1PO9A

Crytsal structure of isoaspartyl dipeptidase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
388
structure length
372
Chain Sequence
MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Isoaspartyl dipeptidase
publication title X-ray structure of isoaspartyl dipeptidase from E.coli: a dinuclear zinc peptidase evolved from amidohydrolases.
pubmed doi rcsb
total genus 128
structure length 372
sequence length 388
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1po9A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1po9A02
1UIOA 3UPMA 4EP8C 5E5CA 4P5UA 3AU2A 3D6NA 2Z26A 2EG6A 2HPIA 2VC7A 4G2DA 2HBXA 4DZIA 1NFGA 2FTWA 4KEZA 3LSCA 3T8LA 2QT3A 4LEFA 4KQNA 3MDWA 1ONXA 4DLFA 1JGMA 4BKNA 2CZVA 2OGJA 4WVXA 1KCXA 4R88A 3OU8A 4C6CA 4IFRA 3GTIA 1YIXA 3GU9A 4DZHA 4PCPA 2Z00A 4DIAA 4H9VA 3TN5A 2BGNE 3MKVA 4C5ZA 1I0DA 3UR5A 2YZ5A 1FWGC 2YB1A 4HA0A 4MUPA 3DUGA 4F0SA 1V4YA 4C6QA 1NDVA 3GTFA 4XD3A 1KRAC 4BJHA 4RZBA 2GZXA 4GY1A 3GU2A 4EPBC 5HMFA 4ERAA 3HPAA 1YRRA 4QS6A 1P6CA 4UB9A 3KM8A 1UBPC 4C6MA 3TN3A 2AQVA 1RJQA 3MDUA 3GG7A 3OOQA 3TNBA 1GKPA 4IH3A 4V1XA 1A5KC 4H01A 2OOFA 4EPKA 2F6KA 3T81A 4KESA 4V1YA 3DC8A 2Z29A 3MVIA 4IG2A 2DVUA 1R9YA 3UBPC 3R0DA 3GTHA 4B3ZA 4KEUA 3K4WA 4GK8A 4KEVA 2R1KA 1GKRA 2EG8A 3S2LA 2AQOA 2AMXA 2D2GA 4GYFA 1YBQA 4XAYA 3S4TA 4LCSA 2PGRA 4XD4A 4PE8A 3DCPA 3PNZA 1FWBC 4H9ZA 1V51A 1KRCC 3JZEA 3QGAC 4LANA 4J35A 1XWYA 3GGMA 3C86A 4PCNA 3TN6A 3WMLA 4LCQA 4DI8A 3IRSA 4GY0A 1FWFC 1VFLA 3LGGA 1A5MC 1A5OC 3G77A 4XAGA 3FEQA 1A4MA 3A3XA 1RK5A 2I9UA 3LGDA 2ZC1A 2E25A 3MPGA 1J5SA 5CH9A 1P1MA 1XRTA 2ANUA 3LA4A 4E3TA 3B40A 1K70A 3NURA 3OQEA 3RN6A 1W1IE 2VM8A 4H9XA 2FVKA 2HBVA 1O5RA 1K1DA 3CJPA 3CAKA 1EJTC 4H9YA 1K6WA 1RK6A 2Z25A 3T1GA 3GUWA 2QVNA 1FWHC 1P6BA 4CQBA 3SO7A 4C6EA 4C65A 4XD5A 4I6VA 3IGHX 3S2NA 3UF9A 4OFCA 2HNHA 3WYZA 4DO7A 2Z7GA 4J2MA 4EPDC 4C6LA 2Q01A 1BF6A 3RHGA 2GOKA 2KAUC 1ADDA 3F2DA 4AC7C 4GX8A 3AUOA 4KETA 1J79A 1EJSC 4GBDA 2WJEA 2YXOA 1PB0A 4HK6A 4QS5A 3A3WA 1ITQA 3GTXA 2IMRA 2R1LA 3QGKC 2WM1A 1FWEC 4GY7A 4RDYA 2RAGA 4D8LA 4C6FA 2HPMA 2Z4GA 1FWJC 3GIPA 4XAZA 2P53A 4XAFA 4B90A 4C6NA 4XD6A 3E38A 2Z2AA 4DNMA 4C6DA 3S2JA 4C6BA 3E0FA 2OB3A 1ONWA 3A4JA 3LSBA 4YIWA 1ITUA 3LS9A 1A5NC 1HZYA 4CQDA 1M65A 2Z27A 3EWCA 2GWGA 4G7EB 4LFYA 3HTWA 3IPWA 3RYSA 3O7UA 3NEHA 3QY8A 2W9MA 1E9YB 3PBMA 1J6PA 4CNSA 2Y1HA 3ID7A 1KRMA 1J6OA 4WGXA 2PAJA 4C6JA 3FDKA 4GZ7A 1YMYA 3NQBA 2FVMA 2GWNA 4QSFA 3GU1A 4QTGA 1EZ2A 5G4HC 2GSEA 1M68A 4IQJA 2E1WA 2O4QA 4LH8A 4GX9A 1A4LA 1WXZA 4BY3A 1XRFA 1A5LC 2R1MA 4IF2A 1EYWA 2UZ9A 1FWAC 4QROA 4ZSUA 4H9TA 4B91A 2I5GA 4CEUC 3URNA 1QW7A 3LNPA 3URAA 2YB4A 4AQLA 1RA0A 4IFKB 3LU2A 3E74A 3OODA 4R7WA 3MTWA 2Q09A 4PBFA 2ADAA 3N2CA 2ICSA 3MJMA 1M7JA 2R1PA 2P50A 3PAOA 2FFIA 3AU6A 3QY6A 4NG3A 4ZSTA 3HM7A 3LY0A 4C6OA 4Z42C 4HK7A 1POKA 1EF2A 1FKXA 1UMLA 2P9BA 3GIQA 2Z24A 4H9MA 2D2JA 2Z28A 4C6IA 2QPXA 4UBPC 3O0FA 3BE7A 2O4MA 4GXWA 4TQTA 3F4DA 3CS2A 2EG7A 3FDGA 4IFOA 4PBEA 1RJRA 3F2CA 3F2BA 3RCMA 1PTAA 4CNTA 3IACA 3MVTA 4CNUA 1NDWA 4IGNA 1PSCA 4NP7A 3B0XA 4JOMA 4ICMA 1KRBC 4RE0A 2XIOA 5A6TC 2VHLA 4I6KA 4C60A 3K5XA 3V7PA 1E9ZB 2VUNA 2D2HA 3QY7A 2DVXA 1PO9A 4QRNA 1R9ZA 4ERGA 3OVGA 1POJA 5HMDA 4HJWA 3URBA 4RDVA 2OQLA 4L6DA 3F4CA 1UIPA 1XGEA 3ISIX 4RDWA 2A3LA 4LAOA 3E3HA 4INFA 4C6KA 1EJWC 2PGFA 3PNUA 1EJXC 1QXLA 3URQA 4KIRA 3PANA 3B0YA 1V7AA 2WJDA 4G7EA 2G3FA 4ERIA 4L9XA 4NI8A 4DLMA 1FWIC 5FSDC 4R85A 3EWDA 4IG2B 3IARA 3GRIA 4C5YA 1EJUC 1S3TC 4F0LA 1NDZA 3IJ6A 3UR2A 3E0LA 1IE7C 4KF1A 3SFWA 2HQAA 1V79A 5HMEA 5AKQA 4LCRA 3ITCA 4RDZA 3TN4A 2Z2BA 4HK5A 5FSEC 1YBQB 1R9XA 1V77A 1FWDC 4DYKA 2OODA 1EJVC 2VC5A 4EPEC 3ORWA 4GC3A 5LXXA 2BB0A 4WHBA 4C6PA 1RA5A 2VR2A 1EJRC 4LAMA 4CQCA 4KERA 2DVTA 4LALA 4LAKA 1RJPA 1GKQA 4H9UA 3S2MA 1WXYA 3EGJA 1NDYA 1O12A 4B92A 4M51A 4IFKA 1I0BA 4H00A 3OJGA 4J5NA 2WJFA 3K2GA 1DPMA 1FKWA 4F0RA 1FWCC 3IV8A 3E2VA 2UBPC 1ZZMA 3ICJA 1YNYA 3MSRA 2FTYA 4GOAA 4IGMA 1RAKA 2PLMA 2PUZA 4CEXC 3WZ0E 2R1NA 4DI9A 2QS8A
chains in the Genus database with same CATH superfamily
1VFTA 3U3HA 3GDBA 3PPHA 4R5EA 2AL1A 1OYBA 4HZ7A 5DBUA 4IX2A 2O9TA 1L8PA 3LSCA 2CBVA 3IUDA 4CCDA 3ZOAA 1KQZA 2BHYA 1JCTA 4W93A 4DLFA 2A6NA 4L9ZA 4US5D 2I56A 1AH3A 4C6CA 4EXQA 5CC7A 3Q2DA 5E70A 3WDIA 3VKDA 3G5EA 2O7QA 1KWKA 2VDHA 2ZZ2A 2OLHA 1XIHA 5F2GA 3B8VA 3WF0A 3WF1A 4D6DA 1MFUA 4PUNA 3PUEA 4V28A 1V03A 2BS9A 5F1UA 3UZJA 3RX4A 5AC8A 1ICSA 1B3ZA 5DMYA 5BXRA 1OC5A 3TN3A 5MF5A 3EDJA 4KW2A 4R33A 1K9DA 1GKPA 2OEMA 3M5XA 3QW3A 2ASJA 1KNWA 1KXHA 4A35A 3Q65A 4PMXA 3GXDA 4O3PA 2AGPA 2QCHA 1Q66A 3QKZA 1HGYA 4FS2A 1BSIA 4H8HA 2R1KA 1ZQ5A 2C19A 1L9WA 3R79A 2Y8UA 4LCSA 4AWEA 2OEKA 1IZKA 1JIBA 3ITOA 3SY5A 2BODX 1QMLA 3DCPA 1O1HA 4GUJA 3HGRA 3U6WA 1FDYA 4FBTA 2C79A 4FS1A 1WDSA 1UJPA 1YDNA 5D30A 3MSYA 2XIIA 4W8BA 4W86A 3WLIA 1TKKA 2XG9A 1XLGA 4DF0A 4JPGA 1R3TA 1OX4B 1B30A 1XRTA 2OZ0A 3N6JA 1C9DA 3O0KA 1R47A 1N8IA 3OVPA 2YFNA 3BOFA 3FX4A 1I2QA 3L4XA 4B5NA 3CAKA 4H9YA 4FNQA 4PYSA 2QYGA 3VDCA 2Z25A 2QVNA 1J93A 5KFLA 1OQFA 4I5RA 4LSBA 3L4VA 2OWXA 1BSLA 4JFWA 2BZNA 3SQLA 4AAJA 4C90A 2D0HA 3VKAA 4R7JA 1QTWA 3C8NA 2YXOA 4D6CA 4HTBA 4XKYA 3TKFA 4QS5A 1M7OA 2YDRA 3EMZA 4O3NA 3BLOA 3R10A 5I07A 1XLMA 1KD0A 3OSPA 4KFPA 4KWOA 1CGUA 4MDPA 2CLLA 3GR8A 1W9BM 2ZC8A 5EB8A 1AQFA 3UZWA 4HA4A 3UPWA 1QOPA 4UTIA 1PDZA 1BYCA 1BHGA 3UYIA 2G37A 3VPLA 2X2YA 4JL2A 4KGLA 3K8KA 1NIUA 2XFWA 3RYSA 2WC4A 3E5BA 4CQ8A 2NZLA 3GNDA 3VCRA 2DQXA 1RCQA 2C13A 3LHYA 2BXYA 3R1ZA 3BQ0A 1OY0A 2FFCA 5KZEA 4UTKA 1R5YA 1Q6QA 3L5LA 1RLCL 3VKKA 2J6SA 2BBFA 3PZPA 2WKGA 3SW6A 5TAOA 1OBAA 1I1XA 3NWRA 5I5RA 1PBGA 1A5LC 3W29A 1EYWA 4JNYA 1DKWA 2RFGA 2GK1A 5HQMA 5KG2A 4BCEA 4BI5A 1VBHA 2G3MA 2V5DA 3WNMA 3IWPA 3PBUA 4EEYA 5KFUA 4FR1A 1EDQA 2EKGA 3OODA 2ZTJA 1LRQA 1OFAA 1GCYA 2QF8A 1NVMA 4RJEA 2Y7DA 4ECLA 4LUTB 4ZSTA 3LQGA 1O94A 3KCLA 4JX4A 1H09A 3UG4A 5HJXA 3GXPA 3PZ9A 3K1DA 4W5ZA 1JULA 3PSVA 2O4MA 5T9BG 4MWAD 2C14A 5G2WA 5I00A 2YCIX 4IFOA 3F2CA 4MAVA 3P14A 4B15A 4MFDA 2MANA 3EXTA 2X1TA 1W9UA 3STPA 1U1HA 4A8IA 3KTCA 5XIAA 3APGA 4GUHA 2CLFA 3W27A 3S1XA 2BQRA 3FHQA 4YVXA 4QR6A 1MUCA 3RUBL 2XM2A 1SJDA 3CO8A 5D04C 3WNNA 2X7VA 5CKSA 1XLEA 4TTUA 4DN1A 1ZJHA 4LAOA 1OC7A 2FHFA 1E4LA 5I3GA 2YW3A 5A8OA 3M0IA 3QBUA 2VEPA 4RZ6A 3QPYA 1TFVA 3G6MA 3WY1A 4JQ1A 2WJDA 4AHPA 1RPXA 3OB8A 3VIOA 3G6VA 3NXLA 3TJLA 5DMNA 4P7NA 4AEFA 4JY8A 3KE0A 3GLCA 3QM3A 3IJ6A 1PTGA 4D8ZA 4K6AA 5DY2A 4DM1A 2E09A 1ISZA 3H2NA 2P3ZA 3S1GA 5FSEC 3AROA 1PHQA 4WSJA 1FWDC 2XN1A 4G56A 4E8GA 4YYCA 1Q7ZA 1AQHA 3W1XA 4DVOA 4XKMA 3SGUA 4F4YA 2ZX7A 3D3FA 3DFQA 2XFRA 3B05A 4LQ1A 2REQA 1FA2A 2GQAA 3S2MA 1VLWA 5A2BA 3CV7A 4A3HA 4M51A 4I8DA 2X09A 3GX9A 5H8PA 4U2YA 1VYPX 3GHUA 4GA8A 7A3HA 1ZB5A 2Y8VA 3IJ9A 4XSMA 3FXGA 1HG3A 1GZJA 2F6UA 3A6OA 3NZGA 4WSKA 2BNJA 2ISFA 4M1RA 2PZNA 3CIWA 4FR6A 4J9KA 1TR1A 2OLAA 4ZO8A 1QOQA 3GQCA 2P76A 5E5CA 3W4RA 3M9NB 4U28A 3G8EA 3S1UA 3C3UA 4AEEA 5JUMA 4FP1A 1UH2A 1RH9A 2QIIA 2F6XA 1N8WA 1ZUAX 1T40A 1C90A 1XG3A 2X41A 4GMEA 2CZVA 4JTGA 1KCXA 2YFOA 4R88A 1NARA 4PCSA 3LBOA 3C52A 4P61A 1UUMA 4OU1A 3A22A 1UMYA 3W7NA 3FLUA 2Z00A 3W73A 5TF0A 3FN9A 1YW1A 3QTGA 4H9VA 4Q4MA 2B31A 2ASHA 1XLHA 3DI1A 2QCCA 4ECSA 2ZZ4A 4OUEA 4OT7A 1XPGA 3O06A 4CCCA 2E40A 4X60A 4RZBA 2GZXA 4GY1A 4OV4A 3PP7A 4PRTA 2ZE0A 2Y61A 1EQPA 4HZ8A 4QS6A 2HZGA 4JIQA 1MZHA 2GFTA 3TX9A 3SZ8A 1P0DA 1BRLA 1XQLA 4Q4OA 1I1WA 3HV8A 3M6DA 4L4PA 1QI4A 1E40A 1X96A 1TTJA 3CTTA 1OCJA 3H2AA 1UQZA 4DWSB 4WKAA 2EQDA 2QUUA 4XZ9A 3R5EA 1E0UA 2CZFA 3RPMA 4DL4A 4GO9A 3M16A 4TU1A 3PB2A 4I7UA 4AG0A 4X9YA 3CAVA 3L66A 3B9DA 1WV2A 4GNJA 6XIMA 4E8CA 4TUFA 4FX8A 1W3TA 1LCOA 2XZ9A 2G8ZA 1QW8A 1D7KA 5FJIA 2VGGA 5D32A 3GVRA 1H49A 3FKRA 3L5MA 3UVIA 1XLCA 4G1NA 1IF2A 5LIWX 1TPB1 4Y9NA 3IJ8A 1O95A 2CYGA 3UXKA 4EKJA 3LGDA 4O3OA 4ROQA 2GGEA 1WXJA 1HL2A 3MUY1 2RJGA 2SFPA 4AWTA 3UJ2A 3VUSA 5KG4A 2J9XA 2Y88A 1NFBA 2BFGA 5T9CE 1K1DA 3W0KA 4J27A 4FNRA 3P67A 3SSJA 3T1GA 3GUWA 5LA2A 4EACA 3F5LA 3NVDA 1RSCA 4DJFA 2VC9A 4HPXA 4W5UA 3ES8A 3GDTA 1I2OA 3WDHA 3RO6A 4DZ5A 1EPVA 2FLNA 2E6FA 1QFEA 4LYPA 4M6PA 3U0HA 5KFAA 1GYLA 3GG1A 1J79A 4A8RA 2CLIA 3PAJA 1E1CB 2WJEA 3IIOA 3BDKA 3A3WA 4F8XA 1F6PA 1XLIA 3DN5A 4HSHA 3LDVA 2FTPA 2H8ZA 3TA6A 4V33A 4KGJA 2HPMA 1TCMA 2FHBA 3ZO9A 3R25A 1TJ2A 3UWQA 3XISA 2QV5A 1G94A 3IJ7A 5C7HA 5KT3A 1Q6EA 5D2YA 4QGCA 4YJ5A 1AW5A 5HUPA 4UFLA 2OX1A 3BAKA 6REQA 3B06A 1VBUA 3PBVA 3UG8A 2YXGA 4JTCA 5C6MA 5F9LA 4W87A 4R9XA 1WYIA 3RLGA 2QLYA 1IIHA 4W4QA 5KFMA 4N7QA 4Q8UA 3DXIA 3SECA 1B3XA 1QATA 4LH8A 2DU2A 4J3XA 3UJFA 5ABEA 3ZT6A 4AD5A 1SJCA 4Q4SA 3B4UA 4GIYA 5BXTA 1P1XA 2I5GA 2FYMA 2PZ0A 4EWJA 3BZJA 3NSMA 4WD0A 2DY3A 1ZRQA 1UR1A 3LNPA 1CGVA 3ZMRA 5A69A 1Q13A 4AQLA 4NXKA 4DNHA 4KMQA 2YCLB 1KGWA 1KO0A 5KG5A 1UR9A 1UWRA 2JEQA 3BJSA 3K4AA 5KG1A 1E6QM 1DJXA 2FZNA 3WQDA 5T8GA 5CPOA 1X38A 4NAEB 1VBRA 3LQLA 4Q22A 4N4PA 1TWDA 4GH3A 4YVVA 3EA1A 3GSMA 3CS2A 2CERA 1HKJA 4JTKA 1KCLA 3MVTA 3GHTA 3BK0A 4Z2HA 1IWPA 3FVMA 8XIAA 3NGFA 4X2PA 1LQ0A 5D37A 3DFPA 5JMUA 3R7MA 3WQ4A 1UR8A 1HGWA 1GQIA 4MG4A 3A21A 3OVGA 4LEQA 3URBA 4DL5A 1Z8AA 3V75A 4B5TA 4AX6A 3IGUA 4RDWA 3BOXA 1PIGA 4KFNA 1OK6A 3CEUA 4F79A 1L6SA 3A4XA 1M41A 3NAVA 1PCWA 1KTCA 1TA3B 3T7VA 1V7AA 4MPKA 5D05A 3AXHA 4FZIA 4J2PA 3W07A 3W53A 2ASLA 3BJYA 3SCTA 4TXEA 3CPRA 2GVEA 2VTFA 3GRIA 2Q8LA 1V5XA 2EPOA 4IM4A 4HD5A 1KTBA 2DUAA 4AIUA 5AKQA 1IEWA 1H7OA 3I4EA 1XYFA 5ABHA 3G1SA 2ATLA 2Y89A 4CU7A 4WHBA 1E5JA 2Y85A 3GAKA 3VO0A 5EPDA 1O68A 3NL5A 4UOJA 5A3HA 3EWBX 4LALA 4DUVA 1ZCCA 1M01A 4B5VA 2XVGA 1OABA 4DF2A 5AHMA 1CXHA 4M6VA 3C2YA 3M0JA 4RUCA 1WZMA 3K2GA 5F1VA 1EYEA 3FA5A 4D72A 2JGQA 4YL2A 4HN8A 1QPNA 3E2VA 4HNCA 3PPFA 2RDXA 1DEDA 4HU8A 1IM4A 1A0EA 4KCVA 3KOWA 4OHQA 3T8LA 2DSKA 4RNNA 1Z41A 1P7TB 4LEFA 3NO5A 4HT3A 1JGMA 1LUCB 2ACQA 2P0OA 3V5CA 5KFHA 3GNOA 4J40A 3CB8A 4M80A 5LZLA 3OU8A 3D5HA 1E3XA 5CPNA 2XSXA 4B5SA 1W1VA 4K1WA 5A6BA 4DIAA 2ZUTA 3C2FA 3Q8RB 1NH6A 3WD4A 3SI9A 5C9RA 3EOEA 3HV9A 1CB7B 2PDMA 2J8TA 4AISA 4O0ZA 3DBPA 4RV8A 4EPBC 1T5AA 3OLIA 4N9CA 5GJMA 3DX5A 4R8UB 1W0MA 3SURA 2NUXA 3BJTA 4JTJA 3M9OB 5M1TA 3L23A 1W3KA 1OINA 4YCPA 1JPKA 1K7XA 4JDBA 3M9YA 3UXDA 1TVLA 4DYJA 1VFMA 2VR5A 3DHFA 1ZPTA 5I3FA 3T44A 4LVBA 2W7OA 3OBEA 2OVLA 3RCYA 2V81A 3AZSA 1W9XA 1HL9A 2A5HA 3WLHA 3W7HA 2WVVA 4GGBA 4G9PA 3CAQA 1YBQA 1SZGA 2WVUA 3GTNA 4O15A 5LA0A 1EUAA 4ECZA 3AIWA 3MU7A 3VIFA 1A5BA 6PTDA 4H9ZA 3VGBA 3OSNA 1QI5A 4X9SA 4LANA 4WXYA 3N34A 5TQLA 2YOCA 3M0HA 1VFFA 2A85A 3LGGA 3KOXA 1A5OC 3AMLA 4BF5A 2E6AA 3KBWA 3EOUA 5AOUA 4JV2A 1ZALA 3MP4A 4LUYA 4QLLA 5DX7A 3R11A 4TMBA 1GJUA 4IUOA 1SMAA 3BH4A 3B8TA 2CLOA 1Z48A 4DY1A 5H8UA 1OFOA 1YPIA 1XC6A 4JEJA 3C2RA 3OIXA 3VZYA 4AX7A 1LBMA 1CPUA 4I6VA 2DFAA 3AMDA 2HNHA 1C92A 4IP7A 2J6TA 1D8CA 4C6LA 1SMDA 1BF6A 4R7OA 1AH4A 4F0KA 3F2DA 4A3QA 4UQDA 1ZJBA 1TX2A 3BG5A 3ONBA 1JAEA 2IA6A 2D20A 4BFAA 2QAFA 4GE8A 4LUIA 4G1KA 3QGKC 3MSGA 1CXLA 4WJXA 3V4BA 3RILA 2DSZA 4NY2A 3TQ1A 1HT6A 1AZ1A 3RLVA 3TTEA 5C55A 5H1WA 2RGMA 4K2SA 2V9WA 1WB0A 1UOKA 1TRIA 4N2YA 3TCSA 4DM2A 2GDVA 1HXJA 2EPHA 3KVKA 3S5YA 2QEZA 4QCFA 1LL7A 1FUYA 3PBMA 2YBUA 2Y1HA 1KRMA 2PWGA 2VR4A 2EKCA 4E3VA 3CU2A 4D6FA 4GUGA 2XIBA 1HF6A 1AK5A 1MI3A 5BRQA 3KW3A 3VD5A 3W86A 2V2CA 2DT3A 4ZB5A 1MUWA 1JUKA 1M68A 1QPRA 2C91A 2ONEA 1YXDA 4AZ6A 2W9BB 1W32A 1TJPA 2R8HA 1XH0A 2UZ9A 3AYVA 3RPTA 2DW6A 3S5NA 3KS5A 4O28A 4DO6A 4JUZA 1SO5A 2A1YA 4B5XA 1U33A 2HS8A 1RA0A 4UQ9A 3M9MB 4QG6A 4B16A 1NOFA 1IGSA 5SWUA 5T26A 1TCDA 1VP5A 1M7JA 1XIEA 4ACYA 1PPIA 1NY1A 3F4WA 3HM7A 3TAKA 4S3DA 3PPCA 1POKA 4NLGA 1UD6A 4QWEA 1GPFA 3UZXA 3IIPA 1KM0A 4DBSA 3NPXA 3U4FA 4RNJA 3PTDA 3OQ8A 3F2BA 3TC6A 1F3EA 3RCMA 1SYTA 3SM0A 3PY2A 4QLKA 3DG7A 1CZ1A 4HPJA 4E8DA 5HULA 5KT5A 3RM9A 1A53A 2WHMA 3PUOA 4K37A 3NEVA 4H2CA 4GYJA 5FJTA 1G4TA 1DXIA 3QY7A 5L6UA 1RD6A 1UBSA 4DL2A 3T2PA 1EP2A 1DXEA 5GJNA 3TYCA 3SJNA 3ME3A 5D8ZA 4G8TA 4N9BA 4YHGA 5CJNA 1RYSA 1LWJA 4QEEA 2XM1A 5BNKA 3KTSA 3W7EA 1PZ3A 2XWDA 3QC0A 4GD0A 2BY0A 2PGFA 3GIYA 2VEKA 3NSXA 4QDMA 1DQUA 4PB4A 3TTOA 1J0KA 3PFRA 3QHOA 2QQ6A 3ANUA 3T42A 3AISA 2WWCA 1S0MA 2PMQA 1VB9A 1J10A 4GXMA 1CBGA 4XISA 3B04A 2YL5A 1MVYA 4U2ZA 1QHZA 4MKSA 3SIMA 3TN4A 2EPKX 1JFXA 3EAUA 5CGQA 1H7XA 1YDYA 5J04A 3TC3A 1F8IA 1SSGA 3T40A 4HMNA 4GC3A 3R12A 3AS0A 4EF8A 3RB6A 3R0UA 1QJWA 5AYIA 5HINA 3GXMA 1UZ1A 4IFKA 3NL3A 5AVHA 4XTDA 4JTSA 3SJ3A 1BEUA 4DJEA 2YLLA 2H6RA 4UWMA 3PBWA 3TXZA 4DPPA 4K1GA 5KFCA 1E6PA 4ZO9A 4IQDA 1UWTA 1RAKA 1WCGA 3CUZA 4YTRA 4IRCA 4LYKA 3QPZA 4F2TA 1BYBA 2J9YA 1ZP4A 5HOSA 2Z1VA 4U31A 3DI0A 4GINA 4YS1A 1YPFA 4D6EA 3QR0A 4BQ4A 3BSHA 1HP5A 3VC6A 1YNQA 3CUHA 3K8MA 2VX4A 3KXQA 4NHVA 5HJYA 1BF2A 1VYSX 1AG1O 5ECVA 2POTA 2P3EA 3G1RA 4QDPA 4HSOA 3PFMA 3L2LA 1Q2RA 1A0DA 1FWGC 1NM9A 5KITA 1AODA 2OQYA 2GJXB 3G22A 4PR4A 4M1BA 3HPAA 4BF9A 3E0WA 1R38A 1YNPA 2Y5SA 5FAJA 1MQRA 4V1XA 3CYVA 5C5YA 1V08A 4JXCA 5PTDA 4ECTA 2C2EA 1C8VA 3MVIA 1QHPA 3G18A 4KEUA 3WQEA 3LYEA 2DJLA 3VD9A 1IWAA 1VR6A 1JUBA 3WELA 3VI2A 2AQOA 4S23A 2AMXA 2PGWA 3NXFA 1AQMA 2HROA 3ZLHA 3EX2A 2DT0A 2Y24A 3LXAA 3EX1A 2ZXAA 3LXCA 3SEPA 1H7NA 4IMDA 4LS2A 2QCEA 2ZXDA 1E9IA 3LTPA 3JZEA 4JX5A 5LKYA 2VYOA 3WLRA 5C2GA 5EY5A 3C86A 2PCEA 4LNYA 4LCQA 1EGMA 2FB2A 3QLLA 1UWQA 1HTIA 2OPJA 5DXYA 3LHUA 1NELA 5LHEA 1P1MA 2ANUA 2XU2A 5XINA 3IS4A 2ZKMX 2DIEA 1FWRA 3JVAA 1TMQA 3CXOA 2WLZA 2G50A 5D9NA 5GVJA 3UXAA 4UTWA 4ECQA 2G4JA 4CCEA 1MMFA 4LYRA 4ZENA 1QWKA 4UTLA 3W6MA 3CQ0A 1P6BA 4G5DA 3MUXA 3IGSA 1E6SM 4CQAA 3UF9A 2P10A 4ED2A 4AF0A 3RHGA 4Z2LA 2XWEA 4IJRA 2KAUC 5KFZA 2J78A 3MMWA 4GQGA 4IP5A 3VZXA 4CGTA 4Q8WA 3I10A 1DWGM 2J7FA 1QNOA 5M5DA 4F4XA 3OPSA 3GC2A 1HJVA 2RUSA 1HN1A 2ZX6A 5KT7A 3NQMA 3BG3A 3RDKA 3WLOA 3GVWA 3BWWA 4LOCA 4OJYA 4RDYA 4DEFA 5HBFA 3T5LA 4NX0A 5AHLA 4XAFA 3LNMA 5FOOA 1EXPA 4C6DA 2J47A 5IHSA 3BZGA 4UFHA 1M65A 4NAFB 3RBDA 4QISA 1RR2A 1GTEA 4KBXA 2WV8A 2BLEA 1HFBA 4QWCA 2OXNA 1WUEA 2ZZ3A 3KCOA 3PZGA 3E2RA 3MYPA 1ZETA 3BPWA 3R2GA 2WOQA 2PTXA 3S1WA 3KEHA 3LEPA 3SB0A 3ZQ9A 1F6YA 2E5BA 1Z44A 4GC4A 2IPFA 2BQ3A 2TYSA 4ZOEA 4RUAA 4H04A 5C2XA 2PA6A 1KV8A 3F5JA 1B90A 4CEUC 1GG0A 2F38A 2WQDA 3NZ1A 3W72A 2GQ3A 1K9EA 2PF8A 4H6QA 5KFIA 4CCZA 3PHAA 4MFEA 4UUIA 4HCHA 3CWNA 3TLQA 4PBFA 4UNLA 3GHRA 3EA2A 5KFTA 2PCQA 5I78A 4YQWA 3SCVA 2P50A 1DE6A 3TWAA 1XIIA 4GVHA 3EDEA 5REQB 1FRBA 5E9XA 2PI6A 2ZQ0A 1ITCA 2V4RA 4C6IA 4B2DA 2EJAA 1AVAA 3AXMA 4U3CA 3QQ0A 5K2ZA 3V6KA 4GXWA 3PULA 2WSRA 4US6A 4JTIA 1YLVA 1W3NA 4I9JA 4Y7EA 3TMQA 4QDWA 1OFQA 5E0FA 3CV6A 1UD4A 2PTDA 4NP7A 2UY4A 3MFHA 4KH2A 4GLEA 1XLJA 3CUJA 1ZU8A 5XIMA 1QI2A 5FEZA 4QRNA 1D9EA 5A94A 3L68A 1VC4A 3WK0A 1RQBA 2VURA 1POJA 4M81A 4DZAA 2A6LA 1O66A 3HG5A 3ZVHB 3P7YA 3SQMA 5BOEA 4DWSD 1F8MA 1CECA 1JUEA 3H12A 3CQKA 5LIYX 2EPLX 4D6GA 3BAXA 5BZAA 4AU0A 4JICA 4KWSA 1F61A 3T0AA 1NWRA 1ML1A 3W70A 3NL2A 1PIIA 3WFAA 3P60A 2G3FA 3BSGA 3OP2A 3PBYA 3GZ3A 1MEIA 1CYGA 3Q8PB 4JHMA 1H50A 1HO1A 3REQB 4PMUA 3FEMA 3PG8A 4L5ZA 4FF7A 1SJAA 3M0VA 1OYAA 1D3CA 1E0WA 2WMHA 5KFSA 2PDFA 1Y8BA 3VVGA 4F4WA 3H6OA 3HA1A 3W74A 3S9IA 1JXJA 2UVWA 4NASA 2TMDA 3ORWA 2IKJA 1GT8A 3N6QA 3GG8A 3H4DA 3DFYA 3QFWA 3FOKA 1OHLA 3DBNA 4PFHA 3NSNA 4LVDA 3OYXA 4Q7NA 3GIJA 1OFEA 1I9CB 4IMFA 1R85A 1F07A 4MM1A 4WY0B 3WMSA 1MW3A 2BHUA 1OGBA 4ORIA 4H8UA 1ZSXA 1GW1A 3GO2A 3ZSTA 3GC4A 1EGVA 4F0HA 2W66A 1YE4A 1YDOA 3PK7A 4GI9A 5LNRA 4DI9A 2NQHA 1REQB 1UIOA 3UPMA 1DYSA 3UP8A 3CLWA 4GYPA 4ZB2A 3UR7A 3AMKA 3TSBA 1QOXA 2VQTA 4KEZA 1QNSA 3W7LA 1E43A 3DGBA 2PGEA 2OT1A 1NWSA 3VX0A 1QBAA 4A6GA 1R3VA 9CGTA 2OGJA 1ZBCA 1OT1A 4REQA 5HWNA 3PR4A 2V2DA 3QRHA 2XC9A 3WDQA 2ZRZA 1IZJA 4KCTA 3U57A 2ZDRA 1JZ2A 3W88A 1ENUA 1PKYA 1B3YA 5DO8A 4ZO6A 4Y9OA 3CMGA 3EDKA 2C2DA 1IR2A 3FV9A 3CQHA 1I2PA 5KT2A 3W2KA 1JF6A 3GU2A 3DC0A 1YRRA 1VIWA 3BSMA 4O1AA 4FOUA 3UGRA 1AD1A 5CLWA 2AQVA 3MFIA 3H23A 3TNBA 1JPDX 3CL6A 2WAGA 4XZHA 1LQ2A 4B9ZA 1CNVA 1TPH1 3IK2A 3JS3A 2WO5A 3UA3A 5CBJA 4H7CA 1I45A 4ZOAA 3Q67A 1XIJA 4AXKA 4N9EA 4CD8A 4NRRA 3K4WA 2PB1A 3C2EA 3DFTA 2W9BA 1IXPA 5BROA 2DZVA 4ED3A 4IISA 3C0JA 2E9LA 2PGRA 1E3ZA 3VDAA 3QSRA 5KINA 3LM3A 2C1GA 1KRCC 5I24A 5HK4A 1YTKA 2ZOXA 1A47A 5CPSA 1XBXA 1FWFC 3E2QA 4HPNA 1RXOB 3L0NA 4GH1A 2EPNA 4F9DA 3VD4A 1M7PA 2FZ8A 3TOYA 2WMFA 5CH9A 4V15A 5HXMA 3OZMA 3MP3A 3KFTA 5D2VA 1UWUA 2VM8A 3GK0A 1ZFJA 4G7FA 1SO3A 2BOGX 1RV8A 2GQ9A 1UP3A 1TELA 2QCMA 2VC6A 2OO6A 1H11A 2VRKA 4QIUA 1X1ZA 4OFCA 4J3VA 2PU1A 3K30A 2E8YA 3CUXA 2GYIA 3Q45A 1XKJA 2E28A 1EIXA 3CUFA 4Z0JA 1AMKA 3NNTA 4O1CA 3N12A 1FOBA 2VL4A 2YCEA 4XK2A 4QLJA 5BU6A 2DT2A 1M04A 2W9CA 1BVWA 3KAOA 1YX1A 4LB4A 2ASDA 2ZUNA 4HPHA 4GY7A 3HO8A 3LB0A 3I6TA 2V5JA 1ODZA 3TROA 2QCDB 3SCNA 4XSLA 5AC6A 1QPQA 5F4XA 3AYRA 2OB3A 1A5NC 1H41A 3OHIA 1EEPA 1X98A 4DWDA 3RRXA 2G0WA 2JF7A 3THUA 3LZ3A 3F1QA 2PTWA 2ZXBA 2Y7EA 3HIJA 3OYZA 2W9MA 4ZZ9A 2E6DA 4ZOCA 2F61A 1THFD 3GVQA 4XZLX 1W1B1 2C7FA 3A13A 2OX4A 5FEXA 3R6IA 3GKAA 1IEIA 4IIBA 4LS1A 2PDQA 2QMJA 3AIUA 3PZNA 4QTGA 2R8GA 4EX4A 4O1BA 2E1WA 4JEQA 3IIVA 1VAHA 1XINA 4Y8EA 1ONRA 1VIZA 1OJXA 1G4EA 4ZQRA 4GXPA 2IKGA 4QQ3A 5LHFA 2DZWA 3SUVA 4N0RA 3CQIA 4ZFCA 4PH6A 4F2BA 2DPIA 1GOIA 1S5WA 2DEPA 1Z6KA 3PTKA 1WDWA 2Q09A 2HXTA 2IQDA 3P82A 1JD9A 3RR4A 4C6OA 3SBFA 3LTYA 2JBMA 3MMUA 1UMLA 3VNLA 3O0FA 2D0GA 1HUVA 1X6LA 3PVXA 4ILSA 1DJWA 2CZ5A 1PWMA 4GIEA 2A0NA 1LRNA 3TR2A 2GOUA 1XCXA 2QKFA 3B0XA 4HKPA 3MR6A 3H2OA 4LVAA 3PG9A 3QJAA 5AHFA 5MKGB 1CDGA 3AXXA 1E9ZB 3LHWA 3BICA 3O9NA 4O10A 2XISA 4L9YA 4MWAB 3V5FA 3WH7A 2DP3A 4QWBA 4L6DA 3U5UA 4RW5A 1KXQA 1V93A 4O54A 2J9ZA 5CGMA 5M3WA 3GR7A 1JYXA 4GQQA 5D9MA 3MV01 2ISWA 4JKMA 1KC7A 1EHNA 1V3IA 1XHGA 1EJXC 1NSJA 1XPYA 4GIAA 3BQ2A 3WNKA 1FHLA 5H2ZA 5AYZA 2WPBA 2NQJA 3KTXA 2OEJA 2QUMA 4GFIA 2E0PA 2AAMA 1H1ZA 1IWBA 5FF0A 2VRJA 2PDYA 3RX2A 3OGSA 3QQWA 5CJ5A 1K77A 3WD0A 2X30A 5AHIA 2QCGA 3QV8A 1JCLA 3SFWA 1V79A 2ATMA 3BQ5A 3W7RA 1DIOA 4HYKA 1FVPA 3VE9A 2RDTA 2DUXA 3AYTA 1XV8A 1V77A 5FF3A 4DYEA 2YJQA 4MB1A 3W2JA 4A22A 3E0VA 3WBYA 2FQIA 3GWQA 1D8WA 4NYUA 1V3KA 1Q8JA 1H7RA 3G1DA 1WXYA 4IT1A 3VNYA 1G7UA 4Y9AA 1F76A 4H00A 3ZYZA 4MIMA 5BMWA 3SCQA 4DJFD 1P43A 2WJFA 2OLSA 3FA4A 3XIMA 2F2KA 3TV8A 4IPLA 1W91A 3QR1A 3UCQA 4XWUA 1W1TA 4HNLA 9XIMA 1GVYA 1M03A 4IRDA 2X1IA 3WZ0E 2EEXA 5I79A 3B0PA 3EMQA 4HZ6A 5IHRA 2PDWA 5G1YA 2EG6A 2E5DA 2NW0A 1H7WA 5F2MA 1P0EA 3GB6A 3HG2A 1BGAA 4CQ9A 1BKHA 3BG9A 4ONVA 1KFKA 3T0DA 5D09A 1SFLA 2C1HA 3EBVA 4AEOA 3AI0A 4I9TA 1K4HA 3GYEA 1OD0A 2ZZ5A 3U48A 3TN5A 3RU6A 2BGNE 2R8KA 2F7FA 3AS1A 2YZ5A 4FX6M 3KDNA 1W6TA 4F0SA 5K9DA 2QDHA 1DL3A 2V3EA 2OJPA 3BW3A 3H21A 4FS9A 2QPSA 3WQOA 4NF7A 4FLOA 1OCQA 4C1LA 3DAQA 2V63A 1R3RA 2FVLA 3QFEA 1W1YA 3AHTA 4ML9A 1LOQA 2WC3A 1TQXA 4IH3A 5FJUA 1TPFA 3SR7A 1A5KC 3M0YA 4UR9A 3WD3A 3WMCA 3ZR6A 3AMGA 4PCFA 3DC8A 2ATSA 1OZMA 1KXTA 3K1GA 3KX6A 1J0HA 3GR4A 3N3MA 1MSSA 1SO6A 4QJ5B 1IT7A 1XYMA 3UU0A 1QO5A 4BS0A 5H6HA 3NOYA 1XICA 4QXIA 4P7LA 2CBIA 2JKEA 4PTWA 4O8RA 3W1AA 4JKKA 1C29A 1H7PA 3TN6A 1VFSA 3L21A 4LNCA 4ZCWA 4U3AA 1V0KA 4DWSC 1KLYA 5I77A 4QITA 3GV8B 3K46A 3QN3A 3CH9A 3IGXA 2VP8A 2ZX8A 1UKQA 1TIWA 2RDJA 3PZIA 4XUYA 5KG7A 2VEIA 2PD5A 5IM51 2XHYA 4ACZA 5ABFB 3SCRA 1KKRA 3HPXA 2H9AB 3NR0A 4M3PA 1TPC1 1HKMA 1CLXA 5C9ZA 3CZJA 4JBRA 4YCOA 3W1LA 3QZ6A 3MI3A 1SFTA 2J62A 1I60A 2CXEA 3H54A 3S6DA 4Q8OA 2QJJA 2Z1BA 3UYCA 4V27A 5EDWA 1JNEA 4J2MA 3FFSA 4K8EA 3VGHA 2OOGA 5I6SA 3EKLA 4N42A 3PZOA 1F3XA 3BOLA 7PTDA 1PB0A 1BYDA 3A5FA 2VMFA 2IMRA 2WWDA 2FH6A 1BVNP 2GJNA 4KWWA 5CPTA 1IHIA 4WRHA 3S5ZA 4D8LA 2XGQA 3WJXA 1CTNA 2RDIA 4ECWA 4QNWA 5GNZA 3MY9A 4B90A 3VOJA 3E38A 4MYAA 3M44A 1UZ4A 1JGIA 7CGTA 1T94A 3E12A 3QV9A 4WSHA 4Z2IA 5A1AA 3S3GA 3H22A 1XYCA 4HHPA 4PMNA 3RLUA 3G6YA 2ON3A 4L1GA 1XQKA 3DYPA 3IPWA 3AC0A 3QY8A 3KWSA 5FEPA 3F4VA 4AD2A 1IQ8A 2PDBA 3AIVA 5CPQA 3VINA 1JCNA 2Z6JA 5C9XA 3IVUA 1AQ0A 5EWEA 1K02A 2GSEA 1ZBKA 4NL1A 2NT1A 1LTDA 2R1MA 3N2TA 3QHMA 2DIJA 4NX5A 1Z3NA 4CNOA 2F2HA 5KFXA 3RCNA 4NJHA 4B91A 2OSWA 1JL8A 4E4PA 4HA3A 4Y8FA 1ZAIA 3FY1A 1EPXA 1QT1A 2BY1A 3S8HA 3GNNA 1FP8A 1D2KA 4RW3A 2CLEA 3H2FA 3SGZA 3ZM8A 4O8AA 3N2OA 4ECYA 3KBMA 1JCJA 1KM2A 1TQJA 2H8XA 2XGZA 4PEEA 1BXNA 3L12A 5KT6A 2BY2A 2YA2A 4ZO7A 3GV7B 2W6RA 4B3KA 2Z24A 1YDVA 3NL6A 2QPXA 3SADA 1IXNA 2PP3A 2WHKA 3FGCB 2OWCA 3VDBA 2JEFA 4MYXA 5DRIA 4ZODA 4HHLA 2VWSA 4WOZA 1A3XA 1YKWA 3I3EA 4W7VA 4CNTA 4CNUA 3WDPP 4QW8A 2QPUA 3Q8SB 5FEWA 4KT2A 2CEQA 1GTHA 2L5HA 1V3MA 1KRBC 2VDGA 2PFHA 2ZX9A 4AD1A 2IXUA 1W31A 1TB3A 3MJYA 1KB3A 1QAPA 2VUNA 2BASA 4CKQA 1A49A 1KCKA 3KHHA 1TJRA 1HNYA 3QMRA 4WY0F 2ALZA 1X7FA 3F4CA 4US5A 1G4PA 1Z32X 2ZWYA 1Q7MA 2X8RA 1F3TA 1W17A 1QU4A 3QYQA 4AUBA 3SDOA 1W1PA 2FMNA 3TONA 1W9PA 4KIRA 3KS6A 1HJQA 4YLWA 1KR1A 3F5KA 1EUNA 4I5UA 5LIUX 3RFAA 1KFLA 1X1OA 2UY5A 4Q8NA 1K8ZA 3EZ4A 4NZ5A 1T8XA 1BYAA 1TPVA 3M7WA 2PBOA 3IV3A 4HA1A 2A7NA 4IG2B 2RGLA 4C5YA 3EDFA 3RBEA 6TAAA 2J7EA 4KF1A 2A4AA 2YYUA 3T55A 4LYQA 4UQCA 5HQEA 1U5JA 2I14A 4U7CA 1VQTA 2J7GA 3ANVA 2C0AA 3L0KA 3ZR5A 2TRSA 1OFBA 5KZ6A 3DOPA 5IRPA 1SSDA 2ZA2A 2A3AA 4UCGA 7XIMA 1RA5A 3LHVA 2CITA 4MSSA 5DMMA 3V36A 4QHRA 1X1NA 4LAKA 3SCWA 4GKLA 1L6GA 1JFHA 1SFJA 3PWGA 4B92A 3W28A 2UV8G 3MS8A 1W2PA 1ZCOA 1TE1A 2FPTA 3Q58A 4MLJA 3TTYA 1K7FA 2QGHA 1CT5A 1KCZA 3BLPX 1JPHA 3UVAA 5M2FX 3GNRA 1YNYA 1EDGA 3PWIA 1B3OA 2PUZA 4NJKA 1KFWA 3WLMA 3UESA 1ONEA 2AOSA 5KEZA 3KBNA 4IIEA 3L2MA 1NFGA 3O15A 1SZRA 2WLYA 3W82A 5L1KA 2UVVA 4XIAA 1RVGA 2CW6A 1CWYA 2P1FA 1O5XA 3WD1A 3CLMA 3WCZA 3E96A 3AIBA 3SI8A 4QEHA 2ESCA 2XSBA 2EXOA 4DB7A 2VA2A 2VDIA 3THCA 1ITXA 2OH2A 1SU5A 3RX3A 2BXVA 5K4ZA 4YR3A 3M0ZA 3T08A 3VUPA 2JEGA 2CXGA 4C6QA 1PZ1A 4GJIA 4MLRA 2X7WA 4YPJA 3RU8X 2VQUA 1E70M 1A50A 2Z7KA 3IAPA 2R94A 2AKZA 3TWBA 3UWWA 1P6CA 3MR2A 1U1UA 4S2BA 3ATZA 3N13A 2NX1A 1QRQA 3W1QA 3PW4A 2E9MA 5G2HA 5CSRA 1OFDA 2ZUMA 1RZMA 2ZADA 2F6KA 2DZPA 4UMCA 5A8GA 3KRSA 5DELA 2PD9A 3BAJA 4XBKA 5I3IA 2NQLA 1MEWA 4IHCA 3UBPC 3R0DA 4B3ZA 4OTKA 4CD7A 2G97A 5RUBA 2NUYA 3UWEA 2Q3RA 3KL3A 1V0MA 4PTXA 1GVFA 1H1NA 1PTDA 1UKPA 4NZJA 3WEOA 2CU0A 1X8FA 4XD4A 1RLDA 4PRRA 1H5VA 1ISYA 4PUWA 2QW5A 3TUUA 1S5NA 2V2HA 2GVGA 4FXFA 3B03A 4GUFA 2PWFA 1XJBA 3JRKA 4JN7A 4LGXA 1MUMA 4F4ZA 2B81A 3FEQA 2O9OA 4AZCA 2I9UA 4HPGA 2CZEA 2Y0FA 2E25A 3G1HA 3TU9A 5AZ1A 3PUDA 2E6YA 4ZQPA 1W1IE 4E4FA 4O0KA 3VYLA 4ECVA 4D1IA 3B3DA 2IXVA 3UZYA 5I03A 3WSUA 3TR9A 4XD5A 4ZTYA 5I3KA 1A5CA 2BVWA 3GAYA 3P5ZA 2Z7GA 3HBLA 3UWZA 2F9RA 2H3DA 1MNSA 3T5JA 2KX9A 3N4FA 4JTAA 1WZLA 2PF0A 4MB3A 3VX1A 3WDRA 1XIDA 3ABXA 3KVLA 4TO8A 1EJSC 4DBDA 4HK6A 3RM8A 1K8YA 1EFZA 3UR8A 3GNXA 1B54A 1WQ5A 3DYMA 4AZ7A 4RZ4A 2RAGA 3B0VC 5KFNA 3I6RA 4C6FA 3ABRA 4XAZA 2JEIA 1N55A 4FNUA 2PP0A 4XD6A 1GZGA 2HDJA 4FIRA 2VVSA 3A4JA 2OU4A 1LF1A 1QNQA 4HHHA 4UFJA 5A5WA 3RXZA 4YR0A 2WQPA 2XSAA 3TZNA 4NUWA 1N8FA 1UR4A 3THDA 5B80A 2QNEA 3TIMA 1E9YB 3G8RA 4UFMA 1J6OA 1YQ2A 1GPWA 3FDKA 4WCJA 3W24A 4LWWA 3BARA 1I2RA 4KWUA 3LHTA 1UYQA 3VOHA 1XRFA 4Q44A 1JDFA 2ZZ7A 3BANA 4S39A 3MCMA 4NJIA 4PMJA 4UFIA 1LBFA 1S0OA 1SW0A 1E6ZA 3MUIA 2EHHA 3CTLA 4H3DA 1QW7A 3RO8A 3BGJA 4ALDA 3KOYA 2J4GA 3CHEA 3IJLA 2WK2A 3EWUA 1MQPA 2YB4A 3EPMA 5F2IA 2QMKA 4HU0A 1XDMA 5DCBA 5KFWA 3LU2A 3S2CA 3Q8QB 3OG2A 2XZ7A 3MTWA 4Z1AA 4UNIA 2ZUUA 2A3EA 4O1FA 2G3IA 3QY6A 1Q85A 3OIHA 5EGRA 4A4AA 2QHAA 3LM7A 1ECQA 3WLTA 3NQVA 2BSLA 1SZNA 4UBPC 1H4PA 4MB5A 4LV4A 1V3HA 4IGSA 2G3NA 1FTXA 5I06A 4UZSA 2XGBA 1NDWA 1XIFA 5LGXA 4W84A 3N14A 3PBGA 3IN5A 3ARQA 3BQ6A 5A6TC 3WN6A 2VRQA 1R86A 3MMTA 2CBUA 3TA9A 3A5VA 1BQGA 1PO9A 4EYIB 3R8RA 1PL9A 1TMLA 3Q4DA 1HW6A 3TH6A 3UG5A 3W7OA 1GWJA 3G1FA 4BI6A 5BOOA 2CCRA 3POHA 3NJ3A 3TYAA 4LPCA 3S9YA 3NQFA 4JYFA 4M29A 5C54A 3PNUA 1F3WA 3CHVA 2G4FA 1LP6A 3W26A 2GQ8A 1ICQA 2BGQA 2VXNA 1K1QA 1RQHA 2XDFA 2QR6A 5DQGA 2W92A 3R43A 4PMYA 3WH5A 5C2CA 3JZUA 3LRLA 4J9NA 4QWAA 4WK9A 4PTNA 1WDQA 3AZRA 3TTQA 2CHOA 5D38A 2NUWA 1XSJA 4JIRA 4JNMA 2C71A 3ITCA 2NXIA 3QXBA 4H83A 5I09A 1XRSA 1EJVC 4IPNB 5GJPA 3FNDA 4RUBA 2E8ZA 4S3GA 1EH9A 4IRKA 2DZSA 1JAKA 3GBDA 3RAXA 3VM5A 4HGXA 1NDYA 5CG7A 3GXFA 4PMOA 3H2EA 2DT1A 3OJGA 3GIIA 1ODUA 1MZRA 3GM8A 3PF3A 1FKWA 1UKSA 4FNSA 2BY3A 4EAMA 2J75A 4WDXA 1TWWA 4HYWA 5JVLA 4CN1A 1W54A 1EQCA 2BOFX 4IGNA 2CLHA 2Q8ZA 2DH2A 5HMSA 1GW9A 1X6NA 4TQRA 4L64A 3ABOA 2VC7A 4H41A 2HBXA 2BP1A 4OE7A 3O2LA 2ZIDA 2QT3A 1Q6LA 2OR2A 4LS0A 4M7TA 4LVGA 1GVSA 1NQKA 1BAGA 3W7KA 2Y5JA 1S2AA 3WLKX 1PV8A 4DAFA 2V3DA 4MMWA 4IFRA 2QF7A 4JYEA 1EWDA 2WANA 1BVZA 1IYXA 4F50A 4YNGA 1IGWA 3UR5A 4RNOA 1E6RA 3V0TA 4C1NA 4HA0A 3P93A 4TOQA 2VUYA 2YA0A 1UROA 3NZPA 4A3UA 3BLEA 1UBPC 4UR7A 2Z2UA 2WMGA 1F4AA 3KVJA 3T6CA 4EPKA 1VZWA 3VABA 4YTTA 3TW7A 1PIFA 2D69A 2W9AA 4BA0A 2J77A 4K8HA 2E4TA 3CO4A 3GTHA 1UW9A 4H8VA 4L4LA 5DT5A 2B0MA 3ZJ8A 1MRQA 4O4WA 5EWGA 3G0UA 2XTKA 1AH0A 3W37A 1C91A 4ADTA 2PDIA 4TMCA 1EB3A 4AVOA 1A5UA 3RJXA 4FB7A 1V51A 3TE9A 3GVVA 1XWYA 4DELA 4F48A 2HEJA 1QNRA 1IEVA 3IRSA 1GG1A 1GOOA 1U30A 2F84A 2VGFA 3U4AA 5CZ0A 3MHFA 3STFA 1O60A 3BCDA 3EX3A 3TFXA 4BHYA 1XYZA 1B4KA 1UASA 3EDDA 1FX6A 1KW1A 3GFZA 4PN2A 1EA9C 1TMHA 5DQPA 3GBEA 2WYSA 3VGGA 4C6EA 4C65A 4NU7A 2R14A 3QEZA 5AY7A 3CC1A 5A2CA 2QDGA 3EX4A 5LNWA 5IBXC 2G3JA 1WAUA 4O3QA 4AC7C 3ARSA 3KZSA 2Y70A 4MJ4A 3W2MA 2QJIA 4YWSA 3EXSA 1V6YA 1V6VA 4S1FA 4DJDD 4EBEA 2ACRA 2WM1A 2ZX5A 4AMCA 2DJXA 2FLPA 2OYMA 2Y7GA 1FH9A 2UVRA 3NM3A 1GVOA 2YPIA 4C6BA 4UOQA 1C7SA 3E0FA 4YIWA 2RKXA 4GQRA 4CN6A 1DJQA 3A9BA 2R91A 4AIEA 3M7SA 5KFRA 2EGZA 3C56A 2NXGA 4A8LA 1H62A 2PTZA 3LHZA 4R34A 3OZYA 4JYDA 1R46A 2FVMA 1TO3A 1PYMA 5FI8A 3I3DA 5HNUA 4GNVA 4Y9PA 3QC3A 1A4LA 3FJ4A 4QWDA 4JTTA 4BY3A 1DJHA 2GGIA 4EVZA 3DECA 4RE3A 1FWAC 4QFUA 4D6HA 1LBLA 3URNA 5CC6A 1GOMA 2C0HA 3WK2A 4UQBA 4A21A 3VOGA 1W3JA 3BGGA 1IXOA 1JZ5A 3PC0A 2WZIA 2GJRA 2AQWA 5F4WA 3AICA 4K7VA 1LM1A 4XUGA 4BQ2A 4UTTA 1F5ZA 2ZXQA 3FW6A 1W5NA 4NG3A 3BTNA 1T41A 1MNZA 5JIPA 4TR9A 3EOSA 1W5OA 3OLEA 4OUIA 2VZSA 2DSWA 1U83A 3W02A 2QJMA 3LRMA 1JZ6A 3DFNA 3EPGA 2DZUA 2XJ7A 4TV6A 1Q3NA 3IACA 4AZBA 4XQ6A 4HU3A 3CZEA 1H5YA 4FEZA 2GDQA 1ISVA 4MAZA 1Y65A 2XIQA 4ICMA 3M47A 2D3NA 3ONCA 3VOFA 1AJZA 3H7UA 3EKZA 4AD4A 3EOLA 3IUIA 1Y0EA 1ZP3A 1GJPA 2VOMA 5I3HA 5AFDA 3KL0A 4DEZA 5HMDA 3ITLA 4RDVA 1US2A 1CX9A 1O1ZA 1UPMB 1LYXA 4ZR8A 2WNWA 2YKKA 3N73A 4XZNX 2A7RA 5FAGA 1XH2A 1QNPA 2W8LA 1E1EA 4Z2GA 4DO5A 2G41A 3W84A 2V0TA 1AUSL 4HB7A 6ALDA 1H61A 3R13A 4L6HA 4G7EA 2R9RA 4L9XA 1KQYA 4ML4A 1YTEA 1LZOA 3ARRA 1VENA 1KM5A 1K7EA 1TPWA 1S3TC 4F0LA 2V8ZA 1NEYA 1DP0A 2I57A 5LNVA 1E6XM 1JDEA 4Q32A 1S5VA 5C9UA 4EF9A 2O92A 2C18A 3EWWA 4DBWA 1KGXA 2OODA 4LRTA 4Z17A 1TRDA 4DO4A 5LNSA 1E4IA 5LXXA 2GVJA 1ZNNA 3HQNA 3MBDA 3UA4A 4O3RA 4CQCA 2E7FA 5DBTA 3S47A 2DIKA 2ISSA 1GKQA 3I4KA 4GNKB 3H4GA 2PDJA 4JIPA 1YEYA 4MTVA 1XSIA 4H1ZA 3QMTA 1V8EA 1XUUA 4UMBA 1P4CA 1V3LA 2YBVA 2YIHA 1XF0A 1VJSA 1G67A 3KWXA 3BXWA 3JU2A 5C7VA 2BQUA 3KOFA 1S5TA 4N6EA 3PR5B 2A3BA 4OV9A 2GPTA 3KOZA 2WVTA 4JHOA 3DHPA 2J74A 5KTLA 1RP9A 3GDMA 4BEQA 3LPOA 3GG0A 1T0OA 1RHCA 1RD5A 3EPNA 3VC5A 2ALRA 4I9AA 4EXBA 6CGTA 3MDWA 4Z1CA 3AWOA 3G1YA 1Y5VA 1QI0A 3WQFA 1DJYA 3ABZA 2TAAA 4K7YA 3OVRA 3TDFA 3HG3A 4Q4QA 5DY3A 2QJHA 4XKYB 1W2VA 4QQUA 2WSKA 4P7RA 1K9FA 1I0DA 1XXXA 5BW6A 3T8QA 3RPDA 1R3QA 2J88A 4FOKA 3T2OA 3SSZA 4HQVA 4PL2A 1CB2A 1B4EA 3INPA 4L56A 1US3A 5U7SA 5GQBA 3WH8A 5AHEA 1KFCA 3BC9A 2PDCA 3MR3A 4LXFA 7REQB 4XBJA 2E1DA 3MCOA 2XVNA 4FNTA 1AW2A 1KKOA 4QBXA 4JNZA 1UWIA 2PTYA 2J13A 3NQCA 3AUJA 3QW4B 3H40A 3WX7A 4GK8A 4ZE5A 1UC4A 4KEVA 1KFJA 3DKJA 2EG8A 2A7PA 2NVDA 3LG3A 1UH3A 4N4QA 4NRSA 4LRSA 4W89A 1XBVA 1FH7A 3IRDA 4ED6A 1TJ0A 5GPRA 1ZGDA 4S3CA 2V4QA 2GK1B 3ZJ7A 4RLIA 4JAWA 1OSEA 2DH3A 4PCNA 3WMLA 2Z1KA 5C71A 3BL3A 3NDYA 1IZCA 3G77A 5E9AA 3VOIA 2J25A 4XAGA 2YR1A 4LY8A 1MYRA 1P5BA 2ZC1A 3W22A 3BMXA 5HQLA 3P74A 5AZ0A 4AD0A 4IMGA 2VZUA 2DSVA 3ABQA 3GY1A 4E3TA 2HTMA 1S1PA 3L4WA 3OQEA 3STEA 2I17A 2PDPA 3QZ8A 4ZXOA 4XX6A 4H9XA 2AGQA 3OBKA 1O5RA 3CJPA 1RK6A 4RCXA 3I7SA 1XGZA 1FWHC 2ZVRA 1DHKA 2XGPA 4J9JA 5HPOA 1PUDA 3S2NA 4C91A 3TYEA 3H24A 5KFDA 1Y5XA 3NQDA 1SQ7A 1LJYA 3R8HA 1K9TA 4J9RA 3CZGA 1KBBA 1KBLA 1DV7A 2WSPA 4GFSA 4PCTA 3AUOA 2Y62A 3LK6A 3FHAA 4DXXA 3C2OA 3GH5A 4RNMA 4EYHB 1CXFA 5JBFA 3QLDA 4XO6A 2FH8A 1JD7A 1FWEC 3MHUA 3UWYA 3GS6A 3KRZA 5JH2A 1C9WA 1DJNA 5BXSA 2CPUA 2JEPA 1Q4WA 3RIKA 4D1JA 2OKOA 2FZMA 4ZA0A 2E5CA 4I7VA 4D6JA 1VPQA 2ACUA 4XO7A 1F4HA 4H4IA 4C7FA 1Q6RA 4JHZA 3CZKA 5KETA 1J6PA 3ZLGA 4P8WA 3CYJA 3ID7A 5HWMA 5GNXA 4HN4A 1AD4A 4EBDA 4Q8QA 3W23A 4LT9A 3NQBA 2WMIB 4R53A 3KBSA 3UXLA 4UQAA 3RAOA 3FVDA 3FJ6A 4S2CA 2E9BA 1AL8A 2P8CA 1VEMA 3KRBA 4F40A 4NZ3A 5D33A 2REQB 3E49A 3WQGA 3PN8A 4GC7A 3LBMA 1GVIA 2WCSA 1OX4A 3SUWA 4LJ3A 1KFEA 4PA8A 1F7BA 4ROPA 3RLHA 1QR7A 5AN7A 3H55A 1YHTA 5EWFA 4P8XA 3GFYA 4EANA 4U5IA 3U7VA 2ZE3A 3P0WA 4J9LA 2GL5A 1ECEA 3STGA 3ZSSA 3B8SA 1H1YA 2VWTA 4M5PA 2FZDA 2RDUA 2IQ0A 5D9PA 1V6TA 2A2IA 1CENA 4RE0A 4ICCX 4C60A 3K5XA 5AHNA 4CLMA 4BEUA 5DCDA 1UCWA 3UWVA 4PUJA 3RGTA 3AQUA 4PULA 5FL0A 7TAAA 3RAQA 2GGGA 4BWLC 3VCCA 2DPJA 3ZR4A 2DV0A 2V9DA 2YXXA 1ME9A 5T14A 5E0KA 2VJXA 4HU4A 1XGEA 3NIYA 1PE1A 2CLMA 2ALDA 4RE2A 3EA3A 4X22A 3THAA 3MB9A 2F8QA 5KT4A 3CBWA 1GHRA 1BRLB 1S0NA 3M5ZA 1I6NA 3H7VA 3O3RA 3DH7A 1Q2SA 3T09A 2HMCA 4H7ZA 4MWAC 4RL3A 3P5YA 4ADSA 2VX7A 3UR2A 4TVDA 3PW5A 3JUGA 4K38A 3LPGA 1EA0A 2Z2BA 4HK5A 4UTJA 3LENA 4Y96A 3WH6A 1R9XA 2ZRYA 1RCXB 4FO4A 3R0KA 3WKZA 3UJEA 3TTSA 2Y63A 2HSAA 4RK8A 1LG1A 3TW9A 1H0IA 2NX3A 2OGYA 3MO7A 1G6CA 4J5NA 2IPWA 4M24A 3S1VA 3T4WA 3CMFA 4PMZA 1YYAA 3N6HA 3VAVA 4LUTA 3L4TA 3PJWA 3M64A 1KR0A 2UBPC 3N18A 4ECUA 3M43A 1ISWA 1UG6A 1B9ZA 2R1NA 3SY1A 2NX9A 4EP8C 1XR2A 4J9MA 1XLLA 1R6WA 4G2DA 4GQBA 3IIZA 1WAWA 1JPMA 1CI1A 3TYZA 4JV1A 4HNOA 4ED7A 4PFMA 4GZIA 3WQPA 4MHBA 3ZWTA 1VFOA 4XZBA 4DZHA 5E09A 3BW4A 4ZQNA 3T5HA 4UOZA 1XYLA 4E4UA 4EK7A 1H63A 1UZDA 4JN6A 1WDRA 3I68A 1VGAA 2OELA 2V82A 4ZMGA 2X42A 1DJGA 1VPYA 3P0XA 4NJJA 3AALA 4LB3A 5FL1A 2NXHA 4GC6A 1S2WA 1J4EA 1ZBWA 3W9ZA 2BOEX 1DBTA 1FHDA 3HGOA 3A24A 3TFCA 1EC8A 1VS1A 2AQ4A 3E5PA 1K8CA 6REQB 1WP6A 4U6PA 5C9WA 4ECRA 2Z29A 1PXGA 1J01A 1PWLA 4RXFA 4CUCA 1R9YA 3V35A 3YPIA 3VDHA 5I0DA 1R3SA 4IJCA 4O12A 3KL5A 4JY9A 5FJOA 1HJSA 2XCPA 3G1VA 4L4MA 5G1MA 3TK7A 4L1XA 4NIRA 1VFUA 3KHRA 4PUMA 3RMJA 2PWUA 1NWTA 4H7VA 1VJZA 5LXEA 4Q45A 3CV2A 3IJQA 3M6YA 5BRBA 1E0VA 3UD6A 4JTHA 4RKAA 4E2OA 3GXIA 4FXRA 1E72M 1R7OA 4RE4A 4PSRA 4YTUA 4RZ5A 4ZXLA 4A2RA 2D23A 4M56A 3WEMA 1UA3A 5B7ZA 4GZJA 1FBAA 2HVNA 1UZHA 4WDWA 2JF6A 2D2OA 1RALA 1EJTC 1R30A 1SPQA 1K03A 3L5AA 3A47A 5MHBA 4MB4A 2CHNA 1GVQA 3B8UA 2C8NA 4HTYA 2ZYFA 5KFOA 3IGHX 4NSBA 1MXGA 2OQHA 3LCLA 3IVTA 3GVGA 7ODCA 3QKEA 4IMCA 2VCBA 1QK2A 3HPZA 3ECQA 3AMCA 2H3BA 3O63A 3NTYA 3VCNA 1W3LA 2NVCA 1XG4A 3DKLA 2PPGA 1E9LA 2P53A 5JU6A 1U5HA 3CIXA 4AZIA 3S2JA 4IR9A 3E6EA 3NQGA 5BYWA 2WBKA 1VHNA 1WUFA 3WL0A 3EPIA 3CV1A 2YL6A 4UIOA 2X40A 2VGBA 4FLRA 1LDCA 3WLPA 3SAZA 1VRDA 4NKCA 3NEHA 3LOTA 4DWSA 2V5BA 4LVFA 3V5OA 5A8PA 1XI3A 1O6IA 2J7HA 1T8QA 3QF0A 1ZJIA 4AH7A 3ALFA 2J7DA 3TSDA 3C61A 1ADOA 4X63A 3WNOA 1N2VA 5A8NA 4Y6GA 3WQ8A 4JQ3A 3T07A 4QE5A 3WLQA 2XVKA 5I2UA 1A5AA 4B5WA 2O4QA 3W1MA 4G6CA 5HATA 1S2CA 1TV4A 5HAOA 3BCJA 4IF2A 1E5NA 2W63A 1S38A 1XCWA 4ZSUA 3B9OA 2Y4SA 3QTPA 4QJ3B 3NPWA 4LAUA 1TPDA 3WQCA 1UD3A 4HHMA 3NCOA 4XVEA 5CBIA 5FACA 3LLDA 4XZWA 4FIQA 2Y6ZA 5BOFA 1L6WA 5LNUA 1LLOA 2GDUA 2GLKA 1XX1A 2FPVA 1QK0A 1Q6FA 4JGDA 2R1PA 2GUUA 2W79A 1JZ8A 1A5SA 1G5AA 5BWAA 3THQA 4GIRA 3V18A 4EBCA 2P9BA 2DPEA 1QWGA 2Z28A 4JIIX 4ATDA 1WE5A 2V69A 4Q8MA 2OYLA 2O55A 4LV9A 2ABAA 3FDGA 4GQ0A 7ENLA 4Y90A 1PTAA 1UWAA 3ARUA 4RX0A 2WCGA 3G6LA 3PUGA 1F74A 4IQEA 3NQAA 4NT0A 2VKZG 2VHLA 2HV5A 4LF2A 5DN1A 5J5RA 3G6XA 4Y2WA 1E1CA 1JDDA 1XLDA 2Z1WA 3UW6A 4A3RA 1CGTA 1FDZA 2OT0A 1E73M 1MRAA 5BMXA 5L9FA 4HJWA 1SR9A 2DORA 3LERA 3N11A 3VNJA 3NYDA 2XINA 1DXFA 1NF0A 2AKMA 3MP5A 4INFA 1EXBA 4RV3A 3QYSA 4Q3MA 4G3IA 7REQA 1O5KA 2V5CA 1IR1A 3PANA 1IXQA 3ARXA 2XUCA 4ERIA 1W37A 4NJGA 1QW9A 1M5WA 1FWIC 3OHMB 1GUVA 5FCZA 5FSDC 3AO0A 1FCQA 2VOTA 4ES4A 1EWEA 1GQNA 1WPCA 2HQAA 4FI4A 3VA8A 5HMEA 2WVVB 4LCRA 1XS2A 2QUTA 3BLKA 1YBQB 2HJPA 1W3IA 2V5LA 4MOZA 3VNMA 2BB0A 1BLIA 1GEHA 1RCOB 1BGGA 2VZVA 2WSYA 1HVQA 4LW7A 1M7XA 2YCLA 5FF4A 3I3BA 3UZZA 2NT0A 4ZL1A 2PDNA 1WKDA 5KZMA 3U7BA 4UTUA 3TVAA 5G4EA 3RB3A 4E38A 4DBEA 1PVNA 1EL3A 3HPFA 1DPMA 4H6KA 3L4UA 1US0A 5KFYA 2O9PA 4NAEA 1ZZMA 2RHGA 4GOAA 5DQHA 3STCA 5K3VA 3P81A 2PLCA 2P8BA 2I5IA 2Z1SA 3H53A 3D6NA 1OG6A 4PUDA 3ZVIA 1XCFA 1XFBA 2C22A 4NXSA 2JK2A 3HF3A 1CCWB 4J3UA 4BK9A 1T7LA 3ARPA 3DFSA 2UVUA 5D2XA 4J3WA 3SQSA 1X7IA 2YDSA 4UTHA 3B0UX 4D9PA 4RU9A 4HMEA 4Z2JA 8RUCA 8XIMA 4UTTC 3GIMA 3N4AA 4FK9A 4AFYA 1ZL1A 3HFTA 2YL8A 4Z0SA 2C2RA 3MKVA 4Q7BA 3LPFA 3NO1A 1KTNA 2VZOA 4IJBA 3UXIA 2VX6A 4A05A 3CHCA 2YB1A 1TPEA 4XD3A 4BJHA 3TJXA 5DG9A 2Q3OA 1PS9A 3E02A 3HN3A 3I7RA 2NSOA 1XM3A 2WNNA 1R2SA 4S3FA 1J5TA 1TA3A 4HZMA 1RQEA 4IIGA 2AL2B 2YCKX 3PZVA 3FCPA 3CHFA 1LROA 2OOFA 3IUHA 1PX3A 3UJSA 1J0JA 2IPJA 4GVFA 2WMIA 3CAWA 3S6TA 3TYUA 3QR3A 5EL1A 5DQIA 4W9TA 3EOOA 2WB5A 3S2LA 5LGZA 4XAYA 2HK1A 3ARWA 4Z1DA 1TTPA 1QCWA 3WF3A 1E4MM 2R82A 1H2JA 3ALGA 4MY8A 4YMZA 3LLFA 5E93A 1NJJA 1D3HA 1A5MC 5KMYA 4H6RA 1ADSA 3A3XA 4O11A 1JZ3A 3LPPA 3M07A 3RN6A 3BLFA 4YTQA 3ANYA 2FLLA 2FPYA 2VNCA 4NILA 4XTIA 3KLLA 1DIDA 4JTFA 1S2TA 2QJNA 4WX2A 1CGYA 5EMMA 3LD5A 3VZZA 4EAYA 3WNPA 4MVAA 4AC1X 1V6WA 4DXVA 1EOKA 1P7TA 3L67A 3CL7A 2BV9A 4R27A 3ZS4A 1LUCA 2W62A 2A21A 1ADDA 4OIFA 4AWSA 5KG6A 3BW2A 4KETA 5EFDA 3BLIA 1ZAHA 3FS2A 4NZFA 3AXIA 2YYTA 2JGYA 2W27A 4ZE4A 2WKLA 4XIMA 1HKWA 4N6FA 3GUGA 2W0UA 5CZSA 3OA3A 3TSMA 1XDJA 4JTDA 2P88A 3GXTA 4L61A 4DNMA 4HCDA 4WF7A 4R8UA 4ZB0A 1ZY9A 5BXPA 3OHBA 1Q65A 3EWCA 1BXBA 3U2CA 1KLZA 3V6HA 1QASA 2XIJA 3WQ5A 2YDQA 3BQ1A 1PCKA 3QZEA 3RG6A 2HVOA 4Z1YA 4UXDA 2J7CA 1UA7A 4ZBCA 2FDSA 3W7DA 4U10A 1Y5WA 5CC3A 3TMLA 2GWNA 1EZ2A 5G5IA 1AMYA 1EHAA 2OYKA 4YYFA 2P5NA 2YBTA 4E5TA 2FDMA 4MKNA 2R6OA 3NQ2A 3K8LA 1VRXA 3EWXA 1P6WA 4MF4A 1S46A 1DVJA 1JCMP 4GACA 4IFKB 1KM6A 5EKYA 3OTRA 4R7WA 1DWHM 4GABA 2Y2WA 2E77A 1S97A 1UQYA 4GYKA 2CLPA 1XIGA 3LY0A 4QP0A 2B7OA 2A3HA 1BWKA 4GKTA 3GIQA 4IWWA 5KFVA 2ZRWA 3DHUA 1GOQA 4GI4A 3T4CA 1ZTVA 3K4DA 3ARZA 3ZFHA 1CW2A 1RJRA 1BTMA 4CU6A 4Z2KA 1DQXA 2NV2A 1UH4A 3VXGA 1VD6A 2FGBA 3W87A 4FALA 3SUUA 3CPUA 1HKIA 3ZJ6A 4F2UA 1Y7VA 5KFKA 3L4YA 3QSTA 4NYYA 4ERGA 4OGZA 5CBBA 1SZEA 3DERA 4CVWA 3EEZA 3OO2A 3VTRA 3U2ZA 3DFOA 3SUTA 3TYBA 1UWSA 3QOKA 5CSUA 3E3HA 3MHGA 3S42A 2OSXA 4H8NA 3C8FA 4IICA 1X39A 1PHWA 2HXUA 5DT7A 2AMGA 1JYNA 3USZA 3PW2A 1WKYA 5A6MA 3FYPA 2YCJA 6XIAA 3HMCA 1XBZA 2ZCGA 2XFFA 1JQXA 1FWSA 1UUOA 3EWDA 5A8MA 3ZIZA 1JNDA 4NZCA 2NQZA 4QX4A 4QSHA 1LWIA 4XZMX 1TUXA 4UMAA 1KBJA 2D0FA 1J9YA 2W5FA 2PRMA 1JVNA 4C6PA 3N2MA 2VR2A 4LAMA 4J28A 2CFFA 1GVRA 2PWHA 1U1JA 3R8GA 3WEZA 2CIPA 4LC6A 4KIEA 3F03K 3TXVA 1S3HA 4MNJA 2XFYA 4Q4PA 4WR3A 2WSQA 3IV8A 3GW3A 3VK5A 1WBHA 3N1AA 1TPUA 2PC4A 2FZBA 3BUVA 1TIMA 1A80A 1WDPA 1JPIA 4IUGA 3S5OA 3LX9A 3NGJA 3MBFA 3ITYA 4K39A 1QNVA 2AAAA 4KQNA 1ONXA 4WJEA 2XH4A 4AF0B 1F05A 1L0PA 1QDSA 4NI3A 3CT7A 3E1F1 4S3BA 3P62A 2KZHA 3AS3A 3GTIA 1OX6A 2VD8A 3MKCA 3R58A 1KM1A 2HS6A 5C5JA 3APTA 4OOUA 1TV3A 2EO7A 2VO5A 5F7UA 4AMAA 3DYOA 4JFUA 4YWIA 3VMNA 2ODOA 4EWND 3A3HA 2X0SA 3GG7A 1FWNA 3OG3A 4I7WA 3K13A 3O16A 3T81A 3CZ8A 4LY4A 4MKVA 3ZT5A 1VLIA 3PZMA 3KBVA 3S46A 3ZLFA 1HJXA 3W1TA 4XAPA 3W2LA 1WZAA 1CIUA 3P3BA 3BAWA 4PE8A 1IT0A 5HWJA 1UOZA 3CGTA 3ENLA 3PNZA 1OZQA 4Q4RA 4KPLA 2CWNA 3TQ0A 3ITTA 4JIHA 3GGMA 4GJ1A 3CZLA 2GSHA 4GY0A 1XBYA 3B8DA 4KCUA 3W1NA 3BV4A 2MUCA 3W7GA 1UR3M 3IANA 2PBGA 3W83A 3FA3A 2QUVA 4CD5A 4PL1A 2JE8A 3C5QA 1EX1A 4V2XA 3OHAA 4QW9A 2NWSA 4JZ5A 2FVKA 2FZ9A 1AFSA 4H19A 3SRFA 3A23A 3LUTA 1LL4A 4IPJA 3EB4A 4FXJA 4CQBA 1Q4NX 4JCLA 3AHXA 5LIKX 4DO7A 2ZDSA 5DEZA 1HKVA 1MWOA 1V6XA 2G5WA 2OWWA 2PRLA 4EPDC 2DDXA 1OX5A 4LUSB 4HMCA 4XZIA 2D73A 2Z0IA 2YZRA 4P8UA 3T2QA 2NLYA 2HNEA 5A6LA 2R1LA 3C4UA 3G0SA 4BQ5A 1OCBA 2YGYA 4J3ZA 4L7ZA 5AC4A 3N3TA 1TWSA 1PZ2A 2Z4GA 3GIPA 2GJXA 1B2YA 3BO9A 3HG4A 4S3AA 5A8QA 4PEKA 2B4GA 1AW1A 1OVDA 5CSYA 2IQTA 5EBAA 5E6YA 1FDJA 3W7CA 4CD6A 5CG0A 1VCFA 4CQDA 1CXKA 5DLFA 1X6UA 1FFRA 1YXCA 4PMVA 3R4IA 1QUMA 2AGOA 1JCXA 3W3OA 3H70A 3ZZ1A 1E4NA 3HGSA 1Q6GA 4PUEA 3EYPA 3GYCA 3W7IA 5HR6A 2PLJA 1VJIA 4FLQA 3N2XA 2IUZA 8A3HA 4IXXA 3TOPA 3W2UA 2WPGA 4H9TA 3NZQA 4S3EA 1B9BA 1KM3A 1XIBA 3WD2A 4TQSA 2FGZA 5IBXA 3VD7A 3KZPA 2XN2A 4LUJA 1OF8A 3N2CA 1NWUA 4AVNA 4GWEA 4OBSA 2PRHA 4M6QA 3QPEA 4R9OA 1WKFA 4RNFA 8CGTA 1MW0A 3NFUA 1EF2A 3HZ3A 3VGDA 1SVDA 4H9MA 1PJ9A 4TVUA 1VCGA 4DX3A 3DG6A 3BE7A 5KSWA 3LCGA 4K36A 4TQTA 4FPSA 2AU0A 4PBEA 2AGKA 4B9YA 2QAPA 1G69A 5DFAA 4LBUA 3TQKA 3FAXA 4OVXA 2INZA 2PP1A 2DGAA 4M82A 3UQNA 1JIHA 2WVSA 2PDGA 2FMOA 3LXBA 4REQB 2QZRA 4MZ8A 2FIQA 4NNBA 2WBGA 3IAQA 2V67A 5DXXA 2DVXA 1R9ZA 1FH8A 5BCAA 4A29A 5HNNA 3V6JA 1UIPA 3UPBA 3ISIX 4WKFA 3T5KA 2C1IA 2YX0A 1GYNA 2HE8A 2WHLA 3W76A 4M19A 5LA1A 2WZHA 3CB3A 1MFVA 4TTGA 3DZ1A 2AL2A 2NQ9A 1XKYA 4DL6A 4NAFA 2JALA 4ED8A 2X1UA 4H2HA 4JIEA 4JTLA 3WBEA 1S9FA 3IVSA 3MI2A 2VEFA 2PDKA 2D1ZA 3CH0A 5FJPA 1TV2A 4L80A 2ZTKA 4CNPA 3PW0A 3WENA 2UY3A 2OSYA 3TQVA 3B9NA 3A4WA 3BMWA 2PC8A 3TNOA 4TVCA 4RDZA 1VEPA 4QE1A 4PZVA 5A6SA 5U4NA 5ABGA 2VI0A 3PTMA 2JIWA 3VIKA 3MC5A 3NUKA 2HVMA 4IIDA 1DORA 3USBA 3UZ5A 4D2JA 1M9HA 4Q8FA 1VYRA 1DQWA 4KERA 1RJPA 4JFSA 1OFRA 1JYVA 2ZBTA 1IT8A 2E3ZA 1I0BA 1NP2A 3LGEA 3VGFA 1BPLB 4KRTA 1CXEA 2J24A 1MW1A 1OCNA 3V1HA 1VBGA 3AHYA 5TIMA 1UD2A 2TODA 3SUSA 2QCFA 7TIMA 1EJ7L 1LWHA 2JKPA 2A79A 5REQA 2OZTA 1FCVA 4E6MA 1FWCC 4DXKA 2P0IA 1RUSA 3ICJA 1T3NA 3MSRA 3APYA 3I6EA 2HWGA 4FXSA 2DQWA 3IEBA 3HURA 1UR2A 4WIWA 4YXGA 1UD5A 2ZA1A 3D47A 2Z26A 4HNTA 1GORA 2FTWA 4GCAA 3RF9A 1V0NA 1XIMA 2X05A 3GIKA 3AHVA 1FHVA 5ENLA 3DHDA 4C7DA 1P0BA 4DUOA 3HB9A 3W1PA 3DESA 5EMUA 3UY8A 5AC7A 2PDHA 4O57A 4KRUA 1J18A 4HJFA 1YIXA 1EGZA 3LMYA 5AB3A 3LCFA 3N17A 3T9PA 2O9RA 4PCPA 3UWUA 5D9OA 3NPUA 3SRHA 2W9CB 3HPSA 5EFFA 1FCUA 1W9VA 1LQAA 3WK3A 3WF2A 1KBIA 4MUPA 3DUGA 3VIJA 1W5PA 3ZVHA 4M0XA 5HUOA 4PMRA 4CU8A 4DUWA 1E15A 1OYCA 4ERAA 3W1UA 4ADUA 2X1RA 2ZZ1A 3MDUA 3ABSA 4Q8PA 4H01A 4GISA 1Z7AA 3G1AA 4V1YA 4KEMA 5M17A 2DVUA 3REQA 4ED1A 4MUZA 2FJKA 3PJTA 3V0SA 1TSIA 3A64A 2W67A 4GYFA 1F73A 4MY9A 2ZFAA 4W8LA 2O0TA 1L2QA 5I02A 1JXKA 1I2NA 3AFBA 1HX0A 2ZUWA 5CPMA 1FP9A 4RR4A 1UP0A 1PYFA 4UTMA 3UCDA 3I7QA 4JTUA 3DFHA 1J2BA 3SCPA 5A6JA 1PKNA 3QV7A 5JIWA 3LV5A 4JFTA 4L65A 3BLDA 3AYSA 3QVQA 1I4NA 5G2IA 2OG9A 4LBSA 4B4HA 4IMEA 4WY0A 3MPGA 4F9JA 1J5SA 3OGVA 1JEZA 5FIPA 4HOZA 4IMAA 4NNAA 3II1A 3WLJA 4ZOBA 2HBVA 3ITXA 4MY1A 4AY8A 1REQA 1XLAA 2E68A 5EMLA 4M6UA 4MJ2A 2PE4A 4LBRA 1E1FA 1KXVA 3M0MA 2ACSA 5A6BD 1OFPA 2CKSA 1LRTA 2PODA 3FAWA 4PB5A 4K68A 4TX8A 4S38A 2W3ZA 3WJZA 5CZKA 3LZ5A 4HYRA 2Y8KA 4GBDA 3XINA 3SGGA 1R0MA 3C3NA 4ATWA 5KFQA 3WFZA 4UTFA 1EP3A 2G95A 3NQ8A 4PB3A 4AHQA 3T78A 4JFVA 2GJPA 2HISA 3VM7A 2GUYA 2BHZA 3TLLA 1GVEA 4AIBA 4QJ1A 4AD3A 1LLWA 3LSBA 2I7GA 3WQ6A 1HZYA 3M5VA 1OWQA 2X16A 3WH9A 3CNYA 3KUMA 5IXEA 1EX5A 1D3GA 4MWAE 2QCNA 1TX0A 4EE9A 4JV0A 2Z1XA 3M0XA 1M1BA 4O52A 2I1OA 5H8MA 1CXIA 5G4WA 3ARYA 2A3CA 4GRSA 3LCHA 1R3WA 3S83A 4I5XA 3N29A 3SIZA 4GZ7A 4QAWA 2V30A 4QSFA 1RBAA 1ELSA 5G4HC 1GOWA 2BGSA 5EYWA 2NWRA 3CPGA 3LCXA 1RY0A 1SJBA 2X0HA 2FGLA 4IP4A 3WUEA 1G1YA 3SN1A 3NDOA 1YADA 1OIFA 3KBJA 4MZ1A 5CJMA 5IDZA 4EOUA 8TIMA 4N9DA 3T0TA 3R94A 1E56A 1JDCA 3MV11 4HNVA 4TIMA 1R2TA 2AGTA 5A95A 3O8AA 3FDSA 3CL8A 4CD4A 5K4XA 3IJIA 5DLGA 4JN8A 1MDLA 4QJ4B 1PZ0A 5E6ZA 1ZENA 2VFDA 3AAMA 3WG6A 2HRWA 5EA9A 2D22A 2CETA 1W56A 2GVLA 4UNKA 3F4DA 2LLEA 3QMSA 4D71A 2EG7A 2Q6ZA 4GGHA 2J6UA 3C0SA 4IX0A 5K9CA 5LSMA 1UKTA 2PWDA 1G01A 5CC5A 1PSCA 1WO2A 4JOMA 3LTSA 2OCZA 4J9OA 3LI1A 5IOBA 1C93A 2IPGA 1J2WA 5I7GA 5HJLA 4J9SA 3S5SA 1IIGA 2J27A 2CESA 4PSPA 3V16A 3LI0A 2GVYA 1H51A 4P8VA 3AJ7A 1OGGA 2A3LA 2YA1A 2OO0A 1XW8A 2QCDA 1EZWA 3PJXA 1TUFA 3AIEA 5D8WA 1EJWC 1DE5A 2EAWA 3NVTA 1H3GA 1ICPA 3DEQA 3VNIA 3URQA 4AHOA 2DSUA 3GC5A 2VFHA 4HMDA 4KKXA 5DGAA 1H0GA 5EMKA 4L1WA 2FB3A 3B9EA 4R85A 1XD0A 1JX4A 1P0KA 3M5YA 1ALDA 2WZMA 1XC4A 4QG9A 5AYYA 2GUBA 3SCOA 3MYOA 1VPXA 1UP2A 5LYRA 3GDRA 3MA8A 1U2YA 5DG8A 2V3GA 3DENA 3CUIA 4EPEC 3VIMA 4S3JA 1L2UA 4JD4A 4JS3A 1TVPA 4AY1A 3GDLA 1W8SA 2FJUB 1C8QA 3BURA 1C8YA 5FD0A 1YPXA 3CWOX 2BVYA 4ECXA 1XLKA 1V7YA 3M1ZA 4QE4A 4JX6A 4Z1BA 3IIXA 2NV9A 4A3YA 1T99A 1K8XA 1TWIA 1JI2A 1XFCA 3MWCA 3T05A 2FHCA 5ECUA 5CZJA 1YXYA 1DWJM 3O1NA 3COTA 3UNDA 3SY8A 4ACZB 4BWLA 1KV5A 2WTFA 4IGMA 1Q7QA 4GJJA 1FFQA 4PTVA 3WQWA 4JKLA 4FMVA 2WNZA 3SCUA 3BJFA 4P5UA 4NZ1A 3W38A 3LCIA 2VENA 3RJYA 4LUSA 3JW7A 2UY2A 1G7VA 3ATYA 2QDDA 4MJZA 4MNKA 4CVUA 1VBJA 4WVXA 5J8LA 1L8NA 5MKGA 5KG0A 3F4NA 3GU9A 3MO4A 4O13A 2J6VA 1FHUA 2QULA 1EC9A 1GONA 4MWAA 2WJZA 4GG9A 4MGGA 1EO5A 2VA3A 4IXHA 1KWGA 5D03A 2V5KA 1JI1A 2TSYA 3VE7A 5C8BB 4PUUA 2NVAA 3GTFA 4FF5A 1KRAC 4KCWA 3WMBA 4DJFC 5I3DA 2ZRXA