1PO9A

Crytsal structure of isoaspartyl dipeptidase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
388
structure length
372
Chain Sequence
MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of isoaspartyl dipeptidase from E.coli: a dinuclear zinc peptidase evolved from amidohydrolases.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Isoaspartyl dipeptidase
total genus 128
structure length 372
sequence length 388
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1po9A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1po9A02
1GKQA 4EPBC 4GC3A 1UBPC 2VM8A 2GOKA 3A3XA 3QY8A 4ZSUA 3IGHX 1FWAC 3MDUA 4DLMA 3OJGA 1V79A 3WYZA 2F6KA 4B3ZA 3GRIA 4E3TA 1GKPA 4R85A 1IE7C 1RK5A 1RAKA 4GOAA 4Z42C 3SFWA 3T81A 2UZ9A 1EZ2A 4CNSA 4I6KA 1FWJC 1POKA 4QS5A 4EPKA 2YXOA 3IACA 4NG3A 1UMLA 4H9MA 1A5KC 2OGJA 4IF2A 3RCMA 1J6PA 1A4LA 2PAJA 3ICJA 2R1KA 3HPAA 4GX8A 3QY7A 2HBVA 3GIQA 4XD5A 3LSCA 2W9MA 4BY3A 1PB0A 2ANUA 5HMDA 4CEXC 4LANA 1P6BA 3IV8A 1ITQA 1KRBC 1FWIC 1VFLA 3ID7A 4H9UA 2YB4A 4QROA 2PLMA 4F0SA 3UR2A 1RK6A 4GX9A 4QS6A 4IG2B 3GGMA 2QVNA 4HA0A 4RDYA 4TQTA 4L9XA 3DCPA 3RN6A 3GU1A 1FWDC 3GU9A 3NEHA 5FSDC 3OVGA 3CJPA 1WXZA 4QTGA 1KRAC 4D8LA 1W1IE 3IJ6A 4KF1A 4WGXA 2FVKA 1S3TC 1ITUA 4F0RA 4AQLA 4M51A 1K6WA 3E2VA 3PANA 4LAKA 2P53A 3JZEA 2R1PA 3K2GA 1O12A 2Z29A 4NP7A 1XWYA 1I0BA 3AUOA 2VUNA 3EGJA 1V4YA 3GUWA 3CS2A 3IPWA 4IG2A 1A5NC 1EJUC 1EJXC 3EWCA 3LU2A 4XAFA 1A5MC 3A3WA 4H01A 3ITCA 1EJRC 1UIOA 2DVXA 4EPEC 2WJFA 1FWGC 5G4HC 3UPMA 1YMYA 3MDWA 2O4QA 1ADDA 3RHGA 1GKRA 1EJSC 1V7AA 2Y1HA 1E9ZB 1R9YA 4DI9A 3C86A 4ERIA 4UB9A 2DVTA 2FFIA 4MUPA 4DO7A 2ZC1A 3ISIX 4IQJA 3LNPA 3FEQA 3CAKA 4I6VA 2Z26A 1FWBC 1RJRA 1V77A 3F2DA 2IMRA 1YNYA 3E0FA 3FDKA 4DLFA 4GZ7A 4KEUA 4C6OA 1UIPA 2Z2AA 4EPDC 1K70A 1FWCC 4IGNA 4PBFA 3TN3A 4PCPA 3NURA 2QT3A 4GK8A 3URNA 1KRMA 1EJWC 4XAZA 2OODA 4KIRA 4IFOA 3UBPC 1YBQB 3K4WA 4INFA 2QS8A 3PBMA 2PGRA 1KRCC 1QXLA 2GWGA 4GY7A 4XD4A 2FVMA 1A4MA 4C65A 5LXXA 3LY0A 1P6CA 3E3HA 4LFYA 4IFKA 4KETA 4ERGA 4CEUC 1NDVA 4F0LA 1A5OC 1JGMA 2ADAA 4DYKA 2O4MA 4IH3A 2HPIA 4J5NA 4CNTA 4EP8C 4IFRA 1P1MA 4C6JA 4BKNA 1XRFA 2RAGA 2HNHA 4RDWA 2GZXA 3SO7A 3E0LA 4UBPC 2AMXA 3S2NA 4DNMA 3DUGA 5A6TC 2OQLA 2Z25A 3URQA 2EG7A 3QGKC 4C6KA 3TN4A 2I9UA 3PNZA 3MPGA 4LEFA 2OOFA 2D2JA 1YBQA 4C6FA 4DIAA 2E25A 3WMLA 2DVUA 1BF6A 4H9XA 4AC7C 1FWFC 2Q01A 4DZHA 3B40A 2PGFA 3GG7A 1RJPA 2VHLA 3KM8A 1XRTA 4IFKB 1M7JA 1ZZMA 1PSCA 5HMFA 2EG8A 3F2BA 4OFCA 2GWNA 3HTWA 3OODA 4HJWA 1EJVC 2P9BA 3TNBA 1PO9A 3LS9A 2OB3A 3GTXA 1RA5A 4B90A 3EWDA 3O7UA 4CQDA 4J2MA 4RDZA 2VR2A 4KESA 1EJTC 2VC5A 2R1LA 2Z7GA 4P5UA 2ICSA 1NFGA 4LCRA 2FTYA 3D6NA 4G7EA 3HM7A 3QGAC 4L6DA 4ICMA 2AQOA 3LGDA 5HMEA 5AKQA 2Z24A 2KAUC 3E38A 4PBEA 4C5YA 3OOQA 1QW7A 4C5ZA 2E1WA 3F4CA 4C6PA 1EF2A 4BJHA 4R7WA 3ORWA 1RJQA 3E74A 4H9VA 2WJEA 4C6LA 2WM1A 3GTIA 1KCXA 4LAMA 3TN5A 3AU6A 2P50A 3URAA 3S2LA 4LALA 3UR5A 3MSRA 4JOMA 2Z27A 3B0YA 2Z4GA 4C6CA 4C6NA 3QY6A 4B91A 1WXYA 1R9XA 1YRRA 4H00A 4KERA 2WJDA 3DC8A 4G2DA 4R88A 1POJA 2D2HA 5CH9A 4C6QA 3B0XA 1ONXA 4LCSA 1HZYA 4C60A 4YIWA 3LGGA 4KEVA 2EG6A 4J35A 1M68A 3A4JA 2R1NA 3OU8A 3OQEA 4QSFA 4CQBA 1FKXA 4GBDA 1R9ZA 1K1DA 3G77A 4QRNA 4IGMA 4LAOA 2D2GA 3F4DA 4RDVA 3R0DA 4V1XA 1NDWA 4C6DA 3WZ0E 4H9ZA 4H9TA 4CNUA 4GYFA 3UF9A 3F2CA 4XD6A 3T8LA 3MJMA 2PUZA 2R1MA 2FTWA 1FWEC 2Z00A 3TN6A 1XGEA 2AQVA 4C6BA 4GY0A 1I0DA 3PNUA 4RZBA 2UBPC 4ZSTA 2I5GA 4HK7A 4XAGA 4NI8A 3GIPA 4H9YA 3LSBA 3GTFA 1PTAA 2YB1A 4XD3A 1A5LC 3S2JA 3URBA 4GY1A 4RE0A 5FSEC 1J79A 4C6EA 4WHBA 1DPMA 3AU2A 3K5XA 4XAYA 4LH8A 3N2CA 4HK6A 1J6OA 3GTHA 4C6MA 3S2MA 4V1YA 3V7PA 3IARA 2GSEA 4CQCA 4PCNA 4B92A 4G7EB 3GU2A 3IRSA 2Z2BA 1ONWA 1M65A 2HQAA 2Z28A 4DI8A 1E9YB 4LCQA 4GXWA 1J5SA 3MKVA 1NDYA 4DZIA 3NQBA 4C6IA 2BGNE 3PAOA 4ERAA 5E5CA 1V51A 2HPMA 2QPXA 3O0FA 1RA0A 2BB0A 2Q09A 2G3FA 3BE7A 4KEZA 1EYWA 2HBXA 1FKWA 3MVIA 2A3LA 4PE8A 1FWHC 4HK5A 3LA4A 2VC7A 3MVTA 4WVXA 2YZ5A 3T1GA 3S4TA 1NDZA 2CZVA 3MTWA 1O5RA 1YIXA 4KQNA 2XIOA 3RYSA 3FDGA
chains in the Genus database with same CATH superfamily
1GKQA 5I3KA 5E93A 4YCOA 3IEBA 1I9CB 4E5TA 3PY2A 3A3XA 3W7CA 3IGHX 3B9EA 3NZQA 4JTQA 3OJGA 4ROQA 1V79A 1DHPA 5BOEA 2E8YA 1JZ3A 1IIGA 3LHYA 2A3HA 4R85A 3MSGA 1HJQA 2NXIA 1KFJA 4GVGA 2GSJA 3M0YA 5I3HA 4A35A 1UA7A 5AHMA 5I06A 2HRWA 3BWWA 4WOZA 3W23A 4LC8A 2OWWA 1JZ5A 4NNBA 4JEJA 4ZO9A 1A4LA 1DJYA 3U4FA 5DANA 1DJIA 4GX8A 1Z44A 1OM0A 3ATZA 1YNPA 1A3HA 1MXSA 1YDVA 5KZMA 3AMGA 1HUVA 5EU9A 1MEIA 3KXQA 3QH2A 2VC9A 3MFIA 1QI2A 3C8FA 1FWIC 1BXNA 1AZ2A 2E1DA 3KHLA 4DEFA 3MQTA 1PL9A 4KS0A 4TV5A 3VE7A 3WQFA 3GR4A 1XSJA 2QVNA 3SR7A 1TE1A 4HPNA 2JEGA 2RJGA 4JY8A 3MBFA 3BLPX 4D8LA 2F2KA 4Z17A 3IJ6A 1SW7A 1EDGA 3A47A 4EYHB 1BQGA 1B9BA 5CEWA 5I6SA 3V0SA 5IFPA 1TV8A 2CZFA 5BXSA 1XYZA 4GUFA 4FXSA 3TV8A 3LCXA 4EBDA 3GH7A 4FBTA 1D8CA 2UVVA 3H6OA 4MDPA 1Z42A 5C8BB 4HBKA 1EJXC 2GVGA 4PA8A 2PDYA 1S1PA 4XAFA 1QHOA 2PP3A 3KP0A 3QLDA 4O4VA 1FWGC 1ZBCA 4EACA 1V02E 2F61A 4ECQA 2NLYA 2Y1HA 3SUWA 4ERIA 4I5UA 5IBXA 3PJTA 3BLEA 4F2UA 3FEQA 1JCXA 1FWNA 3TTOA 2VZOA 4CLMA 4DO4A 2QDGA 4CN4A 3W7LA 3FGCA 4UTIA 4JV0A 3SRKA 4AEFA 4HTBA 2C18A 1BXBA 4NT0A 2VCAA 3I3DA 2XYLA 4U2YA 1YBQB 3QC0A 3UG4A 4IPPA 3NEVA 4GY7A 3CV2A 1A4MA 4FOUA 4KKXA 1TTQA 4EP8C 4BKNA 1GQKA 2HNHA 3TTSA 4O8AA 4D6EA 3UYIA 3MHGA 1QHPA 3KX6A 4HZ8A 5JIWA 4WSKA 3DIPA 2D0FA 1DJXA 2PDUA 1LRNA 3WH5A 1IWBA 2V82A 1QR7A 2VZTA 4CD6A 2OYMA 4EWND 4ADUA 4C6KA 3TJLA 3DFNA 4DWSC 3MZ2A 4H8VA 5A8QA 3BAKA 2WQDA 2ZUWA 5AHIA 4IL2A 3CZEA 3SY5A 2PF0A 1CEOA 4GINA 2ASHA 2BOGX 2IUZA 3OBAA 4AC7C 1JUBA 1LQAA 2FJKA 3T5JA 3B40A 3DYPA 2F8QA 1HGWA 1TA3B 2EJ1A 4NU7A 3PBVA 3LZ5A 5HBFA 5AC7A 3T05A 3K8LA 1LLWA 3NCOA 3AXMA 1KWKA 4J2MA 4L56A 3LMYA 1OGBA 4I7UA 3RMJA 1WDSA 1AA1B 3BARA 3P74A 1OFAA 4B4FA 4PUNA 3GILA 1Q4NX 4W8BA 4RW3A 1S9FA 1WYIA 3UGVA 3MCOA 3NOEA 4ED7A 1VPYA 4Y7EA 5KMYA 3A4WA 1YTDA 3WBWA 1E6ZA 4PCFA 4HNNA 4CNPA 1O68A 4GIEA 1DE6A 3L4XA 1WXYA 3C0LA 4ZTYA 2OSYA 3AIRA 5EL1A 1E1CB 4N4QA 5DT5A 2XIMA 4JKKA 4RE4A 1M68A 4N0RA 1MXDA 1WBJA 1R9ZA 2PDBA 2J88A 3P2VA 2GOUA 1JPIA 2R91A 3TWAA 2BG5A 4N02A 1WNOA 2WMGA 4O3QA 5D38A 1JPMA 1W1VA 1X1NA 5D9OA 4ECVA 3DG6A 2BQUA 4RZ5A 3OTRA 4Y9PA 1F73A 3SI9A 2Z6JA 4XAGA 3VZZA 1RYSA 1W5MA 4W86A 4RNHA 1H0IA 1PTAA 3SB0A 3SGZA 1XLFA 4GCXA 2OGYA 1A53A 2V5KA 1RVKA 1JCMP 5LHEA 1OYBA 2ZTKA 4PTMA 3GU2A 1ZUAX 2RKXA 1FWTA 4MPQA 4HP5A 5FEZA 2W8KA 1BG4A 3Q45A 1J0ZA 3GH4A 1JPDX 5BRBA 2ZUTA 1DWIM 1N8IA 2QNEA 4O28A 3A64A 1XFCA 2QPSA 3OPSA 3GBEA 1W5PA 4NQ1A 3SW6A 4Y9OA 4F0MA 1GZ1A 3T1GA 4L65A 2ZA2A 1M3UA 4JL2A 4M56A 1EX5A 2ZXDA 3COTA 1CGWA 4GGHA 2GVYA 2AL2A 4D6IA 1ISVA 3RUBL 3QY8A 2PTDA 3L66A 1Q8JA 3AZRA 1KLYA 3E6EA 3UGRA 3GNRA 3MA8A 2WSQA 3W7EA 1VEPA 4D71A 4EXAA 4LYQA 4Z42C 3W73A 5E0CA 3KVJA 4KW2A 4EIVA 1MDLA 3NOYA 1VFTA 1GORA 5H8UA 3U7VA 2NVDA 1CDGA 1EP2A 3R0KA 3T40A 3M0IA 3W1XA 3WEMA 5BW6A 3RB0A 2PDCA 2QLYA 3LBOA 1H5YA 2H8ZA 3MY9A 4LVFA 3SCTA 5A6BA 3E1F1 5MF5A 2XVNA 3TH6A 5F1VA 5EMYA 3AS2A 3R8RA 4MNKA 1V8EA 3S6TA 1O5QA 4XISA 4CEXC 1U1HA 4AWSA 2ZX5A 4O53A 2AGKA 2YL6A 3A5FA 4TO8A 1KC7A 4LW7A 3JRKA 1JYWA 4F0SA 1DJGA 1G4PA 3RM9A 1UW9A 5AOUA 4JUZA 2PTZA 5GVJA 1UH2A 4HA0A 2BWGA 4U5IA 3EYPA 2NUWA 3GU9A 1JZ7A 3DENA 4M3PA 2E5BA 4KH2A 1ODUA 5HANA 1HFBA 1KM0A 2W5FA 3LTYA 1MRQA 2YBVA 3W24A 3SUVA 5HQLA 1TPUA 3TR9A 2YYUA 1XLEA 2EJAA 3ZSSA 1O12A 2V69A 3AUOA 3LCHA 3AXIA 2HEJA 1EWEA 1L0PA 1S39A 2PLCA 1JYVA 1E4NA 1QWGA 3EWZA 2AOSA 3TQVA 1OZQA 5A8NA 4IQDA 1RQBA 4IX2A 3N4EA 3W25A 3MUIA 1YMYA 2O4QA 4RCXA 1DYSA 1VFFA 5FESA 5C54A 3V0TA 2FLNA 4AZ7A 3AJXA 2CERA 3M1ZA 3SBFA 3VAVA 4XK2A 3CUFA 4B9ZA 3R43A 4B5VA 7ODCA 1RV8A 4RL3A 3B97A 4MHBA 3VNMA 4R27A 1OC6A 2Z2AA 5DEZA 4FMVA 1WKDA 4PUKA 3CUIA 5LNVA 5EWGA 3PZQA 3T0DA 4KIRA 4ED3A 2BR0A 1E6SM 2W0UA 1PHWA 3QQWA 5TQLA 1H5VA 5LXXA 3LY0A 4WOQA 3VMNA 2NW0A 1W91A 4DJDD 3HB9A 1JGMA 3UJSA 5KINA 3TQ0A 2V0TA 1LG2A 5F2GA 3EPGA 2WWDA 3C8NA 3NL6A 4YTQA 3CL6A 3W7PA 4HGXA 3SO7A 3W38A 3E0LA 4LUSA 4LNYA 3SCUA 4O1BA 4ACYA 1SFSA 2JEIA 5A6TC 2Z25A 2PC4A 4BQ3A 4H3DA 4K37A 3DG7A 3CMGA 1JCJA 3T0BA 3H8AA 4A3QA 3ALGA 3PNZA 1B4KA 1JR1A 4TMBA 3ALFA 3B05A 3B8SA 1YBQA 1UUOA 4IIGA 4IR9A 3IJQA 3ABRA 3ABXA 3RAOA 4LXFA 1C7SA 1CX9A 1NWTA 2EO7A 3L5LA 1XRTA 1ZAHA 4NXSA 1VLIA 2NV9A 4IUGA 3GC5A 1VEMA 3L2MA 5A3HA 1C8QA 5A69A 1TTPA 3UU0A 1JCYA 1Q6LA 4MOZA 3XISA 3A23A 2FZ8A 1Q7ZA 2YSWA 4OV9A 1F5ZA 4YTSA 1UKQA 3EPOA 1L2QA 5HUPA 4JTJA 2BOEX 1EDQA 4OOZA 1ZNNA 5HMEA 2PDQA 3DERA 4WY0A 4ECSA 3C2EA 1VFSA 3SSZA 2C19A 2PODA 3PBWA 1TPFA 2ATLA 1KNWA 5ABTA 1RD5A 1HKIA 1A50A 3BL3A 3WMBA 3FKKA 1EFZA 5EKYA 1ZAJA 4F2BA 1V0KA 2Y88A 2J6TA 3CZLA 1TIMA 3W1NA 3NYZA 3OQ8A 1CCWB 1YXYA 4C6NA 3WLKX 3LTSA 3KP1A 1IZKA 1RCOB 2E8ZA 1R9XA 1L6WA 4X2PA 3HZ3A 5DMLA 2BVTA 3WEOA 4PEEA 3NM3A 4I5XA 5LYRA 2YA0A 5C5YA 2X7WA 1XYAA 4PEKA 4J35A 4B16A 3L4WA 3M0MA 1KM3A 3UY7A 1R3QA 3MC5A 4PL2A 4GBDA 5I03A 2FH8A 3CUXA 1L2UA 5EA9A 4S3KA 5BOFA 4Q8QA 4V1XA 1B1YA 3LM7A 2ATSA 1H62A 3Q37A 4GUGA 4H7VA 5CZTA 2WPGA 4H4IA 2CU0A 1QHZA 4XZHA 4F79A 5D9PA 2ISVA 3W27A 2VC6A 5T9BG 1LWIA 4AYSA 2V2DA 3KBJA 5I09A 3GY1A 4TVUA 3LSBA 3VC6A 3SJNA 3O6CA 4XX6A 2D73A 2VT0A 5LGXA 1H2JA 4FIQA 2X8RA 3W7RA 3TNOA 3HBLA 2A5HA 4IMFA 1KR0A 1J6OA 1C8YA 1UP2A 1XLHA 3IANA 3NAVA 1H51A 1TG7A 3NGJA 3FJ6A 3IRSA 3II1A 2O9OA 3L5MA 3PR2A 4FEZA 1FX6A 4PTXA 3T9PA 1E5NA 3STPA 3VZYA 3ZWTA 4ERAA 3G6MA 4S3DA 1EHAA 1RA0A 4UUIA 3I4KA 4K1WA 3WBYA 4ZFCA 4KEZA 4AUBA 5CZJA 1W2VA 4LOCA 1I1XA 2FZBA 4C1NB 1HQTA 5CPTA 3SURA 3FVMA 3EA3A 2X2GA 3QTPA 4LWWA 1FH9A 3ZJ6A 4JTAA 4M7TA 4JQ3A 3BG5A 1C3FA 3DFHA 4IIBA 2Y7FA 2GJXB 1E15A 1CXHA 3I7RA 3WYZA 2F6KA 1HL9A 3O8AA 2ZBTA 4JICA 1RCQA 1R3VA 5BOOA 1H7OA 1FBAA 1GKPA 4PMZA 2W3ZA 3VX1A 4LBRA 1IGWA 4HSOA 4CNSA 1UC4A 4H8NA 4LVBA 3E5PA 2XFWA 1QO5A 2J6VA 4E0CA 3GE7A 2IPGA 1GT8A 4OUIA 4HNVA 3UWZA 3BJSA 5U4NA 2NVCA 4K38A 2OKOA 3LQGA 3THDA 3M4HA 4BY3A 3LQLA 1ZHAA 2GQ3A 4PL1A 4RU9A 1PX3A 4JV2A 1P6BA 3TMQA 1AH3A 2AAMA 4FPSA 1GOQA 1OZMA 3E9AA 4FF5A 4QS6A 3KHRA 3U2OA 2MUCA 2V9DA 1GVQA 4M5PA 3Q8QB 3NQ6A 1Q6EA 1NM9A 2WHKA 1EEPA 3W84A 4ZEPA 1W1IE 3MUY1 4LYPA 4O0KA 4JHOA 1TPB1 2VEKA 4DJFA 1MVYA 4MKVA 2VMFA 3TAOA 1K6WA 4JGDA 4QHRA 3O1NA 5KFUA 2ZUSA 3QR1A 1TVPA 1XD0A 4MKNA 3K2GA 3TONA 4MWAA 4J3ZA 1XWYA 3BCJA 3C3UA 3VD4A 3T2PA 3CS2A 5DCEA 1H4PA 3MI6A 4MG4A 1F6YA 5JH1A 4GC6A 1Q6OA 2XWDA 2WSYA 4UC5A 1EJRC 3H4WA 2ZWYA 1E6PA 4UTMA 5J5RA 1HT6A 1ZJAA 1YLVA 1E0TA 1TSIA 3E5BA 3MDWA 2WCGA 3WK2A 2FZDA 3RHGA 1UPPA 3W02A 1WDDA 3V6JA 3K8KA 1EXPA 3VPLA 4L4MA 3XIMA 2FFIA 4DO7A 3C0JA 5BROA 4XZNX 2W92A 5LGZA 2IMRA 2GVJA 4M1BA 1GTHA 1W3JA 4PRRA 4Q7NA 2PDXA 1ML1A 4RZ6A 3ITGA 4MKSA 4MF4A 4XZIA 4MFDA 1D3CA 1IEXA 2CLHA 3URNA 1GOWA 4F4RA 1EA0A 1UZ4A 1UZDA 3K4WA 3P62A 4P8WA 2Q8LA 5CG0A 2A85A 5CZSA 4C65A 3LOTA 4YVVA 5M03A 2HPIA 2QUNA 4RZRA 1A0CA 1XRFA 4L4LA 3RXZA 1UR0A 4AHQA 5C7HA 3HN3A 5G1MA 3LI0A 4P8UA 3MR3A 1ME8A 1F3XA 5AC6A 1UQZA 3EB4A 2R8JA 3UZXA 1KKOA 2P0IA 5JBFA 2KX9A 5JU6A 1UASA 1SZNA 2D2JA 2VL4A 4IP7A 4NL1A 3WMLA 2NT1A 3LHWA 4I5RA 3L21A 1HKMA 1F6KA 4BI5A 2Q01A 3WNNA 4HYKA 3CUGA 3ES8A 1R2SA 3B8UA 5M17A 4UTWC 1PZ2A 3AIWA 1B3YA 4GZIA 2RDXA 3EX4A 4D6GA 4GI6A 1KO0A 3W71A 3BICA 4H83A 3U5YA 1JZ4A 4AB4A 1LLOA 3MI3A 1EJTC 1CGXA 3AJ7A 1E1CA 3ARXA 1YW1A 1FFRA 1Q13A 4KEMA 4ICMA 3EDEA 2IXUA 1QPNA 3V5OA 5L1IA 3ZT7A 3UJFA 4E2DA 5D4YA 1EB3A 2PDGA 4LVAA 3VGDA 4ORIA 1QOXA 3F4CA 4PUUA 4DEZA 5ECVA 3H26A 1BSLA 4PZVA 4FNPA 3FJLA 1PBGA 4LAMA 3AU6A 3WBEA 5LA1A 2BXVA 1KFLA 2J62A 1OX5A 5A1AA 1OX6A 2R14A 4M81A 5AC5A 1VCFA 4KERA 1POJA 3H2MA 5EFFA 3B0XA 2DIJA 3AC0A 1HZYA 3OSNA 4LCSA 5DT7A 3VM5A 3NDZA 3P84A 3QHMA 3CUHA 4MY1A 1V3MA 2GJXA 3FSUA 3G0SA 2W91A 1FHUA 3O16A 2DGAA 3EXTA 4FNUA 2GFTA 5L9FA 3CBWA 3C0SA 2J9XA 2RUSA 5FF2A 3FV9A 1UR3M 3OGSA 3R0DA 3GIMA 2OYLA 2YX0A 1ICSA 2OEJA 4X9YA 5HULA 5CC3A 5DG8A 5D8ZA 3HG4A 3W7HA 5H8MA 3FHQA 3N34A 3HJEA 3R89A 3TN6A 3WMSA 3TJXA 3VIHA 3K13A 3RFAA 1P0BA 3S5SA 2FMNA 1RUSA 4B15A 3IAPA 3N4FA 4RNMA 3VMPA 4DWSB 2VP8A 2ZRXA 2H9AA 1VCVA 2DT3A 5JXQA 4GY1A 3VOFA 3BCFA 1TTIA 3THCA 4Q44A 5A8OA 2B31A 3GTHA 1S2WA 3E0WA 1JNEA 1ONRA 4CQCA 1E51A 4G7EB 2PWFA 5HJYA 2PWDA 1SJDA 3CZJA 5D2WA 4W7UA 1E9YB 1G4SA 2VO5A 2WSRA 3CWHA 4Y9AA 3ABZA 1PDZA 3V35A 4O3NA 1V51A 1XLLA 4PBGA 3TSDA 1FA2A 2VOMA 3BE7A 3BO9A 5FL1A 3GDLA 1OC5A 2RDJA 4DF0A 4HCHA 2DSKA 3M0JA 1FWHC 1EGVA 3OYXA 3LA4A 5EB8A 1E40A 2CLFA 4GH1A 3U8GA 4QQUA 4D6HA 1UR4A 4M24A 4PMOA 2G0WA 1PKNA 1UOKA 4DYEA 5C2CA 2J6SA 3NQ7A 4QDMA 3L4UA 1ALDA 3QTGA 1AD4A 2YFOA 1JYNA 3WN6A 3H23A 3PPHA 1C9DA 3MWAA 2XC9A 3IJIA 1XGDA 1Y5XA 1WDQA 2VX6A 1IE7C 2XIJA 4BQ4A 4IRCA 1GVSA 2BODX 2QHAA 4QDPA 2P5NA 4JCMA 1MMFA 1BAGA 2ZDSA 3H70A 4NG3A 4J9RA 3GC4A 1TIWA 1M9HA 1B9ZA 2X0SA 1SZRA 2UY5A 1TRIA 1LM1A 5DXYA 1J6PA 3ITLA 1RQEA 1H7PA 1KM2A 3TYBA 3B9NA 3SDOA 3BLFA 1V6XA 1O60A 2B7QA 3OVPA 4JEQA 4NJJA 3NGDA 1R85A 4JFTA 2PP0A 3WDPP 4RXGA 4LANA 4RR4A 3KWSA 1E0XA 1Q6RA 1SR0A 3WLHA 1CGUA 4R8UA 2VRJA 4QQ3A 4WXZA 4BZYA 4FS9A 3PS7A 1NH6A 4EBCA 3QSTA 4RDYA 3P14A 4GI8A 3N6QA 4TX8A 4KCTA 5KG6A 1W37A 4UZSA 4QTGA 4GC7A 4ED1A 3LRLA 2CXEA 3D3FA 5DQGA 4AHOA 2FVKA 2B7OA 1KBJA 2UY3A 4GZEA 4LUSB 4GXPA 4JZ5A 2IKGA 2ISWA 7CGTA 1SO6A 2MNRA 1TRDA 3SRFA 3ECQA 5JBDA 3K8MA 2XGZA 1XI3A 1XQKA 5A6MA 2WHLA 5AYXA 1DXIA 3A5VA 2A21A 2NVAA 1CENA 4ZQRA 5GPRA 1R3YA 3MKCA 4JBRA 4H01A 3VDGA 5HWJA 2X7VA 3S2CA 1IT0A 3VFLA 3GO2A 3QN3A 1TMLA 3CL8A 1DHKA 3BQ1A 2PI6A 1PWMA 1J96A 2UV8G 2VGFA 5KFPA 4MUPA 3I7SA 4K68A 5LIUX 4I6VA 3WJWA 3BSHA 2DH3A 3EB2A 4Q8EA 2J9YA 3OGRA 4WY0B 1A47A 5U7SA 5E6ZA 1L6YA 4UCFA 1QI0A 1XG4A 3NURA 2W63A 3VFCA 2BBFA 3B4YA 2WXDM 2HVNA 1TCDA 5AZ0A 1EJWC 3R7MA 3AYRA 1EOKA 5A8GA 3UBPC 5KFCA 3ZZ1A 3WLSA 3P93A 5KFEA 3CLMA 1S0MA 2IXVA 1OFBA 4ROPA 3QMTA 1SFJA 2A3BA 3NQDA 4REQB 1OYCA 4QIUA 2RAGA 3E0VA 3L2IA 1W54A 1S5WA 2IKJA 3BMXA 1Y5VA 3AZTA 1KV8A 3MUCA 1X8CA 1S10A 1RLCL 1XYLA 4HHLA 2YJQA 3PPGA 3OG2A 1Z41A 5CAHA 4MMWA 3R4IA 3U4AA 2PD9A 2YCLA 4I3GA 3KHJA 4MB3A 4M6UA 1ELSA 3PJWA 1P0EA 4C6FA 5FOOA 1J0YA 3M0VA 3D5HA 1WPCA 4DUVA 4XZLX 2GDQA 2JEJA 2WM0A 1TREA 5AY7A 3V0UA 3BVJA 1EYEA 4JTHA 1S0OA 3WD0A 3UETA 4DF2A 3HFYA 3IV3A 4DWSA 5SWUA 2QUTA 2GUYA 2E9MA 3K4DA 1ZALA 3N13A 2I7GA 1IQ8A 1CLVA 3SFKA 4GC4A 1OINA 3CPGA 4N6EA 4G3IA 2Y7EA 3WLRA 4QXIA 2F6UA 4J3UA 1SFLA 3QGAC 1CXIA 5HNTA 2AQOA 2VCCA 4N9CA 3LLXA 2E9LA 1OHLA 1W3KA 3OOQA 1B0IA 2GJRA 2EBNA 1YNQA 1EF2A 2O9RA 5MHBA 3W87A 4FP1A 1RJQA 4H9VA 3CEPA 3WDIA 1JZ2A 4NF7A 7PTDA 2BV9A 1IXNA 4JIHA 5I23A 4K6AA 3ANUA 3TXVA 1AFSA 4Z1BA 5A6JA 1NAL1 1XQLA 4C1NA 1BXCA 4TTUA 1RBOB 1YXDA 3L12A 1IV8A 4Y96A 1HW6A 4ML9A 5I07A 1EIBA 1XDJA 1KB3A 1REQA 1R2RA 1JDFA 4O1AA 3PZGA 7ENLA 1M03A 3MMDA 1ICQA 4M0XA 2G41A 3KW3A 1AG1O 1XL9A 3F4DA 2CYGA 4WCJA 1W8GA 4CD5A 1OJXA 2J8TA 3MR6A 1BWVA 2EF9A 1FH7A 5LNRA 2PBOA 2BXYA 5BXRA 1KXQA 2PTXA 3UQNA 2ATMA 3KOXA 3A21A 1I75A 3AHTA 1DIDA 5D03A 3QZAA 3SCOA 1MW0A 3CIVA 5HK4A 3MKKA 2WC7A 4H19A 5KG2A 1XYMA 2FB3A 4URIA 2G3NA 2EGZA 3WQVA 3NQEA 4RE0A 4S3GA 3NL2A 4PTVA 1S0NA 1HJVA 1E6XM 1GOOA 3VDCA 1DVJA 1R8LA 3FEMA 4HK6A 2OU4A 2TODA 3S1UA 4RNIA 4AG0A 1V6YA 3MO7A 2V5DA 2QCHA 3V7PA 2XIBA 3LBMA 4M8UA 3GIYA 4J3TA 4JFSA 3M41A 1XJBA 4UOQA 4NASA 2NWRA 2P10A 1F8MA 1W9VA 2QPXA 5C55A 3FAWA 4HHPA 1NVMA 2VFEA 2PDJA 3CM4A 4RX0A 5EGRA 1AMYA 4NAFA 4IMDA 2O9PA 2CLOA 2YIHA 2H9AB 2C22A 3RG6A 1QW8A 4J9PA 4G6CA 1ODZA 1B3OA 3M0LA 1WDWA 5DCBA 4BQ2A 3VABA 4HNTA 2DORA 3M0HA 4EEYA 1VQTA 1A5BA 1TX2A 1JDDA 3OIXA 3MDUA 4JD4A 1RLDA 3QR0A 2Z1WA 3SCQA 3WK3A 1T41A 2QCMA 4GPNA 1GEQA 1C8VA 4P61A 5E0KA 3A9IA 4JFWA 5C70A 2WBKA 2A3AA 3AXHA 3GHTA 3N15A 1LQ2A 4KRZA 2ABBA 1V3LA 2I1OA 4L4OA 2E3ZA 4Q3MA 3W01A 4AW7A 1J10A 3NVDA 5LXEA 1OK4A 2ZX7A 1N48A 4GFSA 4YP3A 2CHNA 4MAZA 5EMLA 4ECUA 3LSCA 4QM1A 1FRBA 2OH2A 5HMDA 4GD0A 3QZ7A 1R7OA 3UNDA 4AYGA 2OT0A 3ARUA 2J9ZA 2I56A 3ZXWA 3GQCA 3AS0A 4IPNB 4JFVA 3HG2A 4JQ1A 2DIKA 4OGZA 1T6MA 3S9IA 3L4ZA 2VFIA 4R9XA 1PHQA 2YCKX 4U6PA 5FCZA 3TW9A 1A49A 3IUDA 3OHAA 4HSNA 1WAWA 2ONEA 3N1AA 1QJWA 3UJRA 1D9EA 1TPWA 2GQ9A 3FHAA 4OECA 1DORA 1VBGA 4J3VA 2GSHA 3S3GA 4QLKA 5CC7A 1ZB5A 3PK7A 4H8UA 1B5TA 2CKSA 5KG7A 6REQA 2XN1A 3O63A 3W2MA 1DQUA 3A3WA 3VUSA 1CZ1A 1FDZA 3ARQA 1QW9A 1C93A 4UTLA 3M5XA 3L4TA 2C3ZA 1YPXA 2AGPA 2WMKA 1E9ZB 2UVWA 1LP6A 4DI9A 1MQRA 1TO3A 4GYPC 3LLFA 5JBEA 1PZ0A 3Q8PB 2HXTA 4PRWA 5MKGB 4JPGA 5DLFA 1IT7A 1XCXA 3FDKA 3UWWA 4YWSA 3TA6A 2PWVA 2Z7KA 2V4RA 1S5MA 4PBFA 4GKTA 3EAUA 3NYDA 3W1QA 1KRMA 1Z8AA 2BS9A 1J01A 4HU3A 4QJ4B 4INFA 3PJXA 4K1GA 1GOMA 4YMZA 4K7VA 3FFSA 2WB5A 3B0UX 2GWGA 3GIKA 4IPLA 1Q85A 2FVMA 1UHVA 2A7PA 3N9SA 1MFVA 3TROA 1W9BM 3PW4A 4EWJA 3PZTA 4PUJA 1VBUA 3SJ3A 4E38A 4AY1A 4ERGA 3BAWA 2J75A 2Z1SA 3OHMB 3S5OA 3C2OA 1R3SA 3GHUA 4ZE5A 4GG9A 2XH4A 4XSMA 2V6AA 4Y9NA 4AVOA 2GL5A 1CPUA 3MSDA 1AQMA 4MWAB 4G9PA 2HE5A 4TUFA 1ZCOA 1MFUA 5KT4A 3HGOA 4ZODA 1T94A 1Q65A 4I8DA 1FWWA 2F2HA 1SVDA 1DXFA 4Q8VA 3KM8A 5AYBA 4PULA 2J13A 1PSCA 5HMFA 1XS2A 1YE6A 1EC8A 2YGYA 4XBKA 3BW3A 2V67A 4QAIA 5FF7A 2C15A 4CQDA 1I2RA 3M07A 2ZKMX 3T44A 5L9XA 2CLEA 3GNOA 2OMAA 4LCRA 3DBNA 1K4GA 2YCLB 4G7EA 3JU2A 1G1YA 4Y8FA 3KBSA 4H6RA 1W6TA 1VBHA 3IIZA 1TJRA 4C5YA 3G5EA 4PTDA 4XWUA 2OCZA 4GWEA 4C6PA 4EE9A 1IXOA 4MWAD 4JQ4A 2WM1A 2JQXA 4MVAA 1XD1A 3AHXA 3A6OA 4EANA 3KHGA 2Z6IA 2BOFX 1OB0A 1XF0A 2X05A 4MAVA 1ISXA 4R88A 4ECLA 5ABEA 1T40A 4KEVA 2G3JA 2GUUA 4FB7A 3WH6A 1GW1A 1XC4A 2R1NA 4CCCA 4AXKA 3GFYA 2XFFA 3CUJA 4TTGA 1EC9A 3VXGA 3GXPA 1T5AA 1H0GA 3NNTA 3WJYA 4H9TA 2YW4A 1S2AA 4HOXA 4CNUA 1A0EA 5D09A 4XG1A 5F7UA 1QMLA 2E6DA 4HPJA 4NZFA 1FWEC 1LROA 1XGEA 1IF2A 3SADA 2GGEA 1D3HA 2FB2A 3PR5B 3ABSA 1QNQA 2YCIX 1J2BA 3EKZA 5I3GA 1GUVA 2C7FA 2DZPA 5B80A 3EEGA 4NI8A 2PPGA 1XX1A 4UFMA 4TVCA 3GD6A 4MM1A 1JFHA 5KFKA 1J79A 2FPVA 2CCRA 4WHBA 2I5QA 1BYCA 2CBJA 1TPVA 1HJXA 4KRTA 4EXQA 5LA2A 2ACUA 4Y8EA 3TC6A 3ATYA 2DT0A 3ZR6A 4XZWA 4NILA 2XN0A 5KFAA 3GZAA 5XINA 4J4KA 2YBTA 2FZMA 4C6IA 4QJ5B 5JH2A 5BWFA 3P67A 4CD8A 4Q33A 4V2XA 4ED2A 4CKQA 1SQ7A 2R94A 3W1AA 3T4CA 2G96A 3BMWA 2J79A 1QI5A 1HNYA 3WJXA 3UPWA 2INZA 1WCGA 1GJWA 2VI0A 2OSXA 1FQ0A 5F4XA 4ZOCA 3H7UA 4WSHA 2RGMA 1R86A 4RJEA 3M46A 2GOKA 1FOBA 1WE5A 3VK5A 3VI2A 1PKMA 5KEZA 3C4UA 4B3KA 4DL2A 3QOMA 3BANA 1OBAA 1BYBA 2OZ3A 2YZRA 5F4WA 3C6CA 5H6HA 5G1TA 2Y5JA 1CXLA 2EAWA 5GJNA 1W3LA 4FNTA 4W8LA 3S1WA 4NAFB 3TYCA 3FJ4A 4W5ZA 6XIMA 4DM1A 3WNMA 3LHTA 3MV11 3U9IA 2AMGA 2ZX8A 1W3HA 1A5KC 3AIVA 4HA4A 4PMVA 3RCMA 3I3BA 1IGSA 3V16A 2PAJA 2QCCA 1X39A 1WP6A 4J9QA 3TYDA 3TC7A 4XTDA 4N9BA 3D0CA 1VJZA 3O0KA 4GO8A 1KBIA 3L7RA 1U5JA 1H49A 3ZIZA 4ZMGA 2VFHA 3SCWA 1JL8A 1NTHA 4P7OA 1VIWA 3ELFA 2XZ7A 3WH8A 1RXOB 1G4EA 1UD8A 3C61A 3BXWA 4B2DA 2VZUA 2E6YA 4KRUA 3RR1A 5I3JA 3EPNA 3QW3A 3H7VA 4CNOA 3LPPA 2Y8VA 3BCDA 3ABOA 4UTHA 5FD0A 2J77A 3G6XA 3VNLA 3W81A 4QAWA 1O1ZA 2YL5A 3WNKA 4HOWA 2X16A 2C91A 3K1GA 4JIEA 1SZFA 4F2TA 3W85A 1ZJIA 4AIUA 1AW5A 2PRLA 4QW9A 3L9CA 1EJUC 2JF7A 3R13A 5CXPA 2QCLA 4Z2IA 3K1DA 4QGCA 2UY4A 2QAPA 1WUEA 3OVRA 4KWVA 4EPEC 1E56A 5JUMA 3UG3A 3CAWA 1LUCA 1GG0A 1IT8A 1TE6A 3R0UA 3BV4A 3G1XA 2PMQA 1C91A 4TU1A 3TMLA 3VIJA 4IQJA 3UR8A 4REQA 3CAKA 3KEHA 2YBUA 3AISA 1YNYA 3SM0A 2ODOA 4LRSA 1ZS2A 5DN1A 3BQ5A 3N18A 2E9BA 4DXVA 1KFKA 1FWCC 3VX0A 4FO4A 6TIMA 1E73M 4D8ZA 3F5KA 3WDJA 1ITCA 3EKLA 3P8JA 2TRSA 5DMYA 2DIEA 3N6JA 4MGGA 1V6UA 3T09A 1YQ2A 2RJHA 1TX0A 1BKSA 3PW7A 2KZHA 4JXCA 1TB3A 4HU4A 2ALRA 5GJMA 3W6YA 4CEUC 4U33A 1X7FA 4CNTA 2PD5A 1IIHA 1O5KA 3NZ1A 4ATLA 4AMCA 2ZVRA 1BG9A 1KBBA 1XLKA 3EOLA 1EXBA 2GZXA 7A3HA 4JN6A 5EPDA 3QZ6A 4O15A 4HSHA 5AYYA 4K7YA 1SYTA 1BVWA 3W7OA 3OBEA 3UG8A 3F4NA 2INFA 2ZRZA 3BPWA 4JTSA 4H6QA 1F61A 1UWAA 3A9BA 4EVZA 5G2IA 3ARSA 3CHCA 1UH3A 3UY8A 1K8CA 3ZJKA 4U5KA 2RDWA 5L1KA 3WD2A 2WZEA 5FEPA 1NOUA 1SMAA 4N9EA 1U83A 4IM4A 5C6MA 4L7ZA 5CGTA 3U48A 3VOGA 3ZLHA 3SY1A 3LS9A 1MEWA 4XTIA 3CZKA 3SIMA 2TSYA 3UWYA 4GNKB 3N4AA 5LHFA 1NFGA 1TWZA 2Q71A 3TFXA 1REQB 4F8XA 3DGBA 2XUCA 1Q7MA 2B7PA 4ZOAA 4DRSA 3WEZA 1PPIA 1Z69A 4F50A 3C0QA 4DJEA 3NO3A 3GV8B 3HG3A 3M0ZA 2NQZA 1XIEA 2H8XA 4MJZA 3C3NA 3MYOA 5D32A 4OTKA 4AVFA 2SFPA 3TN5A 1TZ9A 3S5ZA 3CHEA 1XR2A 1RQHA 4UR9A 1M7XA 1SZEA 2WJDA 4M1RA 2D2HA 1H7WA 1FCQA 2DQWA 3GNXA 4YL2A 1TKKA 3Q58A 3O6AA 4PRTA 4Z2JA 1E6QM 3CC1A 5ECUA 4UWMA 3WL1A 3M7WA 3B8TA 5KTLA 1EOMA 3EWYA 4LEQA 5DBTA 5M5DA 5IDIA 1R3TA 4FNSA 1ISWA 3VKKA 1NDWA 3FYYA 2R8HA 4H9ZA 3WD3A 1E4IA 1W3TA 4UQEA 1EBGA 4DHGA 4GYFA 5DGBA 3UF9A 3ZT6A 4YQWA 1E9LA 1F6PA 5IHRA 2EPHA 2FTWA 2Q02A 1XPGA 3A3HA 5KFJA 2BXZA 5AVNA 3SGGA 2WLYA 3GLCA 4WDUA 3T5HA 2OTDA 2ZX6A 2RGLA 2FDMA 1OCJA 3EKGA 4FI4A 3ZR4A 3G24A 1RD6A 1H11A 1V08A 1XFBA 3CPUA 4Q8OA 4DBWA 4JDYA 4OVXA 5HNNA 4PMQA 1DBTA 2D3LA 3CO4A 2QV5A 1AUSL 2ASLA 2ZFAA 2VENA 4PCNA 5CSYA 4I7WA 1J8VA 3UXAA 2Z28A 3HJZA 4DZAA 5I24A 5M3WA 1D7KA 2XTKA 2QJNA 1XH0A 3BLOA 4C7GA 4RE3A 2HSAA 4O16A 3DHPA 4MZYA 2HBXA 5M2FX 4MDOA 2WKJA 1UD5A 1DJHA 5LZLA 2DSUA 1KXVA 4ZTXA 4F4YA 3S1VA 3QV7A 1JX4A 4KQNA 3NR0A 3WQOA 3FDGA 4R53A 1UWTA 3WJZA 1KFBA 1ZSXA 4CN1A 1J4EA 1TR1A 4ZENA 3PFMA 4CUCA 3CO8A 2BP1A 4GCAA 1PYMA 1XUUA 4JTGA 4L9YA 3DZ1A 4A8NA 4L80A 4MSSA 5LIYX 3GVWA 2WCSA 2PLJA 1GQNA 1WKEA 2PWGA 3UVIA 3VNJA 2OEMA 4S39A 3IACA 2DZWA 4GJIA 5D37A 3EDKA 1OFPA 2RFGA 1UMLA 3I6RA 1TJ2A 2JE8A 4IF2A 2D0GA 5EMJA 2PWEA 3WO8A 3D46A 1XXXA 3V3WA 4H6KA 4DBDA 4JKMA 8CGTA 2AGQA 2W9BA 1K1QA 4Y2WA 3LPGA 3MFHA 1YYAA 4HZ6A 4AWTA 4UCGA 4GGBA 4X3ZA 2DY3A 1X97A 1HJWA 3PZIA 4H9UA 1Z7AA 1PUDA 3UR2A 1UBSA 3IWPA 2WZIA 3S1XA 2G37A 2WC4A 4AZ5A 2QR6A 4L9XA 4O54A 2BGQA 2QJHA 2VRQA 4H41A 3R2GA 3ITTA 1N55A 3UNTA 5I02A 1SJCA 1PYFA 4Z2KA 2XZ9A 4H6EA 4M82A 3L0GA 1ITXA 1VC4A 4UTTC 1LG1A 3H21A 2DZVA 2A6NA 4IP4A 3LMZA 3PUOA 2CZEA 2PDIA 2R1PA 2R6OA 4QBXA 1TFVA 3WF3A 2FZNA 2BMBA 3CAQA 1NP0A 4IG2A 3P82A 4OHQA 3TC3A 3EWCA 4DJDA 2X1IA 3LGEA 1UIOA 2G97A 1A5AA 4WQ6A 3G1AA 3T78A 4PN2A 1JRCA 1AW1A 4CQ9A 4LC6A 1UWUA 2VTFA 3R6IA 1EJSC 4NAEB 4BK9A 2NLIA 5LNSA 4ORMA 2BX7A 4GO9A 2POTA 4XV0A 1RJRA 3FYPA 3Q65A 1UD3A 3ARPA 1EX1A 3TYZA 2IPWA 3H2EA 4ZQNA 1R46A 4IGNA 4UZUA 2GDVA 2JIWA 1JG9A 1W5OA 1EO5A 6CGTA 2VURA 1VPXA 3FNDA 4KWOA 1BVNP 1F74A 1HXJA 3F4VA 4BCEA 2J8FA 1VF8A 2PGRA 3STFA 7TAAA 2YDQA 4HOZA 1TUXA 3LEPA 9CGTA 1KFWA 3GYEA 1U2YA 1A5OC 2CLLA 3CPRA 1VFHA 3VDAA 1R30A 1TA3A 2Y85A 5FAJA 1HIZA 2TYSA 5D2VA 1US3A 3FK4A 5TBOA 4B5UA 2XVGA 4Z0SA 3D3AA 3S42A 4JIQA 3U0HA 5L6UA 4R7OA 3IJLA 2QJGA 3HMCA 3KVMA 4G1KA 1O6IA 3V6KA 2I9UA 3KCLA 4MNJA 3SCVA 1MNZA 1UCWA 2D22A 1GCYA 4KWSA 3M0KA 5A6SA 4KCUA 3VGGA 3R25A 4MFEA 3WJSA 1VIZA 3WDQA 2XGIA 1K3UA 1D3GA 4X61A 3LI1A 2IA6A 2AKZA 4O1EA 4QEHA 5KG3A 5G4WA 1HJSA 2P9BA 1KWGA 4M80A 3PG8A 3UJEA 3M5ZA 4B90A 3KTCA 1RCXB 2WW5A 1NY1A 2GGHA 2V30A 5CPOA 1MUWA 1Y8BA 5CZKA 3DFQA 2V3DA 3HM7A 5EBUA 3LXBA 3KRZA 1JI2A 4YCPA 1RALA 3KUMA 4ML4A 2EQDA 2O55A 3E74A 2ZWZA 5L1JA 2C13A 3QZEA 3SECA 3QPEA 3BAJA 4WJXA 4RE2A 2J78A 2YCEA 4DWDA 4QE5A 1KTCA 5CPQA 4PTWA 4B91A 3KDOA 3MCNA 3TCSA 3DI0A 4FS2A 3VIIA 2DSWA 2PRHA 4CQAA 3WF0A 4ECTA 4HKPA 3UXDA 3PTDA 3V18A 2VOTA 4MYXA 4ASTA 2AGOA 4IGMA 1EZWA 4LAOA 3FY1A 3LZ3A 3S9ZA 5T26A 4Z1AA 3F2CA 5AECA 1G6CA 3G1YA 2WWCA 1W32A 2FKPA 1MI3A 3CYVA 3QF0A 3EX3A 3EOSA 5C7VA 2X30A 1DWGM 1DJQA 1E1FA 3BTNA 4JIPA 3CH0A 3EDJA 1WA3A 4IJCA 3RX3A 1A3WA 3S8HA 4B5WA 2OVLA 3DHFA 3LCGA 4XD3A 1RPXA 4DYJA 3K5XA 3QW4B 3N2BA 1OGGA 2DZSA 5LSMA 3W1RA 1GHSA 1P1XA 4C6MA 4MJ4A 3LERA 1X6UA 4GQBA 1JZ8A 1H41A 4AD5A 1ECQA 2V8ZA 1ONWA 2HQAA 5F2IA 3APYA 2PBGA 3EX1A 3TWBA 3DKJA 4YVXA 1UOZA 2R8KA 5G2HA 4HT3A 4JTUA 3KHDA 2ZADA 2C28A 1GQJA 1LWHA 4PFMA 3W7GA 2J66A 1FKWA 1XDMA 1XIDA 1JRBA 4PE8A 3PHAA 3T42A 1T3NA 2YKKA 4UIOA 3QV8A 2QV4A 3BOLA 2PZ0A 4EPBC 4UTTA 4O0ZA 1NSJA 1P48A 1XIMA 3LYEA 1TJ0A 3W6MA 4FALA 3GRIA 1LCOA 2VELA 4J9LA 2C71A 1HP4A 2V5LA 3PF3A 2EEXA 5KFNA 1G0CA 2WMFA 3E2QA 3P8IA 2NSXA 3R5EA 1U1UA 2ZC8A 3W4RA 1HKJA 2VQTA 3ZJ7A 1XIBA 3V75A 1FXQA 3UZWA 1FFQA 4CCEA 1X1OA 2QULA 3LK6A 1EPVA 2XCPA 2YA2A 2AL1A 3BUVA 3GG1A 2W9MA 3N6HA 3NJ3A 4IIEA 1AJ2A 2F6XA 1IXQA 4J40A 2E68A 3L0KA 4PMJA 3VIMA 2DZTA 1ITQA 5CLTA 1KRBC 2IS7A 1V02A 2GYIA 3R10A 3ES7A 4IL0A 4QROA 1BYAA 1OADA 1I8JA 4GX9A 3GS6A 6REQB 1AH4A 4MNMA 2UY2A 2DT1A 3ZO9A 2A3CA 5BXTA 3CJPA 1PZ3A 2FQIA 2F38A 3VO0A 3FJNA 3EWUA 3LENA 2ZRVA 2AKMA 4S2CA 3GR7A 5DQPA 4N4PA 1K9DA 5A2BA 1UH4A 3H4BA 3GAKA 1XCWA 1LJYA 3R8HA 1JCTA 2DZXA 1DJZA 5BU6A 1SPQA 3M43A 3M7SA 5DBUA 5D9MA 4Q7BA 3BH4A 3G1FA 4O1FA 3ANVA 3H55A 1ZLPA 2FMOA 4JV1A 2ISSA 1S2VA 2W27A 3UPMA 1LYXA 4GFIA 1HG3A 1GKRA 4IWWA 1L6FA 3EX2A 3I6TA 3WUFA 1P5BA 2XM1A 1UD4A 1QOPA 4XIAA 4AZCA 4MY8A 5FEWA 3UYCA 3F2DA 2PU1A 2DFAA 3CNYA 3V36A 1F9CA 4C6OA 1VFMA 2QJIA 1XICA 2HTMA 3UT0A 3WQ4A 1BKHA 1BEUA 3U7BA 3N3TA 4Q4OA 3GK0A 2ZZ3A 4Q7IA 3L4YA 1RPKA 1UWQA 1YKWA 1GTEA 1QXLA 3MMTA 5KFLA 2EPLX 1XCFA 3E3HA 1XIGA 3FVDA 4KETA 1V5XA 1NIUA 4IIFA 2DJLA 1HKKA 4IH3A 3DHDA 3ZVIA 4J5NA 3PZMA 4R3UA 2CHRA 5GQBA 2OQHA 3EOEA 4HB7A 5CBJA 1BFNA 1HTIA 1JXLA 3EPMA 3KFTA 1TELA 4GVIA 3U3HA 4WY0F 4E6MA 3NXFA 2VGBA 1S38A 4HMCA 4IIDA 3EMZA 3STCA 3LHVA 4BI6A 2EXOA 1ENUA 2YXGA 1ADOA 1EUAA 4V28A 1JIBA 1XLGA 4IFKB 3ONCA 2EG8A 3WD1A 1MQPA 4ACZA 2I17A 2VUYA 3HTWA 3C2YA 1JVNA 1E55A 3NQFA 1LUCB 3RBDA 1XIIA 1RA5A 4DJFC 4O13A 1BQCA 2POZA 3EWDA 2DW6A 3FDSA 4HN8A 4O11A 2UVRA 1P7TA 4S3JA 4ZE4A 1MSSA 3EWBX 1MZHA 1A5UA 3STEA 3LGDA 3UFYA 4A3HA 3VUPA 3E38A 1E3XA 3SY8A 2OLHA 1QW7A 3QHNA 3JS3A 3T0AA 2ZZ2A 3P7YA 2O7QA 2CBUA 2VA3A 3BJYA 4BJHA 3ORWA 1V6TA 4MADA 1OVDA 1KTNA 2A7RA 1R0MA 3VGEA 3SUTA 2VFDA 3PZVA 3OHIA 4JTFA 4YU1A 1GZJA 4BR1A 1DWFM 3A4AA 5DELA 4AVNA 2HNEA 2C1GA 1VEOA 2GQ8A 1OIFA 4H2CA 4AC1X 2QMKA 4TIMA 1L8PA 1UWSA 1IXPA 1RZMA 3G0XA 3QYSA 2OYKA 5CBIA 2WNQA 2Y63A 1FKXA 2DZUA 5G4EA 1K1DA 1OCBA 4I9TA 5FA5A 1GK8A 3BQ2A 5GNYA 4YYCA 4U3CA 4UTKA 4FZIA 2DZBA 3W82A 5EY5A 3WZ0E 4GQ0A 4GYKA 4H7CA 2XGQA 3VGFA 3GUGA 2W61A 1EWDA 3DGRA 1KKRA 1K7XA 3WQCA 3E49A 4I90A 3CK5A 1XBYA 2X1UA 3S5YA 3N2TA 4JIRA 3H2AA 3W7NA 4IMCA 4HCDA 3BC9A 4FOKA 4O17A 4YNGA 2W9BB 2Y89A 2YB1A 4ZZ9A 3URBA 5FSEC 3NUKA 3AALA 1UB3A 3CYJA 3RPDA 4MJMA 3QFWA 3T2QA 5DG9A 2DSZA 3PTQA 1XPYA 4R8UB 2JGYA 2CLPA 1CIUA 3HOJA 4IICA 1TV5A 4IR1A 1LOSA 4JQAA 4XB3A 1LDCA 4G7FA 3GVRA 5KFSA 1TR9A 4QCEA 3IGSA 1K7FA 4C7FA 3NQGA 3V5CA 4KFNA 1W2PA 4C90A 2ZZ1A 2YLAA 4WVXA 5I79A 3MVTA 2YZ5A 2R9RA 3W7IA 1DTUA 4GH3A 5ABFA 1W9DM 1SMDA 4XVDA 4A6GA 3U57A 4FA3A 3CB8A 1Q45A 3KOFA 1OFRA 4ENLA 1QU4A 2HV5A 3N2XA 2Y6ZA 2HZGA 3AAMA 4DLMA 1PWLA 1NU5A 1TVLA 3MP3A 3VNDA 5LKYA 1E71M 1I1WA 5CZ0A 5KFTA 4ZQPA 5T91A 2IKHA 4S3CA 1RAKA 4X63A 2DSVA 2UZ9A 2V5JA 2CWXA 2I5IA 2VEMA 3IUIA 3RMEA 1HVQA 2W62A 4EPKA 2OO6A 1K03A 3RCNA 1ME9A 2OGJA 3VDHA 3MB9A 1RP9A 2D69A 3RNDA 3WFAA 4CD4A 5IOBA 3GC2A 1BTCA 4F0HA 5CJNA 4WD0A 1RBAA 2Y2WA 1O4UA 3EA1A 5TD4A 3ZLFA 5I2UA 4O50A 2ASJA 1U30A 4PSPA 1FCUA 3AIQA 2PLMA 2DP3A 3ZFHA 3VZXA 4K2SA 4DVOA 4AIOA 2QCDB 4TQTA 2C1IA 3Q94A 3GU1A 3KS5A 4IQLA 4QFUA 3OVGA 5A8PA 5J5DA 3GX9A 1RR2A 1E1EA 4K3ZA 2GK1B 1WX0A 1NQ6A 3KLLA 1ITUA 2J6UA 2OZ0A 3UWVA 1V3JA 1P4CA 2XVPA 4UQAA 4TVDA 4JHMA 3WQ5A 2VZSA 3QR3A 3WLMA 4O12A 3GXFA 1N7KA 2E0PA 8RUCA 1G4TA 5CKSA 2QJMA 1P0KA 4GIYA 2ASDA 3EGJA 1OABA 3TKFA 3IPWA 2PE4A 4HTYA 2J4GA 4NZ3A 1A5MC 1Q6QA 4ATDA 3ITCA 4QWAA 4JTCA 5LIWX 2WYSA 3T7VA 5G4HC 2QUMA 4FLQA 2WNNA 4IQEA 4LS1A 5HAOA 1ME7A 1Y7VA 2PDFA 3AZSA 3MANA 4AZHA 4W87A 3L23A 1YPIA 5I3IA 4O0QA 4DLFA 2PDKA 2XINA 4GI4A 2BQRA 3LHZA 4BF5A 4Z2LA 3H2NA 2VDIA 2WQPA 3QHOA 2B0MA 2Y5SA 5D33A 1T99A 4NZ1A 3W2LA 4FR6A 4XAZA 1CGVA 3CZGA 1V03A 1CNVA 3ZWSA 3OYZA 3LXAA 2V3EA 3QYQA 5H2ZA 2HDJA 3G1SA 1E4LA 1EDTA 3CH9A 4E8CA 1XLAA 5FJIA 3WBAA 3LPOA 3GDMA 1EJ7L 5FJOA 3UP8A 4F0LA 1N82A 3HO8A 1S46A 1SJAA 4IFRA 2C8NA 1VFOA 1VAHA 1L6SA 3H12A 4L1XA 1UA3A 3RLGA 1WOAA 2AMXA 2FZ9A 5ABHA 5BZAA 1R2TA 3PSVA 1W1B1 8A3HA 4D8AA 4GQRA 3B9AA 1JIHA 2HS8A 3PW2A 2YL9A 2E25A 1FUYA 2A0NA 2VXNA 1UUMA 1J11A 4DZHA 3GG7A 3LV5A 5J8LA 3MP4A 1O66A 2NQLA 3O15A 1C7TA 5C2XA 4OFCA 4AAJA 1CLXA 4O3OA 2OFJA 1EJVC 4TX9A 1PO9A 3PTMA 3K46A 7XIMA 1T8XA 4UFHA 2YXXA 1CXEA 3WNPA 4XZBA 5JQ9A 4AD3A 3RPMA 3NDYA 4K36A 2FTYA 5A6LA 1DL3A 1I60A 1G5AA 3WF4A 5A2CA 3PWIA 3CT7A 2DPJA 3B8DA 1OC7A 3BLLA 1UR1A 4FAMA 3KOYA 5EDWA 3QZ8A 4ICNA 4C5ZA 3GH5A 3O6YX 4LNCA 2QAFA 3G3DA 3QMRA 3PTKA 5H1WA 4YPJA 2CPUA 1WKYA 4FLSA 1B2YA 1PJ9A 4BEQA 2DT2A 3GTIA 4ACZB 4WIWA 4YR2A 2P50A 1LTDA 1TMQA 3EXRA 1R47A 3MSRA 3W37A 3WY1A 3QY6A 1J18A 4NJHA 2VD9A 4NJKA 4ZOBA 4BWLC 1XBXA 3GNNA 3JR2A 2XH2A 4Z1YA 1JAKA 5TAOA 1CBGA 2Q3OA 1Z3NA 3VC5A 3VYLA 4Q8FA 3TP4A 3W86A 3VGBA 1UUQA 1KM1A 4L1GA 3HQPA 1Y5WA 4UFJA 1ZTVA 3WENA 1UWRA 2JEPA 3CQ0A 2G95A 1TJ1A 3AMLA 4DO6A 1EEXA 1WDPA 2R1MA 3ARWA 1W8SA 1G7UA 2QMJA 2ZUVA 5EBAA 3DECA 2HE8A 3CASA 2QF8A 1AODA 3HPZA 3LM3A 4JTDA 1B90A 2OZ8A 1XISA 1VRXA 4WX2A 5G1YA 3TFCA 3KBNA 3IJ9A 1UWIA 2ACQA 2VCBA 4Z1DA 2Z1KA 4LY4A 5BRPA 2LLEA 3L67A 1GG1A 4JN7A 4CU7A 2GGIA 5GNXA 1D7FA 3TAKA 4FF7A 3CGTA 3NG3A 5KG5A 2INEA 2ON3A 3G8RA 3THUA 3H40A 2HJPA 1OCNA 1HVXA 3ZJ8A 4RXFA 2AQ4A 2BQ3A 1H60A 3GAYA 1EYWA 4OV4A 5DRCA 2DZAA 2NQ9A 1LL6A 3MVIA 3BGGA 9XIAA 2GPTA 1O5XA 1CB2A 1WXJA 3N19B 3U2ZA 3UWEA 1ZP4A 4F66A 4PCTA 3UG5A 5BRQA 3UD6A 5AC8A 2F84A 1YIXA 6ALDA 3ZSTA 3TJIA 3E12A 3PG9A 4UNLA 4GQGA 1Q2SA 5DRIA 5GNZA 4XZ9A 3UA3A 1KCZA 3DXIA 4ZA0A 2HVOA 2VVNA 1TPEA 4QWEA 3O9NA 1M7OA 2XVLA 4HN4A 4B5NA 4PMUA 4X2RA 1LRQA 1RK5A 1QT1A 2ZRUA 4QCFA 2J47A 3SCNA 1EZ2A 2H6RA 2JFEX 1TWSA 1JQVA 4IIHA 5AFDA 3BW4A 1FWJC 2QIIA 2YXOA 3PUDA 3RBEA 2IBKA 4TR9A 2W8LA 3QPYA 2VVSA 3IGUA 2NQJA 3MMUA 2BVYA 3HQNA 3LHUA 1UR2A 3EX6A 3QBUA 1QBBA 1PDYA 1B3ZA 3CB3A 1OF8A 3REQA 1I2NA 3FX4A 3F5JA 3OHBA 3ME3A 1XINA 2BVWA 4O10A 4U10A 3SQLA 3VILA 4LX4A 3GIQA 3H24A 4XD5A 2PB1A 3CHDA 4E2BA 1VYRA 4IJBA 2J7HA 3QFEA 3UZZA 1H7XA 1XSIA 3IV8A 4MUZA 3POHA 4PMDA 4AFYA 1VFLA 4RNJA 4JR5A 4UTJA 2XIIA 1A5CA 4OT7A 2VFGA 4JTLA 4IG2B 1E6NA 4FXRA 1IZJA 3W1LA 2QIWA 1GPWA 3PWGA 1ZETA 4ADSA 2H3DA 2J25A 4ZB2A 1BWKA 2J7FA 4PUDA 1S3TC 2CETA 2PC8A 5KFIA 5EWFA 1KCKA 3PANA 3CIXA 2P53A 3MP5A 3WBXA 2FGLA 3GNDA 3NL3A 3C2VA 3PB2A 2OXNA 2VEGA 1AZ1A 2QXWA 2WHJA 2JK2A 4HNCA 3PFRA 1I0BA 4PMXA 3KRUA 2VUNA 1V4YA 2DUXA 3ARZA 1EBHA 1MXGA 1A5NC 4DXKA 2A79A 4YVPA 4E8GA 1F3EA 5DLCA 1CGYA 4QG8A 1PV8A 2QF7A 5KFXA 1YE4A 1WQ5A 4B5SA 5T14A 4HHMA 2B4GA 4WLCA 1OIMA 3FLUA 1E43A 5E70A 5HPOA 1W3NA 3TOPA 2ZC1A 1T96A 2Y70A 2Z26A 4NUWA 5KFDA 1KGUA 2Z1BA 4XO6A 4DJDC 3TOYA 2I14A 4MIMA 5DO8A 3K30A 1UIPA 3BV7A 5D05A 1OYAA 5E0FA 1HX0A 2XJ7A 2V38A 5B7ZA 4US6A 1Q6FA 5HQMA 3UXIA 1L9WA 4JX4A 4QDWA 4C7DA 4DF1A 1S2CA 3RLVA 3CT2A 1AQ0A 1SO3A 1KRCC 1ZFJA 4NRSA 3KWXA 3W75A 2V5BA 3R79A 1P6CA 4I8YA 3ERPA 1DQWA 3IIPA 3VOJA 3AIBA 1F2JA 3GDRA 1H50A 2ZXQA 3TYEA 2D0HA 2D3NA 2G3IA 1GW9A 3TTEA 4G56A 5H91A 1HJUA 1W1PA 1XV8A 3HU7A 2ZE0A 1XIFA 4KGLA 1OX4B 2NV2A 4CU8A 3JVAA 3GBDA 3QPZA 2TPSA 3W2KA 5KZEA 5HXMA 3W2NA 2WZMA 3MHFA 3P5ZA 2QYGA 1J12A 1EGMA 4LUYA 2JALA 3TXZA 5BXPA 5FI8A 1I45A 2OPJA 3VOIA 4LT9A 3QC3A 4QLLA 4FSAA 1OSEA 1M7JA 3NO5A 3BURA 2NQ5A 2X42A 4O52A 3UPBA 4Q4SA 3OODA 3EBVA 5D2YA 1LWJA 1XRSA 1Q66A 4QITA 3CHFA 5G5IA 3ZM8A 3BDKA 4QLJA 3TLLA 5F2LA 3STGA 2IW0A 2Z7GA 4U31A 1Q2RA 1XW8A 1FCVA 4FHAA 1ZP3A 4L6DA 1B4EA 1DWHM 3MJYA 5AKQA 4HYVA 2ZRYA 4WZHA 2YDSA 2E1WA 4NYYA 4WF7A 4TV6A 3PUGA 4EAYA 5FF0A 1X6NA 1XYFA 5REQA 1BYDA 4JNYA 4JYEA 2OLAA 3W29A 4NRRA 1KCXA 1P0NA 3M64A 1RY0A 5JIPA 4B5TA 2CIPA 3OBKA 4K39A 3WG6A 1LOLA 1OK6A 3WH7A 3EDDA 4NI3A 3FOKA 3DU0A 4GYPA 4GBUA 3EZ4A 1IYXA 4QWBA 1TZZA 1SFTA 3IN5A 4DM2A 3FW6A 2EPKX 3PZPA 3A4JA 1UG6A 2Y62A 3OU8A 5TNVA 5HA7A 4AWEA 2OLSA 3DYOA 3ONBA 1GGOA 1C8XA 1TWDA 2VRKA 3LLDA 1MW2A 1HL2A 4NIRA 3L68A 4IPJA 4J2PA 3R94A 1V0MA 3IRDA 2PDLA 1W1ZA 1H09A 1QBAA 1VJIA 5CSSA 3UESA 4PUWA 5IDZA 4PMYA 5C9UA 2REQB 1KBKA 2X1RA 2Q6ZA 3LG3A 4LV9A 2NX1A 5EWEA 3AI0A 1ZY9A 4RZBA 3M5YA 3NQAA 3UCCA 4HK7A 3PP7A 1S5TA 3T55A 3HURA 2J7DA 4DBEA 3VIPA 4PYSA 3UJ2A 1KA9F 2QVHA 3S2JA 3N17A 4D9PA 3M47A 3OLEA 3GFXA 2WHMA 3RRXA 2QUVA 4TMCA 4FXJA 4YN5A 4UFKA 4CNNA 3FIGA 1JDAA 1G9HA 3ABQA 4B92A 1SM9A 1YPFA 3JUGA 1VP5A 2E67A 5E09A 3DFTA 3PW5A 4LCQA 1G94A 2BGNE 9RUBA 3WLLA 1K1SA 1IZCA 4HJFA 2W79A 4AZBA 1Q6GA 4MWAC 4YR0A 3VNKA 3THQA 3NQ8A 4POCA 3TVAA 3F1QA 3SIZA 1HL8A 3TQPA 3UWUA 3DFOA 1BSIA 1WUFA 2QZRA 3S4TA 1NDZA 4HNLA 4WDTA 1PE1A 2JKPA 2XIOA 1U22A 3LBCA 3APGA 3OGVA 1UP0A 1VPQA 1FWAC 1JNDA 3LDVA 3W2UA 1OEPA 3BZGA 3M6DA 2Y8KA 1LBLA 2NUYA 2CLKA 4JY9A 3RX2A 2VQUA 3BLKA 1SO5A 4QS5A 4UMAA 3GQYA 4FLOA 1YTEA 4X60A 4HYRA 1BVZA 5BNKA 1UKOA 3H4XA 3PPFA 5HDRA 4W4QA 1XM3A 2DPIA 2OJPA 4Q4MA 3M44A 4IXHA 2HCVA 3W7KA 2R1KA 1C29A 2XSXA 4HZMA 5HJLA 1J2WA 1JF6A 1E72M 1XYBA 3QOKA 1V0LA 1O7AA 4AF0A 3N12A 3W7DA 2ZZ4A 1VHNA 1TWWA 2D24A 3VIGA 2FGZA 3OLDA 2VX7A 4JTEA 3KCJA 2ALDA 1RK6A 4OZOA 3GGMA 3OW1A 1ZL1A 1V3KA 3AHZA 3GDBA 1NFBA 4BF9A 1XLIA 1EC7A 1ONEA 5FSDC 1DIOA 3WQGA 2PDMA 1WXZA 2ZUMA 1KLZA 2PLKA 4LU0A 3K4AA 3INPA 4FBUA 1SUXA 2GJLA 3I4EA 1CXKA 1FVPA 1G01A 4WKAA 3KL3A 2WTFA 1ESWA 3E2VA 4BHYA 4Q8TA 2TMDA 2WOQA 4ILSA 4F4XA 3VGHA 3ENLA 3NZPA 4CVWA 5KT5A 1O94A 4HMDA 4E2OA 3CMFA 3WDRA 3RLUA 3OP2A 4WSJA 4UNIA 1S97A 5DGAA 1UZHA 2XN2A 2BGSA 3W83A 3AICA 1ADDA 3M5VA 3W07A 4ZOEA 2ZUUA 3NGFA 3CEUA 4FNQA 4AZ6A 4UB9A 3HG5A 3VVGA 2XHYA 2WLZA 3VIOA 4LBSA 1J5TA 3SUSA 5GJPA 3KS6A 4KBXA 1FWBC 2WBGA 4IMAA 2PCEA 1UMYA 1LT8A 5KFOA 4EKJA 4XUYA 4GZ7A 5FEXA 2FHFA 4LV4A 2Y8UA 2HISA 4WDXA 1QRQA 4MY9A 3TN3A 4ZO8A 3Q8RB 3N73A 1H63A 2X0HA 1PZ1A 4DUWA 1WZMA 2QJJA 1BD0A 2FTPA 2QCDA 4DB7A 3VCNA 1JDEA 1OD0A 1FP8A 5FJTA 1EKOA 1IEVA 4IFKA 3FSTA 2VDGA 5BMXA 1NDVA 4DYKA 1F3WA 2VX5A 3DAQA 4GVHA 2OZTA 2CHOA 2RDUA 5HNUA 1XLJA 3O6DA 1W5NA 2WVVB 4PTNA 5HUOA 4JYDA 3DUGA 1S2UA 3DBPA 3URQA 4GUHA 2P3EA 2YLLA 4HHHA 4GNVA 4L6OA 3MPGA 1SSDA 4DX3A 1V0NA 2OEKA 2BHUA 4M6PA 5ABGA 2Q8XA 2EHHA 3I7QA 5D2XA 3N14A 3S46A 5DFAA 4YS1A 2CITA 3W0KA 2AU0A 3CTLA 1VJSA 2WNWA 4EX4A 1ZZMA 1PAMA 3BG3A 3F2BA 2VWTA 3TYUA 3EMQA 1OT2A 2QGHA 1B31A 2BVDA 4DUOA 2FLIA 3BOXA 2GVLA 1ZPTA 1V7YA 1P0DA 3B8WA 2VR2A 1F8IA 1OX4A 4BEUA 4BA0A 4GA8A 2QPUA 1S1RA 3W3OA 5KFYA 2DDXA 4PB3A 4S3FA 3SN0A 1DWAM 4ZO6A 1DXEA 2CEQA 3KVLA 1FP9A 3EB3A 4J1OA 1PKLA 4HQVA 4E8DA 1AK5A 1WZLA 3FA5A 3R1ZA 2UWFA 3S0CA 3NXLA 1KM4A 2WJEA 4C6LA 4RV8A 2FHBA 3VA8A 3QLLA 3LXCA 3MV01 3FN9A 3LUTA 4JOMA 3RR4A 2Z27A 3FAXA 3T5KA 2Z4GA 4C6CA 2RH9A 3NSNA 5DG7A 3P0WA 3EPIA 3DC8A 3SUUA 5FIPA 4ZR8A 1E4MM 3PM6A 4YIWA 1M5WA 3IUHA 1DIEA 3DOPA 3NQCA 1OFDA 3BOFA 3E02A 1K8XA 3G77A 2BHZA 4L5ZA 3VTRA 5AZ1A 3WFLA 2IQ0A 4MB5A 1F4AA 1IEQA 4J9NA 1JUKA 3F5LA 4JX6A 3QEZA 1LOQA 3LCFA 3MJMA 1TV4A 4FS1A 4DQWA 1QK2A 3CIWA 1UROA 2ZIDA 4GISA 5C2GA 1F7BA 3GV7B 3L2LA 3BW2A 4GY0A 4P2VA 3DEQA 3GTNA 4UTUA 2E5DA 2V2CA 2O9TA 4FNRA 4UOJA 3RGTA 5CSUA 1KBLA 2FPYA 4NZCA 3TLQA 3SCRA 3RJYA 3GHRA 1RP8A 4J3SA 3TUUA 5HR7A 1GWJA 1QPKA 4P8VA 2UVUA 4C6EA 1QO2A 3TCEA 3NDOA 3WLIA 4UTWA 3TW7A 4WR3A 3NZGA 2AAAA 4G8TA 4RNNA 2QW5A 4RUAA 3L0NA 1B3VA 4PC8A 3AHYA 4OKDA 2A2IA 1H3GA 5CPLA 2CNCA 5E9XA 4JN8A 1Z89A 2VZVA 3CZ8A 2CWNA 4RK8A 5KFHA 1VYPX 1NOWA 2R8IA 4HK5A 3UZJA 3VD7A 1TZ7A 2CZVA 4ECYA 3MR2A 5D02A 2VYOA 3REQB 1GJUA 2OOGA 4OBSA 1ECEA 3BJFA 2J27A 4S2BA 3DFYA 5AYIA 2XM2A 2P8BA 3H53A 5F1UA 4IHCA 4E3TA 3FXGA 1ISYA 3P0XA 2BLEA 4S3EA 3IVUA 4GOAA 1Q4WA 1MQQA 4GI9A 4AD4A 4D2JA 3ZR5A 1WAUA 4LS2A 5C9RA 3LV6A 2DW7A 4UFLA 3T08A 2D2OA 3VKJA 2Y5EA 1Q63A 1XH1A 2JGQA 4Q4PA 5C9WA 2NT0A 2J6XA 1QNPA 4S23A 3VDBA 4UNKA 4O14A 4Q8PA 2HBVA 2WAGA 1ZRQA 1GYLA 2E40A 1PB0A 1EQPA 3AHVA 2P8CA 5HR6A 1GONA 1I2QA 2YR1A 5AHLA 3RK8A 3IVTA 2ZA3A 5HJXA 4L1WA 1XIJA 3QKEA 2VWSA 3W26A 3IIVA 1MW1A 2XFRA 4QJ3B 1LL4A 3WLJA 3RN6A 4M7SA 3D47A 2J7GA 1XKYA 2DV0A 1DE5A 2FYMA 3MU7A 1TTJA 3WUEA 1W1A1 3KBMA 3HPFA 4XIMA 4ED0A 1R3WA 1MO0A 2O56A 5HNRA 2PFHA 1OF6A 1F76A 3FA3A 2ZDRA 3KOWA 3EXSA 2BHYA 4O8RA 1UJPA 4YXGA 5HATA 3AMDA 3EA2A 5HPCA 2NUXA 4QG6A 5A8MA 1HGYA 3CQIA 4QP0A 1ZJHA 1LZOA 4PMNA 1UKTA 1RVGA 2XGBA 4QJ1A 4NX0A 4AEOA 4CGTA 3VIKA 3PZ9A 4MJ2A 2JKAA 4ZFMA 4QNWA 4CCZA 1K77A 1VHCA 5D2TA 1NELA 1J0HA 3Q4DA 3W72A 1H1NA 1A5SA 4DN1A 3OZYA 4NKCA 4FX8A 3WQWA 2XGPA 1OG0A 4KFPA 3ISIX 3WQ6A 3DC0A 3WDHA 2HK0A 4AU0A 1DP0A 1W9UA 2WMHA 4I9AA 3NTYA 1BGGA 1EL3A 2P76A 3AO0A 2MANA 3WLOA 3VNIA 2QT3A 2H90A 5HINA 3UXLA 4ZXLA 2VNCA 3G1HA 2OODA 4JNZA 4CQ8A 3ZLGA 4L9ZA 3BSGA 5DLGA 3NPWA 3N2MA 2TAAA 3F7JA 4IPIA 3OZMA 3PSWA 4NNCA 4PMRA 3RRAA 1NFPA 4BI7A 2YFNA 1AW2A 1UR9A 3RAXA 4C6JA 2IQDA 2WMJA 3FKRA 4F3HA 1M7PA 4UMBA 1AQFA 4TOQA 5ENLA 5K9XA 3MYPA 3GDTA 3WCZA 1SW0A 4D6DA 4UQBA 1XLMA 4UFIA 2V68A 3E2RA 1VS1A 5CC5A 4ECRA 4OBTA 1YDNA 5IXEA 3TU9A 4A4AA 1VZWA 4W89A 3TR2A 1TQXA 4B5XA 5KT6A 2QDDA 4HNOA 2VHLA 3N9KA 1E0VA 2PTWA 2V4QA 4E4PA 4W93A 3WK1A 4WXYA 3HF3A 3T0CA 1XBZA 4EAMA 3PBYA 4Q8NA 3GTXA 4DAIA 1ZJBA 3O7UA 1TPH1 4Q8UA 4KESA 3PBUA 5FKYA 4P5UA 3SCPA 2D20A 5KFBA 3GXNA 4A29A 4RW5A 2W9CA 2VEFA 4PUEA 3GR8A 1EQCA 1IEIA 3RB3A 2DQXA 3RILA 4D6JA 3GXTA 3MSYA 4JIIX 5E6YA 1TCMA 4UQ9A 3MCMA 3W88A 4LUTB 3W53A 2BTMA 3N25A 4OWGA 2ISFA 3ZS4A 5FF3A 5DQIA 4DL7A 3B9DA 4LUIA 1GVYA 4F48A 4PB4A 3IAQA 3GKAA 3OA5A 2G4JA 3QMSA 5FL0A 2GLKA 5AHNA 2YA1A 9XIMA 1W1TA 5CSRA 2V81A 5PTDA 4BQ5A 3MW7A 3MS8A 5KFFA 3V1HA 1R6WA 4EOUA 2C6QA 3IGXA 4RNFA 2PWHA 3KDNA 2ZXAA 3LGGA 1W9PA 1TYGA 1V6VA 3NQVA 4CVUA 5TIMA 3RAQA 1AD1A 4WUIA 2HROA 4UR8A 7TIMA 4C1KA 3BLDA 4DBUA 4QSHA 4LYRA 1MUCA 4EF8A 3TEVA 4XUGA 3W00A 2ZX9A 3N11A 4C6DA 1NP2A 5DXXA 2ACRA 5A95A 4AD1A 2OT1A 3NPXA 5CC6A 4R34A 5DMNA 4ECZA 1A3XA 3OZPA 1WO2A 3PVXA 1EA9C 2AQVA 2CBIA 3FCPA 4C6BA 3THAA 2GDUA 3H2FA 1I0DA 3PNUA 2X09A 2PTYA 3ZVHA 3CAVA 4JS3A 1JXJA 4DZ5A 3RDKA 4HCLA 3GTFA 4B2DD 2YOCA 2XCAA 4J9SA 2ZVIA 5T9CE 4D6CA 4XAYA 4AEEA 3E0IA 4G1NA 5C5JA 4M29A 4GIRA 4N2YA 2PRMA 4V1YA 1EUNA 2ABAA 1LQ0A 3UR7A 3S47A 1PIGA 2PS2A 1J5SA 2YW3A 3TSMA 4LGXA 5KFMA 4MNLA 3T6CA 1QAPA 1IWPA 4RUBA 2DH2A 5D04C 5BYWA 3Q67A 3LCLA 4UR7A 1DJWA 2XDFA 3G1VA 2B7NA 2OX4A 3O07A 2VFFA 3CWOX 1X96A 3NA8A 1AMKA 1GOIA 2C2EA 2VM8A 2FLLA 3KLKA 1TUFA 1AJZA 3AS1A 3GWQA 2J7CA 3B0PA 3P61A 3CTTA 4AF0B 3WNOA 4B3ZA 1GHRA 3PC0A 2GJPA 5KT7A 2VKZG 1GYNA 4I6KA 2FPTA 2Z0IA 4E4UA 4D1JA 8TIMA 1O95A 1W1YA 4O1CA 4KT2A 3AYVA 1JULA 2J74A 1PX4A 5F9LA 3VMOA 2CKRA 5T8GA 3S83A 4GACA 1K02A 5XIAA 3WQDA 5AHFA 1QK0A 3MT1A 1GOKA 4JFUA 4QX4A 1K8YA 1Y65A 3G3MA 3JZUA 2G4FA 2GGGA 1CW2A 2HXUA 4EK7A 3WK0A 3CV7A 1KXTA 2QDHA 1CYGA 2W6RA 1NARA 3GYCA 3TA9A 1KGXA 3PVFA 1XHGA 6PTDA 3AIUA 3HV8A 5D9NA 1LBFA 1N8WA 3LCWA 1J0KA 4B3LA 1GVEA 3AYSA 1M04A 4F0RA 2PDNA 1J9YA 4LQ1A 4NAEA 4O57A 3PJUA 2E6AA 5LIKX 4LAKA 1RYRA 4NJIA 5AN7A 5F2MA 4XKYB 4IISA 1SSGA 3PR4A 4NYUA 3M6YA 4Q4QA 1JFXA 2DEPA 1QNVA 3ARTA 1JEZA 2H3BA 5E1QA 8XIAA 3QGVA 2PDHA 5DMMA 1YADA 6ENLA 4J9KA 2DVXA 2WKLA 3GIJA 1YDOA 2WZTA 3N2OA 1EF3A 1BRLB 3VCRA 2FLPA 3W9ZA 3N04A 2X2YA 4LY8A 2ZYFA 3V1PA 3FYOA 2I57A 3C86A 3W76A 1UQYA 3GZ3A 3LNPA 6XIAA 3PAJA 2W66A 3G1DA 4Z2GA 3AQUA 1P7TB 3VNZA 5AVHA 1XP3A 1MYRA 1WV2A 1WBHA 1XSKA 2WVVA 3ITYA 4NZ5A 4X9SA 5C0QA 4C91A 4HPXA 1D8WA 3P80A 4JCLA 3QQ1A 4N9DA 4RV3A 3KE0A 4GK8A 2Q8ZA 2QCGA 2EPOA 1BWLA 4DPQA 3P3BA 4AX6A 4DO5A 5D30A 3ZYZA 1CB7B 4PFHA 2NX3A 4XD4A 2P88A 4Q43A 5FF4A 3BGJA 2P1FA 3I6EA 1M6JA 5KITA 1ZENA 3AXXA 1TVNA 2O4MA 4QEEA 4K8GA 3G18A 4Q6JA 2G5WA 4OQVA 1DJNA 5KFWA 2JEFA 3CXOA 2WV8A 2WC3A 2NSOA 4LB3A 3S1GA 1HF6A 5KFVA 2PDWA 2D23A 1JD9A 3W70A 4DNMA 2A6LA 2OQLA 1JDCA 2EKCA 3GVVA 3WKZA 4QE1A 3RPTA 1VKFA 4A2RA 2P3ZA 4JX5A 3NIYA 1Q6DA 2ZRWA 5BWAA 1V93A 4A3UA 2D1ZA 2F9RA 2DVUA 2G50A 1QI4A 2VGIA 4GUIA 4AY8A 1JZ6A 2J7EA 4N7QA 5KFQA 1UC5A 3RLHA 2B81A 1BHGA 4XSLA 2WO5A 5REQB 3ANYA 4CCDA 1VGAA 3AIEA 3ZVHB 3KZSA 4RKAA 4QR6A 2XSAA 4NZ4A 4HJWA 1MDRA 3TNBA 2NXGA 3RB4A 3R11A 4OOUA 3WLQA 4ED6A 5H8PA 5EMUA 1G69A 2R1LA 3WUGA 4K8EA 2ICSA 3OA3A 4RPPA 4XBSA 5J04A 1QNSA 3MUZ1 3VKDA 1UD6A 3DKLA 3WH9A 3W7JA 4PODA 3VE9A 4CN6A 4HIBA 2KAUC 1OGSA 4PBEA 2OELA 5FJRA 2FIQA 3S6OA 1EO7A 1ICPA 1AL7A 2ACSA 5KG0A 4NSBA 4S3AA 3U2CA 1EPXA 2EPNA 1C90A 1UZ1A 1Q6CA 1NWUA 3HFTA 2J24A 2REQA 2CXGA 2QUUA 1ONXA 3UZ5A 4IZGA 1I4NA 1V6WA 3UEQA 4HPHA 1NEYA 1DOSA 2WMIA 3U2EA 1M53A 2EPMX 4F4ZA 1PEZA 2D2GA 4P8XA 1U5VA 3ITVA 4UMCA 4XZMX 2WVTA 4R9OA 1H7RA 4L64A 4XO7A 2YDAA 3QSRA 4A3RA 3CUZA 2WZHA 3RX4A 1JCLA 3E2SA 2VD8A 3RO6A 3H54A 4ECXA 2GGJA 1VYSX 3GDKA 1M41A 1L6GA 4J3XA 3O05A 2UBPC 2I5GA 3EMCA 1KCLA 3WLPA 3VCCA 2ZQ0A 4H9YA 3MWCA 3HQ1A 3PZUA 1E3ZA 3IJDA 4QWCA 4X0NA 2PURA 4X22A 3S2MA 2V2HA 1SGJA 1QATA 1XIHA 2BY1A 2PGEA 2BZNA 1KW1A 4GXWA 2O0TA 4DZIA 2XH7A 3NQBA 1NQKA 4JQ2A 5E5CA 3R8GA 3AS3A 4O3SA 1O1HA 2BY3A 3UWQA 3TJ4A 2BB0A 2Q09A 2YDRA 2YL8A 3I65A 3GIIA 3QM3A 3V5FA 3B0VC 2GK1A 5CBBA 2ZUNA 8XIMA 1SO4A 2ESCA 3CQKA 2XIQA 1B57A 4U3AA 4O3PA 2XVKA 1QCWA 2DUZA 2GUBA 4OE7A 3C52A 4EF9A 1BF2A 4LVGA 4GC3A 1PCKA 3KL0A 4EXBA 4ZSUA 2J7BA 1KM5A 3G2GA 3O2LA 3WF2A 4WJEA 3WF1A 3UA4A 1OWQA 3T5LA 2PDPA 1BGAA 1Y0EA 2IMWP 3UVAA 2XU2A 1TV3A 4KCVA 6TAAA 1K4HA 3OIHA 3T81A 1VB9A 3A4XA 2HK1A 2ZZ6A 3WLTA 3WNLA 2NX9A 3O3RA 4AH7A 4KMQA 4ZXOA 3KTXA 5EFDA 5KFGA