2WW5A 1WKDA 3GRIA 1GHRA 5D33A 1YADA 1FHLA 3F4VA 2C1IA 4LYRA 3DX5A 2XSAA 4C91A 5DCBA 4DJFC 5KFLA 3WQEA 1UUQA 1I2PA 2C1GA 3UA4A 4POCA 3QYSA 2Q09A 3A12A 3WQ4A 2OFJA 3M0HA 2WPBA 4AX7A 1JEZA 3T0DA 1OFOA 1T99A 4LT9A 1QW7A 4FLSA 4Q45A 3ZVHB 1KM6A 3WLOA 3TAKA 3W00A 3VOHA 3PW0A 2PLCA 3E12A 1K03A 2REQB 1UB3A 3AMKA 2WWDA 2YW4A 1E5JA 4IF2A 4C1NA 4LEFA 3WEOA 3KCJA 3EPGA 1XSIA 4AZ7A 1SJBA 4PMUA 2GUBA 5HPOA 4O3SA 2R1NA 1BGAA 3T78A 4IP4A 5LGZA 5I7GA 2DVTA 5D05A 1IT7A 4PMNA 2Y7GA 2Y70A 2GL5A 3PR4A 1SFJA 2IMWP 3Q58A 5GJPA 3MI6A 2P8CA 2WTFA 1LBLA 5AVHA 1SZNA 3IPWA 5C6MA 1S2TA 3WX7A 3EKLA 2OZTA 1J18A 1WYIA 3BLKA 1MW1A 1M7OA 4DWSA 3LXAA 2IKIA 3TEVA 1A49A 2OH2A 1MQQA 5DQPA 4PC8A 2V5KA 1OGG<