1PO9A

Crytsal structure of isoaspartyl dipeptidase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
388
structure length
372
Chain Sequence
b'MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isoaspartyl dipeptidase
publication title X-ray structure of isoaspartyl dipeptidase from E.coli: a dinuclear zinc peptidase evolved from amidohydrolases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 128
structure length 372
sequence length 388
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1po9A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1po9A02
1EF2A 2GOKA 2P50A 4KEZA 2BB0A 1M65A 2WM1A 1UMLA 2VM8A 1KRAC 4GYFA 1K1DA 3E74A 4V1XA 3QGKC 4BKNA 2R1NA 1POJA 1V7AA 3F2CA 1V4YA 3UBPC 1W1IE 3E3HA 4DLFA 4KQNA 4ZSTA 2Z2AA 1A5NC 4INFA 3F4DA 2HQAA 4IFKA 4CEXC 4B90A 2O4QA 4KF1A 3LGGA 3MPGA 3K5XA 3NURA 3UR5A 1V79A 3E0LA 1FKXA 3T81A 2FFIA 4CQDA 2AQOA 3V7PA 4HJWA 4DI9A 1KCXA 4KESA 1YBQB 4UBPC 1A5LC 2WJDA 1ITUA 2PGFA 4WVXA 4XD5A 1A5OC 3IPWA 2Z24A 1P6BA 4CNSA 4LCQA 4G7EA 3O0FA 3LY0A 1FWIC 1ZZMA 2FVKA 3URAA 4KIRA 1A4MA 3S2LA 4J35A 1JGMA 3RHGA 1EYWA 2WJFA 4ZSUA 4C60A 2Z26A 4R7WA 1UIPA 1VFLA 3T1GA 3GU1A 3UPMA 4CNUA 3GU9A 4OFCA 1GKQA 1I0BA 1RJQA 4XAFA 1XRFA 3F4CA 3UR2A 2YXOA 3MJMA 4C6QA 2DVUA 4B92A 4EP8C 1EJRC 3NEHA 2I5GA 1QW7A 2Z00A 2QT3A 1E9ZB 1PO9A 2VUNA 2WJEA 3ID7A 3IACA 4IH3A 4CNTA 3QGAC 3D6NA 3GIPA 4C65A 2ADAA 4KEVA 2R1LA 2G3FA 4LEFA 1RJPA 5A6TC 4C5ZA 2E1WA 1RA5A 1PB0A 2O4MA 4HK6A 4IGNA 2D2HA 3TN3A 4QS5A 3E38A 4GY0A 1FWAC 1KRBC 1PSCA 1S3TC 2VHLA 4L6DA 1WXZA 3URQA 2OGJA 1EZ2A 3MVTA 2Q09A 4C6JA 3G77A 3ICJA 2HPIA 4H9UA 2A3LA 2VR2A 3C86A 4C6FA 2R1KA 2OODA 2RAGA 4J5NA 5CH9A 1M7JA 1EJVC 1P1MA 3TN5A 3LU2A 3S2NA 4EPDC 4ERAA 3GGMA 4QSFA 3F2BA 4KERA 3URBA 2HNHA 3CS2A 4CQCA 4LAMA 4XAYA 4LFYA 1J79A 4F0RA 1FWCC 3ITCA 3IARA 2I9UA 2P9BA 2D2JA 3FEQA 3AUOA 4XD4A 3WZ0E 1K70A 4DIAA 2HPMA 3KM8A 4C6KA 2OQLA 3AU6A 2R1PA 1ITQA 1FKWA 3OVGA 3DCPA 3B40A 3PANA 4R85A 3F2DA 1RK6A 1EJUC 1UIOA 4RDVA 4IG2B 3A4JA 4PCPA 2HBVA 4C6OA 4IQJA 4QRNA 2E25A 3S2MA 2VC5A 4EPEC 3EWCA 2PUZA 4CEUC 1NDYA 3DC8A 4PE8A 3TN4A 4C5YA 3EGJA 3HTWA 4Z42C 3PNUA 1O5RA 4XD6A 1J6PA 3QY6A 1HZYA 3E0FA 4WGXA 1NFGA 2Q01A 4RE0A 3B0YA 4L9XA 4F0SA 3CJPA 2AQVA 3T8LA 4NI8A 4BY3A 3OOQA 3GUWA 2GWNA 3IJ6A 1J5SA 3PBMA 4ERGA 3RCMA 1ADDA 2DVTA 4P5UA 1XGEA 4HA0A 3IRSA 5FSDC 1NDWA 4GK8A 3TN6A 3MSRA 4UB9A 3O7UA 2ANUA 3ORWA 4LCSA 3OU8A 5HMEA 1YIXA 3EWDA 4JOMA 3JZEA 4PBEA 4GY1A 1YBQA 3MDWA 4HK7A 4XAGA 1KRCC 4PBFA 1EJSC 2OOFA 1FWHC 4GX8A 2KAUC 1EJWC 1R9YA 2P53A 4TQTA 4I6KA 4QS6A 4ERIA 1FWBC 4DLMA 2FTYA 2UZ9A 1P6CA 4NP7A 4KETA 1UBPC 1RK5A 4GC3A 2FTWA 2D2GA 2W9MA 1KRMA 3RN6A 4H01A 4IFKB 1RJRA 4EPKA 2ZC1A 3LSBA 4HK5A 4DNMA 4WHBA 3LSCA 3URNA 4I6VA 2YB1A 1A4LA 4E3TA 3HM7A 1IE7C 3GRIA 3LS9A 1R9ZA 4C6MA 1BF6A 2HBXA 1FWGC 2Z4GA 4C6NA 4GY7A 1FWDC 3ISIX 4PCNA 1ONXA 2FVMA 4AC7C 3PAOA 5AKQA 4H00A 3TNBA 3UF9A 4C6CA 4LCRA 4NG3A 1GKPA 4M51A 2Z7GA 3BE7A 3AU2A 4KEUA 3GTHA 2Z27A 1WXYA 4H9VA 1XRTA 4C6BA 4H9YA 1E9YB 2BGNE 2QPXA 5FSEC 3GTXA 4F0LA 1YRRA 4R88A 2YZ5A 3B0XA 3FDGA 3MKVA 4J2MA 1QXLA 4DZHA 3QY7A 4IF2A 2CZVA 1EJTC 2UBPC 4LH8A 1I0DA 4H9TA 4LAOA 2EG8A 1V77A 4D8LA 2PGRA 2R1MA 3N2CA 4RDZA 4YIWA 2Z29A 4RZBA 3MDUA 4IFOA 3GTFA 4RDWA 3LGDA 3SFWA 4GXWA 4LANA 4IFRA 4QTGA 4G2DA 3NQBA 3QY8A 4AQLA 4C6PA 4ICMA 2Z2BA 2XIOA 2VC7A 2GWGA 3GU2A 4DYKA 1RAKA 3WMLA 3MTWA 3A3XA 4LAKA 2EG6A 2EG7A 4BJHA 3E2VA 4XD3A 2GSEA 3A3WA 1EJXC 2AMXA 5HMFA 4GX9A 1A5KC 5HMDA 3K2GA 3HPAA 2Z28A 1K6WA 4MUPA 1FWJC 4B3ZA 4IG2A 4H9XA 3CAKA 2QS8A 3R0DA 3OJGA 1RA0A 4C6IA 3GTIA 5E5CA 1YNYA 1YMYA 1GKRA 2Y1HA 1M68A 2QVNA 4H9ZA 2YB4A 2F6KA 2OB3A 3GIQA 4QROA 1O12A 3WYZA 1R9XA 1J6OA 3OODA 3LNPA 4CQBA 3MVIA 3SO7A 4C6DA 3IGHX 1DPMA 3S4TA 2PAJA 4V1YA 1NDVA 4DZIA 4B91A 2IMRA 4C6LA 3LA4A 3FDKA 1V51A 4DI8A 3RYSA 4GOAA 4GBDA 5G4HC 1FWEC 3PNZA 1FWFC 3IV8A 1A5MC 3S2JA 2PLMA 1PTAA 4GZ7A 1ONWA 3OQEA 2GZXA 3DUGA 5LXXA 2Z25A 3K4WA 4DO7A 1POKA 1NDZA 4RDYA 2ICSA 4C6EA 1XWYA 4EPBC 3GG7A 4H9MA 2DVXA 4LALA 4XAZA 4G7EB 4IGMA
chains in the Genus database with same CATH superfamily
1JZ3A 4HNLA 1XIJA 3TJXA 2PDBA 2PGEA 1TTPA 4M3PA 1N82A 4GVIA 4N7QA 5EBUA 2V5KA 1POJA 1C3FA 3L2MA 1T41A 3RM9A 4LEQA 4YWSA 1QWGA 4ZSTA 3NJ3A 2RDUA 2QEZA 3O1NA 2CZDA 3S6TA 3CNYA 4C91A 3ZMRA 4P8XA 1JZ5A 1KBKA 3TFCA 1YDVA 1XHGA 1KGXA 3RLUA 1N55A 3SRFA 3VOCA 1X38A 4WVXA 2OKTA 3CT7A 3EX2A 5DT5A 3UR7A 3TAKA 2HS8A 1XLBA 1C91A 2H3BA 4ACZA 3ARPA 4D9PA 3CTTA 3KRBA 2QR6A 2CZEA 5HJYA 4GXMA 1VJIA 2Y5EA 3ITOA 3FY1A 4JY9A 4X2PA 1G0CA 3ITVA 3IN5A 3PWGA 4X63A 4Y9PA 3REQA 3UXAA 4EOUA 1J11A 5ABHA 4JTTA 2DZVA 3WLPA 4LY4A 5A2BA 4ADUA 4IPLA 1F5ZA 3KP1A 1XYZA 1FBAA 1BG4A 1S5TA 4JBRA 1FDYA 2G3FA 2RDIA 3N4AA 1YTDA 5C9WA 4LOCA 1TV2A 4W85A 2WW5A 4IWWA 3RLGA 5I24A 1UYQA 1LWHA 5KFDA 3URQA 2PTXA 1ZJBA 3MT1A 8XIMA 2J74A 2X42A 2YYTA 1RYRA 4QX4A 4F40A 3CB3A 4GQGA 2OEJA 5KETA 5C2CA 3MU7A 2G96A 4DO5A 2V4RA 2VURA 3SCUA 2XSAA 4PMRA 2PDFA 1P1MA 1YADA 2AL1A 3JZUA 4UTHA 4HZ7A 4AEOA 3H7RA 4JCMA 2YYUA 1A47A 4DO6A 4QQUA 1DOSA 4XAYA 4DF0A 3IARA 4I9TA 4D71A 1DE6A 3M9MB 1K4GA 3TEVA 4M56A 1ISVA 4IL0A 4QE1A 4QE5A 4FEZA 2HCVA 3T5JA 3OZOA 3LMYA 2QGYA 3OVGA 5IHRA 4JV2A 3HFYA 1UD2A 1I1XA 1D3GA 3WIJA 4MNJA 2GJRA 2BVYA 3AXHA 2VZVA 3O3RA 4O17A 3W2LA 4IM4A 1EX5A 1HT6A 2WOQA 4C7GA 2V82A 2WHLA 3NYZA 3V0TA 1GG1A 3BQ0A 2CLFA 2GQ9A 3R13A 1QAPA 4NX5A 2PZ0A 3QR3A 3EGJA 2OOGA 3E02A 1UG6A 3AIVA 5C71A 4HOZA 3BARA 3LDVA 2C91A 4GFSA 2C14A 4W9TA 1I4NA 3WENA 1MVYA 3M16A 4HCLA 4QWBA 1CZ1A 4CD6A 2Y8VA 4XK2A 4IJCA 3MV11 3H4DA 3FJ6A 4GC6A 4MNLA 3ORWA 3UZZA 3ZR5A 2A79A 5AECA 4DPPA 2ZXDA 3DFSA 1XD0A 1XBXA 3QXBA 4BI5A 2OOFA 2ZWYA 3G3MA 3O6CA 4O14A 2P53A 2CHOA 1MDLA 1ZBWA 4Y8FA 4DWSD 1JCNA 3KBVA 2VTFA 3P84A 2VX6A 3RX4A 3ZVHA 4RZ6A 7ENLA 1UROA 4BQ5A 3W73A 2OG9A 2RGLA 2P76A 2WV8A 3G5EA 2WQDA 3M9OB 1H5YA 4JQ1A 1XL9A 3QEZA 1UH3A 5AC8A 1Q5MA 3FXGA 3R8GA 3WQOA 3H7VA 4W8BA 4FF5A 4YHGA 1Q6RA 1V3IA 3U9IA 4EWJA 1T40A 4AMAA 3UPBA 1XDJA 1DJYA 1JXKA 5DXXA 1E40A 3W1PA 3U2EA 2IKHA 1JZ2A 5AKQA 3TNBA 3UF9A 4NG3A 3B9AA 9RUBA 3T4WA 1JFXA 4E2DA 3N3TA 3PSWA 3P93A 2Z27A 1WXYA 3PZMA 4PUEA 2YW4A 3W76A 4KPLA 3VIGA 3KHHA 2YCEA 2P8BA 5GNXA 4S3JA 2QUTA 3NZPA 1EA0A 4IF2A 1IZJA 2PS2A 2WSRA 3OLIA 3FJLA 4Q7IA 1GGOA 3O07A 3W71A 3BOXA 2WKLA 1EHNA 3GBDA 3W7DA 5ENLA 1UKPA 1BGAA 1LT8A 1VBHA 5FAGA 3PTQA 3A4AA 3E2VA 3A3WA 3DESA 1EJXC 4A8LA 1GHRA 2X1RA 4JKKA 4IQDA 1BKHA 5EKYA 3HO8A 3R0DA 2YW3A 4UOZA 3M47A 1WDQA 3QW3A 2XTKA 2E77A 4KGJA 1VLWA 2W6RA 4H7CA 3KOXA 5J5RA 1ZB5A 1KFEA 2E6DA 3QPEA 3MVIA 3RCYA 4C6DA 3XIMA 1KCLA 3S4TA 3ARVA 3G1HA 1AK5A 4ECXA 1GZGA 4E4UA 4PRTA 1KM3A 4HNCA 4IIHA 3KL5A 1MW3A 1EEPA 2NQ9A 4NAFB 3QQ0A 1X6LA 3B0VC 4KS0A 1PTAA 3TROA 4WDTA 1SW7A 5DY2A 1XIDA 1YW1A 3Q94A 1W1A1 1BHGA 2ZZ7A 3VIHA 2QJJA 4YR2A 1HG3A 4AZGA 2Y7FA 1FVPA 3BG3A 3ZXWA 2DZXA 3TLQA 2I17A 2P50A 3WH8A 5AZ0A 4Q7BA 1TZZA 4F2TA 2OYMA 2IW0A 2C15A 4ZE4A 4GYFA 4V1XA 1S5VA 3I3EA 2E9BA 4LJ3A 3TSDA 1W1B1 1JYWA 3VZYA 1TG7A 3PPHA 4QFUA 3DDMA 4ZCWA 3GDRA 4PTVA 4L1WA 3P3BA 2I5QA 4P7NA 1DBTA 1QNVA 5A6LA 4YTTA 3R1ZA 2ZRXA 3Q37A 4KFPA 4JN7A 3DOPA 4ECUA 2W9BB 4DI9A 1YYAA 4BQ3A 5DMLA 5D33A 4LUIA 2Z24A 3E2SA 3SECA 4PH6A 1NU5A 5KG2A 4MG4A 4LRSA 2A3HA 3GXPA 4UQEA 1WAWA 2GLKA 3BG9A 3WBWA 1R6WA 4LU0A 3RHGA 1EYWA 3S83A 4ZSUA 1F05A 1PE1A 3V1HA 1EGVA 2Z26A 1EWEA 1VFLA 5E9AA 1JD9A 4IT1A 3WN6A 3MMTA 5EBAA 5F1UA 2WXDM 1RJQA 3KLKA 3APGA 2DW7A 4B92A 1MFUA 4JFSA 2I5GA 3CZGA 5LIWX 1CXLA 1GWJA 3VA8A 1LG1A 2E28A 2J8FA 2I7GA 1PO9A 1UA7A 1FCBA 3OYZA 1CB2A 3L4UA 4DUVA 3LXBA 3VX0A 5A95A 1ZENA 4BZYA 1EGZA 5A6TC 3GH5A 3B4YA 3KRSA 4GY0A 1S3TC 5KFHA 5FL0A 3RK8A 2DT1A 2ZA1A 4WKHA 3L4ZA 5I3JA 3TYEA 4KCUA 1PKNA 2EO7A 1ONEA 1D7FA 1E6RA 1QPNA 2OZ0A 3W7EA 4Z2GA 1OFDA 1TPVA 3LHUA 3H21A 3SAZA 1E70M 1EOMA 2BASA 2X2GA 3M5ZA 2DIJA 2PDCA 1AH4A 2BR0A 2RDWA 2PZNA 1JDEA 1WZLA 1XGDA 5KG7A 2OKOA 4IXHA 4U5IA 3MHFA 1ITQA 2IKIA 5DY3A 1XQKA 3WL0A 2X16A 2BQRA 3H23A 3HB9A 3ZJ8A 1MSSA 1PKMA 1BWLA 4E8GA 4DO4A 3MUAA 3PAJA 2ISFA 4HA3A 3P74A 2VC5A 1E0XA 4Y9AA 3N34A 3UJFA 1GQKA 1YHTA 5L6UA 4O54A 4H41A 1UR1A 3DFHA 1XC4A 4PE8A 3O9NA 1EC7A 4XZLX 3HTWA 4RJEA 1DWJM 3KVMA 5D03A 1Y65A 4LS1A 2C1HA 1HZYA 4B9ZA 2WVVA 1H7NA 4GUIA 4NJKA 3QBUA 4GNJA 3GE7A 1IXNA 1ZAJA 4GABA 2G4JA 2DZWA 5LA0A 3DBPA 5TBOA 3S6OA 3ZLFA 2YCLA 2IBKA 1XCFA 2VFEA 2DVTA 2GGIA 2FQIA 2YXGA 2ZRVA 3EDJA 4P5UA 1XGEA 3WJYA 1BAGA 2G50A 1UCWA 3N9SA 3F5KA 1D7KA 4LCSA 1U22A 4AIEA 4J9RA 3L4WA 1BXNA 3JZEA 4GIYA 3FV9A 2IPWA 5LIYX 3CIWA 1WE5A 2REQB 3UY7A 5DMYA 1HJXA 3PZTA 3TR2A 1O68A 4AISA 1ZETA 3P61A 4P8VA 4NX0A 4FR1A 4QS6A 4IGHA 3PF3A 1FWBC 4GZEA 3ONCA 1G1YA 3C52A 1HKJA 1JL8A 3W29A 3DH7A 5CPNA 3HIJA 5F4SA 3GNRA 1JCLA 1MEWA 2DT3A 4CGTA 3SZ8A 3RB6A 2BXVA 5A6BA 3P14A 1E0TA 1CXHA 3H2OA 3BOLA 2ABAA 2PSNA 4E3TA 2EGZA 3HM7A 2F9RA 3E5PA 3FK4A 2RJHA 1VIWA 4XBKA 4EF8A 3M64A 4ZB2A 2ZRWA 5C9UA 1XKYA 3DBNA 1E9YB 1E73M 1OSEA 1Q6CA 4KRUA 4IMCA 5DCBA 5HBFA 4RNHA 1RHCA 1A5AA 3B0PA 2DZAA 4FXSA 1K7EA 3VC5A 4YL2A 3HPXA 3Q65A 3PP7A 4GIEA 3OHAA 3EWBX 5D9PA 3GQCA 4DJEC 3H53A 3SJ3A 1TWZA 4J9SA 3QY8A 3AXMA 3KXQA 4CD5A 3QMTA 4H19A 3NQ8A 5DLGA 4MZ1A 4IMDA 3U4FA 2PFHA 2VR5A 4PMDA 2OEMA 1QK0A 3K4AA 4TUFA 1RBLA 3L67A 4G56A 4A3QA 3M6DA 3HG4A 4BFAA 4JTHA 4RKAA 4JTJA 3RRXA 1T0OA 2A2IA 1XH2A 5MHBA 3WF0A 3WF3A 4GX9A 1LBFA 4Z2HA 2CXEA 2YL9A 1FWJC 3SB0A 3APYA 2ZVIA 1TA3B 1MZHA 3PJUA 3OJGA 4I9AA 3HMCA 3VGHA 2XGPA 3FDSA 1S2AA 3B8VA 2OSXA 2Y1HA 1SUXA 5D2YA 5HA7A 1KR0A 4IIFA 3VINA 4HPXA 1Q2SA 3SGUA 2HWGA 4LC6A 4B5UA 7TAAA 1IIGA 2PDJA 1EPXA 3QQ1A 4CQBA 1K7FA 2PAJA 1W91A 3MJYA 2ZRZA 3NDOA 2IPGA 4JNYA 4DZIA 4B91A 5T9BG 4GHRA 1UR3M 3EDDA 3N29A 4R7JA 2HDJA 3PG8A 2R8IA 1RPKA 2JK2A 3W6LA 4GZ7A 1TX0A 1UKSA 4HNTA 2V3FA 4MDPA 2W4XA 3TCEA 5LGXA 1RYSA 3W7GA 2FLPA 3O0KA 4TQRA 5KG3A 2G4FA 3QKZA 2WCGA 1C8VA 2NVAA 2O9PA 4H04A 4NYUA 3U2CA 5RUBA 5EL1A 3PZUA 3NSXA 2YL8A 3AMDA 3HQNA 1TMLA 3FGCA 1EGMA 3M0KA 1OC6A 4OV4A 4O1AA 4IIBA 1DWIM 2PURA 4MMWA 4JDBA 2UV8G 2PEVA 1VCGA 3CHEA 2FGBA 2Z2AA 4Z2JA 4B5NA 4E8CA 2YCKX 2C79A 3AHZA 3PZIA 2DPEA 2BTMA 2VO5A 1C92A 1SFTA 2FHBA 1BRLA 4HJWA 3PUEA 3B8SA 4UBPC 3FLUA 4R27A 4JKMA 5E0FA 3AJ7A 3GC2A 3NYDA 1GUVA 5I7GA 1LROA 3VMOA 3OPSA 3ITTA 3WUGA 2YLLA 2CBUA 1JPDX 1MZRA 4A8NA 3SCNA 3UG4A 3UZXA 3MSYA 1E0UA 4KCTA 1O60A 2X8RA 1WNOA 2WHMA 2RGMA 1XLKA 4TTUA 4NSBA 3LX9A 1OFBA 5DCDA 4S3BA 3NEHA 2XM1A 3BCFA 2VNCA 3KWSA 5FJIA 2WTFA 5I06A 4N9CA 1E55A 3HGJA 3GW3A 4EANA 2E7FA 5KFLA 1TUXA 2QZRA 2W61A 3N4EA 2YSWA 4ZBCA 2E68A 1IT0A 3ATZA 2E1WA 3BL3A 1GHSA 1NSJA 3GQYA 4IPIA 5BYWA 3N6QA 1IWPA 3P7YA 1DHKA 1UWIA 3ZZ1A 3NQ7A 3RB3A 1VYPX 3EPMA 4FXRA 4O1EA 3NPVA 2VOMA 4F3HA 3IJLA 3PTDA 2AOSA 3PC0A 3TYDA 2PD9A 3HQPA 3AMLA 2WB5A 4UNIA 1VFUA 4FZIA 3IUHA 5CSSA 3M5YA 5C7HA 3P81A 3R94A 5FJTA 3SDOA 4J5NA 3UP8A 3SUWA 3TN5A 2J6XA 3EX1A 1UD6A 4KW2A 3BOFA 3BZJA 2FDMA 4UOJA 1O4UA 3BAIA 1Q85A 3WZ0E 2HVMA 1JDCA 1PX4A 3NIYA 2WWCA 2P1FA 1J2BA 4I8DA 3O8AA 3SUUA 1I60A 2VDGA 1REQB 3W85A 1EDQA 4CLMA 5TNVA 1GTEA 2ZFAA 2GK1B 4P2VA 4EAYA 5FEXA 3AAMA 2BHUA 4JTCA 4L7ZA 1SMDA 3EWCA 1KQYA 2PWEA 3UWYA 5CGMA 1WZKA 3UCCA 2GVGA 3DYMA 3TN4A 2ATMA 2GQ8A 1JCXA 1O5RA 4XD6A 4GO9A 4D6EA 1FWTA 1ZGDA 4GMEA 2VCAA 3WLNA 3LCIA 4QWAA 3NSNA 1I2OA 3STPA 4YYFA 3MW7A 5H8PA 3WQCA 4A8RA 3TMLA 3MYPA 1EEXA 4GI6A 2PDLA 3LUTA 3M0JA 3T08A 3KLLA 1TMHA 3GIYA 3RAOA 3TQVA 3S5YA 9XIMA 1UASA 1QNSA 5T8GA 4AUBA 4C1LA 3UWVA 2NVCA 3EX3A 1FWHC 1JQVA 2NXIA 4WXZA 2C28A 1DJIA 2ISDA 1ZPTA 3CZLA 4GI8A 1KXHA 3VK5A 3AWNA 1JX4A 1TTQA 3WBXA 5AFDA 2BMBA 3T0CA 2NQZA 1D9EA 2Y7GA 3CWOX 3L2LA 3BXWA 3LPPA 2ZXAA 3OLGA 4CCCA 4DVOA 2BGSA 4K2SA 2ZC1A 6TAAA 3I7RA 3MZNA 3CQIA 3W25A 2CLHA 3B9NA 4ZL1A 1XYBA 1SSDA 1U30A 4OBSA 4WJXA 1ICQA 3V75A 4KBXA 5SWUA 4RE4A 2D73A 5FEWA 2VZOA 1R0MA 4V2XA 2ZUVA 3BV4A 1R3YA 1PZ3A 3QV8A 3C0JA 3PJXA 4CN4A 4AMCA 1EPVA 1XRTA 5D32A 3QSRA 4Q8PA 1UC4A 3L9CA 2YZ5A 4NRRA 4O28A 1N48A 3AZSA 3DHDA 3D0CA 4HYWA 2Q3OA 1IXOA 3T40A 4ECLA 3HPZA 4ZMGA 4LV4A 4Z1YA 3E0VA 4ZENA 1XSKA 3DYPA 3O6DA 1EBGA 5E1QA 2QGHA 3L4TA 3LGDA 3SFWA 4PTWA 1QI5A 1VBRA 3LBOA 1GW1A 2PMQA 2NLYA 1CW2A 4PB5A 4DJEA 3CWHA 1EA9C 4WZHA 4FLRA 4GXPA 5I5RA 2INEA 3TSBA 2X1SA 4V27A 1T6MA 5AYZA 4AZCB 3SCSA 1K6WA 3UXDA 5JBFA 1OGGA 1E6ZA 1EUAA 3VGDA 1BVNP 2DY3A 2VDIA 3VAVA 5A6AA 4M80A 3ABXA 4JNMA 2NX3A 1JIHA 1HKIA 2KX9A 3FA4A 1SR0A 3WJXA 3NDZA 4PTMA 1VB9A 3VCRA 1LDCA 2ALZA 2OB3A 4HU8A 2PI6A 3KEHA 2POZA 3IGHX 4AVNA 3THCA 1XBZA 3ARRA 3FDKA 1V51A 1FHUA 1P7TA 2GDUA 3EB3A 3HV9A 1A5MC 3AS3A 3HGRA 4Q33A 2QCCA 1PZ0A 3IEBA 1J0KA 4GC7A 2QDHA 5MKGA 1XWYA 3B9OA 2DVXA 4YCPA 5K2ZA 1J18A 2JQXA 1OYCA 4RNFA 2WMGA 2GSHA 3ECQA 1Q65A 1UMLA 2C2EA 4DUXA 1VPYA 5C9ZA 1K1DA 1QHPA 2ZX5A 1UWRA 3BQ5A 3AQUA 1X6UA 3FIGA 1V4YA 3W88A 3GXMA 6REQA 1ICPA 1C29A 2DSWA 4AHPA 1JQXA 3BUVA 1XLLA 3MPGA 1CWYA 5CPSA 1E6QM 3BH4A 1DJXA 5KFXA 4UFJA 2EPMX 3HURA 4UR8A 3W86A 3RM4A 4H4IA 3BCJA 1BWVA 2CC0A 4CNSA 1PDZA 3ZLGA 2NX1A 3STEA 2HXUA 1TPC1 4UQBA 4B5VA 3TQ1A 3CASA 7REQA 3LGEA 3GVRA 4DL3A 4QJ4B 4HNUA 1AQMA 3FXYA 2W7PA 2DH2A 4OJYA 1KB3A 1C8YA 1C8QA 1YE4A 4OFCA 3PUGA 1KXTA 2LLEA 3T4CA 3I6TA 4EP8C 3KCJA 6CGTA 3N73A 3NL6A 5DG7A 5FCZA 3W38A 3O6AA 5K9CA 4GYPC 2RHGA 4AEFA 5C70A 1FHLA 1JPHA 4C1NB 1FWRA 4AZHA 2A6NA 2VEPA 3SRHA 2GQ3A 1DVJA 4KEVA 3SCOA 1FH9A 2BNJA 1RJPA 4MPQA 3GIKA 1UB3A 1RA5A 3PZGA 1OF8A 4XBSA 4D6CA 2P3ZA 2IKGA 1KRBC 1ZSXA 4Q8QA 4K36A 5CZSA 4S2CA 4A21A 3K30A 5AZ1A 1KBLA 3TA6A 2A1YA 3MVTA 4JTQA 3ICJA 3SCQA 4AIBA 3TC7A 3KFTA 3T5HA 4FOUA 2Z0IA 4CCDA 2BV9A 4PEKA 4Y9OA 2J6VA 4UTIA 4UFHA 1WCGA 2OMAA 2ZADA 1FH8A 2XWDA 1GNXA 3FNDA 3AUOA 3N19B 1WZAA 3T09A 4BS0A 4B5TA 5BCAA 4D1IA 2Y5JA 3CMJA 5CLTA 1E0WA 1W5MA 3VKJA 4B2DD 2CLKA 5XIMA 5C0QA 3WQ4A 5D9MA 3W1AA 1XI3A 8TIMA 1O7AA 1O5KA 2HISA 5C5YA 3TQKA 3RJYA 3TW7A 1WDSA 5T14A 4LS0A 2NVDA 3EYPA 1SZEA 3UVAA 4IOTA 1ZS2A 3BLKA 1LF1A 1S2WA 2GVYA 4MWAB 4GKLA 1NDYA 4JTSA 3WLIA 1K7XA 4IL2A 3PSVA 3NZGA 3R0KA 1E43A 4PTDA 2XH7A 4O18A 2WNZA 5JQ9A 3ANUA 4MDOA 1UKQA 4FMVA 3SIZA 1TV7A 5D04C 1D8WA 5D38A 3PBMA 4TIMA 3P62A 4I5RA 2E8YA 2C2DA 3G18A 3GYEA 2F7FA 3TZNA 1RD6A 4QG6A 3W9ZA 4HNNA 4LWWA 1OWQA 4XV0A 1FTXA 2ISVA 4GVHA 4QLJA 2VVNA 4OZOA 4PMOA 4GY1A 5FJOA 4YLWA 1NAL1 2B7PA 1KRCC 4PL2A 3WBYA 2ACUA 2NWRA 5KT7A 1PBGA 2YA0A 4MOZA 1R9YA 2YDQA 2XGIA 3BMXA 1DTUA 4NJHA 4PA8A 2PDIA 4PUMA 3NTYA 3R6IA 3LV6A 4Y9NA 4LAUA 4LRTA 5D2TA 3UA4A 3TQ0A 4IFKB 4K8HA 5AVNA 4ATLA 4UQAA 3EWYA 1IV8A 3R58A 4LY8A 4MLJA 4MB5A 1E6SM 3DENA 2GYIA 3V3WA 4ZFMA 3ZT5A 4U2ZA 2GJLA 1Q6LA 3AHXA 3FX4A 1H3GA 4I9JA 3LS9A 4DWSB 3Q45A 4C6MA 1WPCA 4OTKA 2Z4GA 3SN4A 3SR7A 3S5SA 1XRVA 4R9XA 4H00A 2TODA 1XSIA 1WKDA 1K6AA 1TREA 7PTDA 1J0JA 3GTHA 3LRKA 4C6BA 1T8QA 3VKKA 1I2NA 1EP2A 2CXGA 3W1XA 3ARZA 7TIMA 5BOEA 5BMXA 2ABBA 5DCEA 3QY7A 4DUOA 4F4WA 2DZUA 1EJTC 3UWQA 3ZJKA 1R86A 3TYBA 1HJSA 3U7VA 5J04A 2A3EA 4ED6A 1LRQA 3C2FA 4S3EA 4AD3A 1RP8A 2ASDA 4LANA 4QTGA 4PFHA 3PTKA 4AQLA 3TW6A 1H41A 3DGBA 2XJ7A 4WY0B 3B8DA 4JFWA 4LUTA 4W5UA 2VELA 3MR5A 2WVTA 3WJZA 2D20A 3GVWA 3DKJA 3I4EA 1HGWA 1EC9A 4K3ZA 4WKFA 2PDHA 5CSRA 4BHYA 2Z28A 1IZKA 2WZMA 4O4WA 2YDAA 3KHLA 1BG9A 3C3NA 5IDZA 3BDKA 1DIDA 4RE2A 1R3SA 1NWSA 2BX7A 3WF1A 4E2BA 1XJBA 4GUFA 5IRPA 2CHNA 3EEGA 4GCXA 4JL2A 3TH6A 2QJIA 1TELA 4FS9A 3ARSA 4MKNA 2FTPA 5EMKA 3LPFA 1O66A 2PTDA 5F9LA 1YTEA 4QDWA 1Q7QA 1V6UA 3QKEA 2CPUA 3OVQA 5FEPA 2WKGA 3NOEA 2PDYA 5IBXC 3T44A 1SFJA 4DXXA 2R9RA 3JR2A 2VZSA 4Z0SA 5HMSA 3OZPA 2EPHA 4BEQA 3DKLA 4UZUA 1ECQA 1QNRA 5DLCA 1FXQA 1FWNA 1AL8A 1M65A 1XFCA 5HANA 5KFBA 1B30A 1V03A 4JQ3A 4PTNA 3VPLA 2V3GA 3WLJA 3CUZA 1VJZA 2JKEA 4DPQA 2CKRA 4DBEA 3G22A 4TOQA 1WOBA 2DSKA 3IANA 2IMWP 1VS1A 4U28A 5KITA 4KF1A 3NZQA 2ZX9A 4UR9A 2J9YA 5A8GA 1UUOA 3EMQA 1W3LA 3K8MA 4CQDA 3OBKA 2YBTA 3NPXA 3QC0A 1C93A 1F6YA 4IMGA 2FMOA 1P6BA 5KT6A 3PW0A 2WNQA 2VXNA 4C90A 2E5BA 2XIIA 1THFD 3GY1A 4GCAA 4KIRA 1LUCB 2A7RA 3S2LA 4Q4KA 1BQCA 3CC1A 2DJXA 1AJZA 2IA6A 3M9NB 3BLEA 4MAVA 1US0A 4FSAA 3CL6A 1TB3A 1GYMA 4PN2A 3CZ8A 3AALA 3T0TA 3EB4A 1QBBA 3PJWA 4ZTYA 2E6FA 2HROA 3RR1A 1S1RA 2WWDA 4J9LA 3D5HA 3NOYA 1YXDA 2BY3A 1J96A 1DL3A 1SPQA 3N6JA 2D2HA 3TN3A 2AGOA 3WL1A 1F8MA 3VKAA 3THQA 2E09A 3O05A 3LXCA 4KRTA 1ITCA 3UXKA 1CXFA 3NQCA 5ABFB 4B5XA 1NTHA 3SW6A 3V35A 4HHMA 1ZCCA 2HSAA 4MSSA 3KZSA 2C18A 3L4VA 3G1RA 1GZ1A 3IJ8A 3E9AA 2VA2A 2OYKA 4WKAA 3ZWTA 3GHSA 1LWJA 5D2VA 3CUXA 1Q66A 3I10A 3A9BA 3WMSA 1U1UA 3W74A 4CN6A 1RCXB 3IS4A 4LUSA 4JX6A 1WX0A 2QCDB 4DIAA 2HPMA 4V28A 4QM1A 4ZTXA 1TWIA 4ADSA 5LNVA 1EX1A 3OZMA 3ANVA 1XBVA 5EWEA 1GOKA 4PCPA 2HBVA 3CM4A 3U3HA 2FB2A 3S2MA 1ZALA 4C7FA 2ZX6A 2ZUNA 2G3JA 4W86A 2BOGX 4S3DA 4OWGA 5AVHA 4YNGA 4ML4A 5HQLA 3FYPA 3T8LA 3HPSA 1TPEA 2YLAA 1JDFA 3GUWA 3LM3A 3MHGA 3GDBA 3RCMA 5HWMA 4ACYA 3TOPA 2DORA 4IJBA 3CT2A 3AICA 4GQQA 2V81A 2FLIA 4GO8A 2CETA 3OHIA 2ANUA 3NZ1A 3LCXA 4J9PA 4MF4A 4J3XA 1ADSA 1UR8A 4KCVA 1JUKA 1R3VA 3S1GA 5CZKA 4QHRA 1V3KA 5HINA 1PZ2A 5F2LA 1G4TA 1GJUA 4YQWA 4PL1A 3EZ4A 4J3TA 1H7XA 3ES7A 4MAZA 4E3VA 1KM5A 3S9YA 4K7VA 3F4VA 1WYIA 4L6OA 1N2VA 5JU6A 1YDOA 1B9ZA 2D2GA 5AOUA 3KHJA 2W9MA 2D24A 4LYKA 2J24A 4QXIA 3Q67A 1TV4A 3DFOA 5E6YA 3WNMA 4WHBA 1VZWA 3RRAA 5EMUA 4JEQA 3LTPA 3GHUA 3OW1A 4NZFA 5GJMA 2WMIA 3B03A 4EAMA 5H8MA 2C1IA 1BF6A 4AVOA 1PEZA 4EF9A 3TR9A 5CJMA 3H24A 4AC7C 1DQWA 3PAOA 3CBWA 5CPTA 2NT1A 4NKCA 1UZ4A 2G3NA 1JCJA 1UR0A 3CQ0A 4F66A 1M1BA 4F0LA 3H40A 2E9LA 3KUMA 4BQ2A 2ZKMX 4BQ4A 3B05A 3LHYA 3QPZA 3AHYA 4L5ZA 3TJLA 4CU8A 3T55A 5BMWA 4D8LA 3TWBA 1BGGA 2PP1A 4RDZA 4OOUA 2J4GA 2Z29A 1QMLA 1XYFA 3CAVA 3W7HA 5T9CE 1QOXA 3EXSA 4XO7A 2BHZA 3MI2A 4HTYA 3R12A 1VFHA 1B0IA 3DXIA 1VPQA 1GVSA 2XISA 3PK7A 1TJPA 1UP2A 3TZFA 4WXYA 5CBIA 7A3HA 1TTJA 1S2CA 3IVSA 1XQLA 2IPFA 3BQ6A 3EDEA 4U10A 3WCZA 4O1DA 3N2BA 4TR9A 4GPNA 5LA2A 4Q8NA 1KC7A 4IZGA 4HT3A 3MI6A 2XFRA 1C8XA 1SR9A 4KH2A 2TMDA 2OH2A 3R7MA 1RA0A 1NARA 3LQGA 4JICA 1QW9A 5DN1A 2WANA 1UOZA 2DZTA 4DJFA 1RLCL 1XPYA 5G4EA 5A69A 2ZCGA 3F4NA 3ARYA 1EO5A 4ZO6A 1M01A 3W2NA 4MY1A 4AY8A 2VWSA 4IXXA 4TXEA 4S38A 1T8XA 4HMEA 4DNHA 3CAWA 1KR1A 1JZ7A 5G4HC 1FWEC 3NPWA 1R7AA 3S2JA 4IR1A 4MB4A 2C3ZA 3KOFA 3VKDA 1GQLA 5AC7A 1UMYA 2E5CA 1NWUA 3GR4A 5FD0A 4DZ5A 2D1ZA 4EBDA 4LALA 3MQTA 4H8VA 3P80A 3MA8A 2BG5A 1IGSA 1E6PA 2ZIDA 4CCEA 5HNTA 1QI2A 1J0HA 4I7VA 1DWAM 1T5AA 4MFDA 1MI3A 5CJ5A 1SVDA 3ARUA 1HL8A 1E1CB 1U5HA 2W67A 4DLFA 5EPDA 1XIIA 3A3HA 1W6TA 1FCUA 4GJIA 5KFPA 1WKFA 3F7JA 3LGGA 3CV1A 1UWSA 3K5XA 3DAQA 4UTTC 4JTFA 1DXFA 3V0UA 4EK7A 3UA3A 4NASA 2ATLA 5GJNA 4MY9A 4G7EA 3MI3A 4EIVA 1G01A 1ZZMA 2FVKA 1G6CA 3VZXA 3G1SA 4FX8A 1H4PA 2VQTA 3NL2A 3PW5A 2A6LA 1GVYA 2OZTA 2JIEA 1E3ZA 4C60A 4Q6JA 4FNRA 3WQDA 3PW7A 2J8TA 1HF6A 1UKTA 3LEPA 4ECVA 5GJPA 3WLLA 3CHCA 5HNNA 5BXTA 1ISXA 4JFVA 2PDNA 2R8JA 1R3TA 3I6RA 1QW7A 2WPBA 2D2OA 3BG5A 2BQ3A 1D3HA 2WZEA 1E9ZB 4JXCA 2VUNA 1MW0A 2CW6A 4X0VA 1IT8A 2RDXA 3N25A 3LHZA 2DPJA 1E4IA 3IACA 2NLIA 1E4NA 2XVGA 4PC8A 4JIRA 4W7VA 3RAXA 4KRZA 3VOJA 1G94A 4ZQCA 4C5ZA 4KEMA 3GKAA 3GNPA 1EP3A 1HNYA 3FVDA 1XRSA 3UU0A 1GEQA 2VD8A 1WXZA 3LBMA 3OA3A 4JPGA 2YIHA 5AC5A 1IR2A 2XSBA 4TTGA 2GVJA 1W1ZA 4UCGA 5KFAA 3C0LA 2OODA 3KE0A 1ZJIA 2ALRA 3MWAA 4Q7NA 5CAKA 4MKSA 2RDTA 5FJRA 3W02A 4LGXA 1O1ZA 1XBYA 2V63A 2QNEA 1UH2A 1CT5A 2VRJA 3WD0A 2I9EA 4JYDA 5JUMA 2I9UA 3FEQA 1XLAA 4DBUA 2UWFA 3SN1A 2JE8A 4P8WA 2YFOA 1UP0A 5A6KA 2F2KA 2R1PA 1PCWA 1FKWA 2W9AA 4FS2A 1EF3A 2FHCA 3ARQA 3GSMA 2X0SA 2GDQA 3B4UA 3LV5A 4FA3A 1XUUA 3N18A 3R8RA 1HUVA 4PCFA 4O0ZA 4PRRA 4QRNA 3VDBA 4DHGA 5I23A 4I5UA 3MWCA 4KCWA 4CEUC 2QCLA 5LSMA 3N13A 3OGVA 1ITXA 4HB7A 3GM8A 4ATDA 1E56A 2TYSA 4LX4A 4B16A 2CNCA 2GDVA 4XBJA 1QHZA 3OOQA 3IJDA 3HOJA 4HZMA 2NQ5A 1CX9A 1JUBA 1TR1A 2ON3A 1WB0A 1YXYA 1QJWA 5EWFA 5EFFA 3MSDA 1GQJA 4IJRA 4LPCA 2QLYA 1Q2RA 4GK8A 4DX3A 2O9OA 3KRUA 4TV6A 4DXVA 2AU0A 4LAZA 4DM2A 4N0RA 3GD6A 1M53A 4W8AA 2QJGA 4XISA 3DU0A 3M0HA 3H26A 3V1PA 4ECYA 1JZ6A 3KCOA 4PBFA 2FH8A 3VIFA 3LMZA 4W87A 2XPKA 2PE4A 4US5A 1D2KA 1XCWA 1PX8A 4AVFA 1UBPC 1Q63A 1BYAA 4N2YA 4KGLA 3O16A 3L7RA 4IMAA 3YPIA 3TC6A 2XIMA 4J28A 2WSPA 3W23A 3K46A 1W37A 2ZZ1A 3RU6A 2PWUA 2X7VA 3IGUA 4PSRA 1AMYA 3DFNA 1JDAA 8XIAA 4FNTA 3URNA 4IPJA 1EQPA 1K02A 3IJ9A 3H4BA 3W2KA 2GJNA 5KFNA 2WZTA 2OSWA 1V6VA 1UUMA 1S5NA 1TUFA 1VD6A 4YXGA 1TCDA 3WFLA 2QCFA 1FWGC 1FWDC 4UWMA 5B7YA 1ONXA 3OHBA 1ISYA 4MYAA 1XIGA 1M6JA 3QHNA 5HWNA 3GH4A 4RCXA 5AYIA 2AMGA 2FZNA 1K8YA 3VKBA 5D30A 2VA3A 3H6OA 3EPIA 5H2ZA 1V3LA 4DAFA 1XFBA 4IP4A 1L6FA 4ED1A 1GYNA 3ZJ7A 2UBPC 4LH8A 2JFEX 3EXTA 3T0BA 2R1MA 2BSLA 3CTLA 2EPLX 1KWGA 4NT0A 3RBDA 4W84A 5LIXX 1Q8JA 2W62A 4C6PA 3QV7A 1U33A 4R8UB 3DYOA 3AWOA 4KWUA 1Z7AA 1Z32X 2A85A 2IXVA 3U5UA 1RAKA 3DIPA 4F0MA 3S5NA 3M9YA 1K9FA 3KOZA 4QNWA 4FX7A 4UQDA 1HQTA 4JTEA 3QF0A 4RXGA 2YFNA 3QN3A 4X3ZA 3DC0A 1IHIA 4AB4A 2OYLA 1V08A 1W5QA 3E1F1 5PTDA 4MB1A 2O9RA 4F4RA 1KV8A 1X1ZA 3GIIA 1M68A 3E49A 4B3LA 3CIVA 1CGYA 2YB4A 1RV8A 3ALGA 2F6KA 1NIUA 5KFYA 3W7RA 3WYZA 5K3VA 7ODCA 3OODA 3AIBA 3VC6A 1DPMA 3H2AA 3WDIA 4IRCA 4DYJA 2QW5A 3EOEA 4AZ7A 2QAFA 3M5XA 1LQ0A 3DFPA 2EBNA 4QJ5B 1GPWA 3RM8A 1GTHA 3APTA 4MHBA 1AJ0A 2VFHA 4N6FA 4K1WA 2OT1A 4N9DA 4XZWA 3CUFA 3FJNA 2VGBA 3EWZA 3GIJA 4AFYA 1POKA 3E2RA 3ZT7A 4L64A 2ICSA 4C6EA 4H3DA 4L1GA 1BLIA 3A6OA 4WY0F 3SRDA 1YPIA 2A7NA 2P88A 4N4PA 3BMWA 4L4PA 4O3NA 1X98A 1MMFA 3HJEA 2REQA 2PU0A 2VX4A 3P8IA 3A4WA 1KRAC 4AYGA 2QQ6A 1PX3A 3WD4A 4YVVA 1EKOA 2PLCA 2ZUWA 3K1DA 2PF8A 1S46A 1RD5A 3GWQA 5KT5A 5KG0A 3HQ1A 4IGSA 1EZWA 1PVNA 4KQNA 3T78A 1KBJA 2B81A 1HVQA 1GPFA 2OR2A 3GAKA 2FVLA 1QOPA 1TVLA 4L65A 3C5QA 4Q44A 1QR7A 3V6KA 3WF4A 3WUFA 3E0LA 3GXDA 1FKXA 5HOSA 3CHVA 3UD6A 3C0QA 4CUCA 2DSUA 2VEMA 4QP0A 1V0LA 4XKYB 2V6AA 1G4PA 3EOUA 1KFWA 1NELA 4IIGA 1FWIC 3P6LA 4FLSA 1XYCA 4DYEA 2WJFA 2ESCA 3S1WA 5DGBA 4O8AA 3W2MA 3L66A 1MWOA 1BYDA 3G0XA 1BPLB 3NDYA 3GU9A 1BXBA 5D8ZA 1CGTA 1GKQA 5AHLA 1A0EA 5D9NA 1ZJHA 4DEZA 4ZQPA 3W1QA 1MXDA 2CLOA 4FIQA 1I75A 2IQDA 4NUWA 4FALA 3AIEA 1XIBA 2GUUA 1AL7A 1YPFA 1T94A 5F2MA 2B4GA 3TV8A 2ZRUA 1VEPA 3FSTA 2QCNA 3EKZA 2VJXA 1I2QA 3IIOA 3S46A 1VYRA 4IISA 3Q58A 4IUOA 4S3AA 1DORA 4QWEA 4H9UA 1M03A 2AGTA 4XO6A 1J4EA 4Z2KA 2ZZ4A 2CWXA 3J7HA 2XH4A 4O16A 1OZQA 3WKZA 2RAGA 1TA3A 3KW3A 5DF0A 4UZSA 3ZOAA 5TAOA 4ZVJA 2BGQA 4H6QA 4PMUA 1YNQA 4NAEB 2DV0A 3CS2A 1YTKA 2GOUA 5ABTA 2WM0A 1KM6A 3LPOA 1LT7A 4S3CA 4M19A 3L23A 1CXEA 5IOBA 3P82A 4K7YA 1SW3A 1L0PA 4MPKA 4A29A 1F8IA 1JRBA 4K68A 3GV5B 3H4XA 3N3MA 4J3ZA 5DX7A 5FIPA 1NVMA 2E25A 2HS6A 4HNOA 3BAWA 4WF7A 3RLHA 3CO8A 1XLEA 1RALA 3H2CA 5I02A 2O55A 4K6AA 1H7OA 3W7LA 4WJEA 2Z1WA 1H7RA 4LVGA 5DEZA 4XB3A 2XWEA 1J6PA 3QY6A 1QU4A 4WGXA 4DELA 4RE0A 2WNWA 3NSMA 4O52A 4OV9A 1P6WA 1H0IA 4QBXA 4BY3A 4A22A 3VKCA 4TU1A 4A2SA 1TIWA 3VOFA 1PTGA 1SFLA 3FCPA 4XAPA 1UUQA 4J3WA 4HA0A 3IRSA 1O5QA 2J6SA 3MKCA 3NGDA 4LYQA 1FHDA 2XUCA 4HZ8A 5BZAA 1WA3A 4PBEA 5CJNA 3CUGA 3JW7A 1F4AA 3RFAA 3ITGA 3UG5A 3V16A 2TSYA 3RILA 3WLHA 5FF3A 3TONA 4I6KA 4YS1A 4DLMA 4QW8A 1VBUA 2WAGA 3WDRA 2W3ZA 4K8EA 1F3WA 5E0CA 1R3WA 4EVZA 3N2MA 4O1CA 4Z2IA 4PODA 3G1XA 3VYLA 3UVIA 2R8GA 1E1EA 1S2TA 2Z7KA 4ZE5A 2XC9A 3TNOA 3C6CA 1YPXA 2PDQA 5HR6A 3T07A 3GRIA 3WBEA 3L65A 3D3FA 4RW3A 4J40A 1AODA 2UVRA 3EOOA 1W1TA 3GKFA 3UG3A 1B3XA 1VBGA 1DIOA 2ACRA 4KEUA 1E3XA 2DGAA 3DHFA 5GPRA 3XINA 1SJCA 5FOOA 2BGNE 3PJTA 5LA1A 4ED0A 1SZGA 4J2MA 1E6NA 4CVUA 4AG0A 3H54A 2VI0A 3H12A 3W1UA 3K8KA 1MRQA 3Q4DA 5DG9A 5E0KA 2FZ9A 6ALDA 3NQBA 3BLOA 5I00A 1UP3A 1TJ1A 1BWKA 1QFEA 3EMCA 4DBDA 3D47A 1V6XA 4HU0A 1XLGA 2GUBA 1UW9A 1ZFJA 3A3XA 3MY9A 4XD3A 3ZJ6A 2J27A 3WNPA 1UWQA 1S1PA 2FFCA 4LB3A 4H9XA 1Q45A 5GQBA 2GK1A 4CNNA 3W7QA 1YX1A 5EA9A 1EH9A 1ICSA 1UR2A 3AIQA 4HHPA 1OIFA 4O8RA 3FGCB 4ZGYA 1M9HA 4ECRA 1VHNA 1WBHA 1Y5WA 3VNJA 1V0MA 4XSMA 4A3UA 2ZYFA 1BXCA 3B8IA 1NDVA 1UQYA 3VDAA 4KWVA 4ED7A 1I2RA 2BOFX 3GC4A 3NM1A 2MNRA 3R89A 4KT2A 1T96A 4AIUA 2GPTA 2WC4A 3TTSA 4FHAA 4J7RA 1SZNA 1KM4A 1M7OA 4AAJA 7CGTA 1XIFA 1BYBA 1XD1A 4H2HA 3F1QA 3FOKA 3QV6A 3LCGA 3STGA 1GOQA 2IUZA 2Y85A 3CYJA 4JNZA 1W2VA 1K1SA 3G2GA 2AGQA 1LJYA 3CEPA 4HYKA 2X30A 5EFDA 4G6CA 2F2HA 4MNKA 4OU1A 1GVQA 1E51A 2X1IA 5AHFA 2OLHA 4MWAD 1Q3NA 3QSTA 4BKNA 3VILA 3NQFA 3WQVA 5KMYA 3ALFA 1W1IE 1SJDA 3DI0A 3SURA 3S2CA 4F9DA 2HRWA 4MB3A 4PRWA 3NWRA 2CBVA 2VENA 3GH7A 3NGFA 5U7SA 3UJEA 2DIKA 5D37A 4RPQA 4Q22A 2VEIA 1OT1A 1WOAA 4NJJA 2PC8A 4OQVA 1YBQB 3W1TA 3T5LA 1GVEA 2PGFA 2ZC8A 3SQLA 1QNOA 3IPWA 2X0HA 1HTIA 1R38A 1I8JA 5IDIA 1JZ8A 3QZAA 2VX7A 2ATSA 1RQBA 3I68A 2G0WA 1PJ9A 1ZAIA 4WX2A 1H11A 2AAMA 1RVKA 1F7BA 4KFOA 5AHEA 4WR3A 3VDHA 2C19A 4NHVA 3EPOA 4GFIA 3W81A 4HP5A 4O10A 2RH9A 4LUJA 4GH1A 1LP6A 1YQ2A 3PZPA 4E2VA 1XISA 5A5WA 1DQUA 4Z08A 1A3XA 1OFOA 4MADA 2A0NA 1VQTA 4L6HA 1BEUA 5CG7A 4UOQA 5DRIA 4C1KA 2VUYA 4LTSA 4HMNA 5L9XA 1LQAA 4UFLA 3HPFA 3Q8PB 1MQRA 2D69A 2WMJA 1GORA 3TK7A 3SY5A 1LCOA 4L6DA 3KBJA 4IQEA 4XG1A 1OVDA 3KZPA 1RPXA 3A64A 3EEZA 3C2YA 4O13A 4AZCA 3DERA 2XVNA 3BGJA 3T6CA 3EWWA 3BMVA 4TX8A 2JALA 4L61A 3C86A 3T05A 4BF7A 1ZBVA 3UXIA 3LU2A 2Y7DA 3UNTA 3RMJA 4MZ8A 2DDXA 2BLEA 2FDSA 2NXHA 3CAQA 1VLIA 4LFYA 1TVNA 2VC9A 4MJMA 1C7SA 5C9RA 1DJZA 3SUTA 3TWAA 3L5LA 4LBRA 3E0WA 3G8EA 3EA2A 3GXTA 5CC5A 2YL5A 4A35A 3PANA 1C90A 2C13A 1UIOA 2H8XA 2H9AB 2PB1A 2YX0A 2A4AA 2ZA3A 3H8AA 3POCA 3OLDA 1EL3A 2ZE0A 1O94A 1MUCA 3U4AA 3GR7A 4UMAA 4C5YA 3V4BA 2WBKA 2Q01A 1S3HA 4L9XA 3WDHA 1M04A 4UTKA 2AQ4A 3ZO9A 4DJDD 2VFGA 5LGZA 1XV8A 3M7SA 6PTDA 4YMZA 4ROPA 3S1VA 2JKAA 3LZ3A 4C7DA 1UZHA 4YR0A 5CC6A 1ECEA 4JTRA 1EUNA 5FSDC 3H2NA 1HW6A 3WX7A 1KFLA 3ABZA 4RV8A 2VFFA 4J9OA 3U48A 4JIEA 1UPMB 3IGSA 2GVEA 1ESWA 3EWDA 2EQDA 4ECTA 1GT8A 3H7UA 3NQDA 2XDFA 3R10A 4M81A 2Z1XA 2DUZA 3QRHA 4QW9A 1EJSC 1LORA 1PIIA 4HYVA 1OFQA 4E6MA 1BSLA 4ATWA 4OBRA 4N9EA 4GC3A 4AC1X 4Z1DA 4AZ6A 3D3AA 1TWSA 4IMEA 1W17A 2W8LA 5D2WA 3VE9A 2FZMA 1TWWA 2V5CA 3A4XA 5G4WA 1OCBA 4U5KA 1ZY9A 1EIBA 9CGTA 5CZ0A 4ZEPA 1IE7C 3OVRA 2HE8A 1R9ZA 1XLHA 1FDJA 4O3OA 1BFNA 3VGGA 4MKVA 4C1NA 3F5JA 4GY7A 1S97A 1Q6GA 3S42A 2BS9A 3MKKA 1OQFA 3GS6A 4RNNA 2G41A 2YDSA 1EOKA 3WLMA 2ASJA 3M0YA 1ELSA 2V3EA 2YZRA 4DL7A 1PKLA 4F2BA 1FRBA 1W1YA 3GTXA 3SJNA 4EKJA 4F0KA 4EYIB 3GXFA 2Y5SA 3WQFA 3MZ2A 1RLDA 3ZFHA 1LOLA 1XH0A 4RZBA 4UIOA 1SJAA 1SJBA 1UH4A 3QMSA 2WZHA 5CPOA 1W9BM 2BY2A 3P0WA 1SYTA 1XIHA 2PWGA 4NZ1A 1DIEA 3RR4A 3W01A 2XN2A 1RQEA 1ME8A 4UMCA 1QI4A 2I5IA 3AROA 3WMLA 4A8IA 1VBJA 1ZBCA 1DYSA 3HFTA 1KGUA 3WUEA 3L5AA 5MKGB 3NQMA 1L6SA 3P8JA 2OPJA 4RLIA 1XH1A 1TV3A 2J47A 4GKTA 3NR0A 3C61A 4P7LA 3T8QA 3F5LA 3LCFA 4QE4A 4HPHA 4JFUA 4H7ZA 5AY7A 4O3PA 1O5XA 3FA3A 4GYKA 1O12A 1R9XA 1SZFA 4ONVA 5DGAA 2C8NA 3EKGA 3LLXA 1P4CA 4V1YA 3UCDA 4AY7A 3VNMA 1ZUAX 3GX9A 4C6LA 5F4WA 1KTBA 3UJ2A 1ZRQA 4RX0A 4EWND 3PNZA 3BLPX 1JNDA 1LRTA 3GFXA 2PLMA 4RZRA 1H1NA 1ODUA 4GRSA 3OQEA 4RPPA 3K4WA 2CESA 3NO1A 4NNCA 1OT2A 3P2VA 3CHDA 3GG7A 1WKYA 3JUGA 3NQGA 2O0TA 4ASTA 1EF2A 5DO8A 4GINA 1RQHA 3M44A 4PYSA 7REQB 3VX1A 4O0KA 2Y61A 2WM1A 4BWLC 4DRSA 4H1ZA 2X0YA 2CBJA 3WLOA 1KWKA 3W27A 4OBTA 3SGZA 1DWHM 3WELA 1KNWA 3E3HA 3N2OA 5ECUA 4AHOA 3LQLA 1R3QA 2ZWZA 1W5NA 2OJPA 3GILA 2FJUB 4IFKA 1HGYA 1IXPA 4MUZA 1DXEA 1F3XA 2E9MA 1PUDA 4YTRA 4YTQA 1LOQA 1DE5A 1RUSA 2FFIA 4CQAA 1B3VA 5EDWA 1GQNA 5FACA 2VGIA 2XU2A 1IEIA 4XSLA 3P67A 3ZSSA 2V2HA 2QJNA 1Z69A 4LB4A 4GJ1A 1XLIA 1G4EA 3H2FA 3CPRA 3L12A 4FLOA 3U57A 1NF0A 4S1FA 1XIEA 2R24A 2JEIA 2V68A 3OO2A 3IVUA 4CNUA 1QW8A 2EEXA 3R4IA 2YXOA 3MJMA 5CC3A 1OJXA 1BYCA 1GVOA 2DVUA 4QEHA 4IHCA 4ZB0A 3VGBA 2FYMA 3CU2A 3OB8A 2NWSA 5EMYA 3W3OA 2VR4A 1E1FA 2VZUA 3ID7A 4CNTA 5LYRA 3QGAC 3CZJA 1V8EA 3D6NA 4IP7A 2W63A 5E93A 3VGFA 4GUJA 2P0IA 4HU3A 1D8CA 5B80A 3M0LA 4WY0A 3WMBA 3C0SA 4H83A 2W79A 3NA8A 5CZTA 4B5SA 3EOLA 1R2RA 2ACSA 3LHVA 3KOWA 1L9WA 3VD7A 4U4MA 3L68A 5K9DA 1OF6A 3AHVA 2J78A 4XIAA 4W89A 4O53A 5CH9A 4S39A 4DWDA 3SCTA 3QYSA 1JUEA 5FJUA 5E6ZA 2JEJA 4AWUA 3KWXA 2ZUSA 3F2BA 4UQCA 1FY6A 2DT0A 4LAMA 2EF9A 2H90A 2WSYA 1Q7MA 4XD4A 2ZZ5A 2WC3A 4KKXA 2G3IA 1NQKA 3DN5A 1V02E 4H6KA 4OUEA 1JRCA 2I56A 3DFYA 4JTIA 3WLKX 1Q6FA 4DF1A 2XCPA 1VFTA 4M29A 4C6OA 2PC4A 3BJTA 3CUJA 2EKGA 1OG6A 1LWIA 1TZ9A 3LXAA 5I0DA 5A8MA 1VCFA 1VHCA 3SADA 3DHUA 3TTYA 1IWAA 5FJJA 1JNEA 5HULA 2INFA 4PBGA 3S6DA 4ECWA 3RX2A 4O1FA 3INPA 4GLEA 3CJPA 4UCFA 3GFZA 4NI8A 3VM7A 1YEYA 3OSNA 4KWSA 3WFAA 2FZDA 1XPGA 1AH3A 2WBGA 2QV4A 3T9PA 3VOHA 5I78A 1NDWA 4GI4A 3K1GA 4JFTA 5AYBA 3W82A 3MMUA 1Q4NX 3OU8A 5HMEA 3M46A 1PXGA 4ZB5A 3T5KA 5BNKA 1EXPA 1UD4A 2WNNA 4HIBA 3QTPA 4UFKA 2HZGA 1NWRA 5CPMA 1RY8A 4TMCA 3UNDA 4ZA0A 1K8XA 4AXNA 1VP5A 1GCYA 1A3HA 4GA8A 1IEXA 2BHYA 4ML9A 1G5AA 1K3UA 3RNDA 2W9CB 2V69A 3S5ZA 1JF6A 3ITYA 3DG6A 5A2AA 1FFRA 1MFVA 1TPDA 1ADOA 4QJ1A 1WP6A 4MJ4A 4EPKA 3TSMA 3CZEA 1OC5A 1NFPA 4FR6A 4HQVA 1IWBA 1MW1A 3FHAA 4I6VA 5G5IA 2C22A 2YB1A 4A3HA 5ECVA 3QZ7A 3LD5A 3HU7A 1CGXA 3WDJA 5HNUA 3W7CA 5A3HA 4PCNA 4EXQA 3AC0A 1CLXA 4LCRA 4NZ4A 1W9VA 1V3JA 3MB9A 4TVUA 1CENA 4H9YA 4LF1A 4PB3A 3PWAA 2UY5A 5DBTA 4MJ2A 5ABFA 3BAYA 1TFVA 3LERA 4H9TA 5JUVA 2X1UA 3LB0A 1H60A 2DW6A 4GZJA 5AC4A 3B9DA 4IFRA 2E4TA 2GGJA 3GZ3A 1EO7A 5BOFA 1OFRA 4ZQMA 2QV5A 5KFCA 4IP5A 2GWGA 2NV2A 4DYKA 1SFSA 2QCDA 1NFBA 3VDGA 4HGXA 2EG6A 2EG7A 4BJHA 2XINA 1IQ8A 5AHIA 5KFZA 3LHWA 1K4HA 4LNYA 3W72A 1W9PA 4B3ZA 3RF9A 5A6JA 1LRNA 4WDXA 2D3LA 5KSWA 2R8KA 1J0IA 1XSJA 2JEPA 1S5MA 1DP0A 3QVQA 3IIXA 3ES8A 3TMQA 3TP4A 4JX4A 4D72A 4H9ZA 4JR5A 4AD2A 4CCZA 3MUZ1 1B4KA 1P43A 3LTSA 3LNPA 3HGOA 2VT0A 1W2PA 2R91A 2ALDA 2WYSA 4WD0A 3SM0A 1BTCA 3OEXA 4AXKA 4KWWA 5CBJA 4GBDA 3IV8A 5JIWA 2QIWA 3RO6A 3DX5A 2NX9A 1ONWA 3QZEA 2GGGA 1F4HA 2WO5A 4H2CA 3XISA 3P0XA 5FF0A 4WDUA 1OIMA 4AD5A 3PY2A 2GOKA 2J79A 2BB0A 4HSNA 2CLMA 4KIEA 4BCEA 1H2JA 4NVTA 1CECA 4U31A 4H8HA 3TXVA 2V38A 5CPQA 3HF3A 1GJWA 4WLCA 4O4VA 5HATA 2POTA 3LCHA 4DEFA 1JD7A 4LC8A 4PCSA 2XH0A 2W7OA 4JX5A 1KFBA 1TKKA 3TKFA 4BWLA 2PBOA 2Z1KA 1HJUA 3W28A 4B90A 1B3ZA 3GLCA 3MMDA 8CGTA 4TO8A 3T81A 3WK1A 3G0UA 1KBIA 1UWUA 1A80A 2DU2A 1CIUA 3BAKA 1A5OC 2CITA 3B8TA 4CKQA 1FXPA 4AWTA 1CI1A 1S10A 3O0FA 3W1RA 2NSOA 2TRSA 4B5WA 2X2YA 1US3A 1TCMA 1JGMA 3WQ6A 4CVWA 2VKZG 2DJLA 4JEJA 2OLAA 1UIPA 3T1GA 3M0IA 3WLRA 3ME3A 4PUUA 1AA1B 3IUDA 4PGLA 4WGHA 1R7OA 1DJHA 2GL5A 5KT3A 3MP5A 4RV3A 4WRHA 3T7VA 1F2JA 3T42A 4ZOEA 5FAJA 1H09A 3M0MA 2Z00A 1XP3A 1B3WA 1OX4B 4EACA 1LM1A 4Z1BA 1OY0A 2A3BA 4WSKA 3B3DA 4LUYA 5KG5A 4DAIA 9XIAA 4C65A 2NSXA 1X1NA 1PB0A 4QS5A 1KBBA 3C56A 2PWHA 1HKVA 2OX1A 3WY1A 3EPGA 4I3GA 3M4HA 1OG0A 3EAUA 1CXIA 2OLSA 3KCLA 1LL6A 1CGVA 2HMCA 2HV5A 2RJGA 2A3LA 4FPSA 2VZTA 2XVLA 3I4KA 2ZXBA 4I5XA 2QXWA 1M7JA 1EJVC 3S2NA 2QDDA 2BZNA 3AJXA 3WH9A 3GGMA 5DG8A 1LG2A 4NU7A 5HUPA 1JI2A 4QITA 4KERA 4JD4A 4CQCA 3CO4A 1GOOA 2J25A 3ZLHA 1J79A 4F0RA 1VC4A 3BAJA 4LSBA 1FA2A 4GJJA 5I3IA 3G1FA 3L4XA 3PFMA 1RVGA 2ISSA 2W66A 4U7CA 1H49A 3PWIA 3HMJG 1OX6A 1F9CA 1C9WA 3O15A 4Q4SA 4IG2B 1OCQA 3AYSA 1E4LA 1MRAA 2Y7EA 3QTGA 2FIQA 5M17A 1XR2A 1UBSA 3KVKA 1OYBA 5T91A 1TRDA 1UKOA 5KFMA 3M6YA 4AZBA 4JKLA 1LZOA 4XZNX 4HMCA 4O50A 4H7VA 2TAAA 3EDKA 4YYCA 4HCDA 2YA2A 2FZBA 2QPSA 3KDNA 2J77A 1J10A 1UR9A 4Y2WA 3PB2A 2RFGA 2VP8A 1QCWA 1PV8A 4ZO8A 2OXNA 1E1CA 1GG0A 1JPMA 4RR4A 5M03A 1WAUA 3JU2A 5KG1A 2PLJA 4Y6GA 1HIZA 3NNTA 2WMIB 4R5EA 4FAMA 5F2IA 1EYEA 3GBEA 3H70A 1NQ6A 3KOYA 3IGXA 4GBUA 3TTEA 4DBSA 1YIXA 3GDKA 2YA1A 2OZ8A 3QHOA 3WBAA 1KFCA 3PULA 4H6EA 1WKEA 1B57A 4NY2A 3DECA 1LYXA 2XIQA 3AUJA 3HJZA 4ERIA 3RX3A 3Q8QB 2HVOA 4KETA 4QIUA 2EPOA 1E6XM 3LI1A 2V0TA 1KRMA 3RN6A 4J9NA 4XWUA 3IWPA 3AXKA 4MIMA 1X97A 3LSBA 4D6DA 4H6RA 3BGAA 3LSCA 1WDPA 5AB3A 5H91A 1XCXA 1QK2A 2OX4A 4MY8A 1V7YA 4EXAA 5KFKA 4O15A 2W8KA 3UERA 2D0GA 3P5YA 4HD5A 3MBDA 1QO2A 4E2OA 3L0NA 3H2EA 4QJ3B 5C9XA 1KV5A 1SO3A 4AYSA 1XLCA 3AIRA 2J8GA 3OZYA 4MNMA 1QASA 1J5TA 4FOKA 3W22A 4WDWA 5CG0A 2W0UA 3KAOA 2PP0A 3TE9A 1AG1O 3B0XA 4LVAA 5KFTA 2FGLA 6TIMA 3CQJA 2R94A 3H4GA 2IQ0A 1P1XA 3OTRA 1I0DA 4QCFA 4JUZA 5CKSA 1EDGA 4F9JA 3N2CA 3EWUA 3VIMA 3G1AA 4UC5A 5H1WA 1M5WA 4CQ9A 3A47A 3RB4A 1XS2A 5DRCA 3SY8A 1J2WA 2ZE3A 2YBVA 4PMVA 2VEFA 5KFIA 1ME7A 4NXSA 4QDPA 1AZ2A 4JTGA 2Q8ZA 1A53A 3BW4A 4ICCX 1U5VA 4PUJA 1NWTA 1PWMA 1W1PA 2QS8A 3QOKA 5M2FX 3A13A 1V3MA 3UT0A 1S0MA 3GTIA 2NQHA 3PG9A 3VCCA 1QTWA 1YNPA 4OT7A 5BXSA 5CEWA 2EKCA 3NL5A 3TYCA 2VEKA 2NT0A 1ALDA 1QRQA 1W3NA 4W4QA 2PWFA 4P7RA 2Q02A 3VM5A 1Z42A 3GDLA 3L4YA 3AS2A 3ZR6A 3SGGA 1X1OA 1AQFA 2PTYA 1KM0A 4GOAA 5JMUA 1KFKA 4NNBA 1ZJAA 1LL7A 1PYFA 5ABGA 4EXBA 5LXXA 3MUY1 4FNSA 5DELA 4PMXA 3TXZA 3LBCA 4IPNB 2NUWA 4RDYA 4JZ5A 1PTDA 2WSQA 4G7EB 3LCLA 1PS9A 1SO6A 1EXBA 3IIPA 4UTWA 1N8IA 3MUCA 1J12A 1A5SA 4LVFA 5FI8A 2CLEA 3GXNA 3VDCA 4D2JA 4RNMA 1L6WA 4D6IA 4URIA 5KG4A 3OSPA 2QPUA 4LV9A 3H22A 3B0UX 1GW9A 2R8HA 3SFKA 5TQLA 2Y88A 4M7SA 1EP1A 3A21A 3I7QA 2QF7A 2QCMA 4R9OA 2ZUMA 4Q4OA 4AW7A 5KFUA 3POHA 1X6NA 3OHMB 3C3UA 1R47A 1OFAA 4ENLA 4GGBA 3E2QA 1QT1A 2AL2B 2AQOA 4WSHA 1Z41A 2WMFA 4AD4A 5A6BD 3U0HA 1NH6A 4Q8FA 3CYVA 4DUWA 3A5FA 2WJDA 1DEDA 1OYAA 2FZ8A 3E12A 3BJFA 3FAWA 1B2YA 2XZ7A 3WSUA 4J35A 4QNEA 4QISA 1S0OA 1XLJA 4UXDA 3KHDA 4Q8UA 1MEHA 3GU1A 3S1UA 4TMBA 3QFWA 3AXXA 3WQGA 4XZ9A 3F4CA 4RZ5A 1KKRA 3V18A 5TIMA 4XIMA 4REQB 1L6GA 3CLWA 3HBLA 1OM0A 1S5WA 3MMWA 1SSGA 4HSHA 1V6YA 5D02A 1JYVA 1UWAA 2BY0A 1VAHA 1FOBA 2VVSA 1MXSA 2FPVA 1U83A 2WK2A 5B7ZA 3G24A 1ZTVA 4TVDA 3ZS4A 1T3NA 3W6MA 3BW3A 1RY0A 5M1TA 4R8UA 2XFWA 3VI2A 4O3RA 3E38A 3UCQA 2DSZA 2J6UA 4AF0B 5KEZA 1KLZA 3LM7A 4F2UA 2UVWA 1Y7VA 2VWTA 2FB3A 4UQ9A 3G0SA 3UYCA 3W4RA 2VYOA 1OB0A 3PZNA 1UC5A 5T26A 1H1YA 1EZ2A 2PRHA 1XM3A 3VO0A 3RAQA 4TX6A 1ISZA 3D46A 3FN9A 3VMPA 1R87A 3ARXA 1AZ1A 1OK4A 1GZJA 4BF5A 4QSFA 1H63A 4FP1A 2VFDA 1UA3A 1BQGA 1E15A 3VTRA 3ITCA 1FDZA 5FKYA 1MNZA 5LKYA 4CU7A 2BP1A 1T99A 1RR2A 3MCOA 3MSGA 4J4KA 3IAPA 4JIIX 3B40A 4IIDA 1UJQA 3F2DA 1ZL1A 1RH9A 4RDVA 2X7WA 2B7NA 4JGDA 5KFOA 3B97A 1K8CA 3GB6A 4AD0A 3C2VA 2PUZA 5BROA 4NZ5A 3KP0A 1CDGA 3ZR4A 3BZGA 1TMQA 1VEMA 1TZ7A 3CPGA 3GC5A 3CUIA 1CB7B 1H1ZA 3V5FA 4A6GA 2TPSA 4DY1A 4CQ8A 2X09A 4RK8A 1L8NA 1IZCA 1W3KA 5E9XA 1H50A 1KXVA 3V6HA 1TYGA 4GZIA 4QAWA 1VEOA 5AYYA 5CAHA 5M5DA 1F6KA 3FYOA 5EGRA 4S3GA 4CD8A 4D1JA 4WJ8A 1P0KA 3MSRA 4UB9A 3R43A 2YR1A 3AZRA 4YJ5A 4DJFC 3RITA 4JIPA 2V9WA 3RUBL 3BLLA 3CL7A 4NL1A 4HPGA 2NV1A 4XKYA 2B7QA 4GX8A 5EB8A 1DWFM 1EJWC 3ITXA 2V8ZA 4F50A 4D6JA 4B3KA 3EPNA 1B4EA 3AHTA 2DQWA 4NP7A 1RK5A 3GR8A 5G2IA 2PDPA 3GG1A 1A5CA 2VRKA 2X1TA 3SCRA 3CH0A 3GZAA 3TX9A 3STCA 3OA5A 4HK5A 4DNMA 1VFMA 4NF7A 3BWWA 3FEMA 4Q43A 5CXPA 1LLOA 4ZOBA 3M7WA 2IXUA 2PA6A 3SRKA 2E40A 2OO0A 1JXLA 3KL0A 4BK9A 3VABA 2VMFA 1GKPA 5JH1A 4E4PA 1JYXA 1SMAA 3UYIA 3FSUA 4J2PA 2FLNA 3V0SA 2ZQ0A 2W5FA 1OADA 1QHOA 3THAA 1AUSL 4R88A 1JYNA 3WEOA 2IKJA 5HPOA 2FLLA 3IAQA 5CZJA 2E3ZA 3THUA 1HJWA 2AKMA 3ZYZA 2CZ5A 1V77A 2PGRA 4Z1CA 1SQ7A 4YIWA 4ECZA 1HL9A 2A5HA 3MYOA 4GUHA 3MDUA 3FW6A 2Q3RA 4NAEA 3VNIA 4A4AA 5LNRA 2E6AA 4Z2LA 3WQEA 5A2CA 1A0DA 2XIOA 1HJVA 5REQA 3ZM8A 2V30A 4X60A 4JHOA 5KFEA 4LVBA 3MTWA 6ENLA 1VIZA 3W1LA 1XYMA 2YDRA 3BC9A 3C2EA 2AMXA 1HL2A 4JY8A 2AGPA 5I3KA 2CBIA 1XLMA 3CEUA 4J27A 3C8NA 3MUXA 3AIWA 2H8ZA 3T0DA 4JDYA 4QQ3A 4WIWA 2I57A 4WQ6A 2GJXA 2V3DA 2FPYA 3C2RA 1I45A 3ABSA 2DP3A 3MCNA 1UJPA 1J6OA 3E96A 5EYWA 2Y8KA 1XX1A 4B2DA 1W54A 1UZDA 4Q8MA 3U2OA 5HJXA 2XVPA 1CGWA 3O6YX 4TQSA 1TWDA 3AI0A 3TU9A 3SCPA 3FAXA 4BI6A 2V5DA 1FX6A 4Z0JA 1NEYA 4QG9A 1TPH1 2C7FA 1KLYA 1ZHAA 2WZIA 1ISWA 4E38A 1W3HA 4DO7A 1VJSA 4O3SA 3WQ8A 5I77A 5F7UA 1NDZA 3EWXA 1FFQA 4H9MA 3L21A 4J3SA 2OGYA 3NL3A 5F1VA 2QYGA 1FP9A 1GOXA 4JS3A 3BLFA 4PEEA 4KEZA 1TRIA 4F0HA 3U2ZA 4UNLA 3ARTA 2J7BA 1Z44A 1PCKA 4QCEA 2VM8A 3I3DA 4G5DA 3E74A 3QGKC 1OFPA 4AZ5A 2R1NA 2BODX 1TJ2A 5BU6A 1XUZA 1ENUA 4B4FA 1A5NC 2FPTA 1X8FA 5BU9A 4CEXC 1YDYA 3DFTA 3O06A 3NZRA 3TW9A 3CZKA 3AXIA 4PFMA 3V7PA 4FOJA 1VRDA 3CPUA 2PCQA 3AMGA 5A8OA 2JGYA 3UG8A 5TD4A 3RPDA 2X40A 5BRPA 1A5BA 1F07A 2XYLA 1T7LA 2ODOA 4Y96A 2AAAA 3DGRA 3DG3A 3UETA 3FVMA 1CXKA 4KWOA 2JIWA 3PBYA 2JEFA 4HBKA 3UPMA 4GI9A 2P8CA 2J6TA 3GXIA 5CSYA 1SW0A 3CGTA 4NQ1A 4FNUA 4ZOCA 3KTCA 3E6EA 2IPJA 3UPWA 1TO3A 4R7OA 1TIMA 2WJZA 1GJPA 3WJWA 2QT3A 2IS7A 4L9ZA 3BURA 3W07A 1SZRA 3GIPA 4CU6A 1F76A 3ITLA 3B04A 5IFPA 1KD0A 1NP0A 3QM3A 4HCHA 1JPKA 3VIIA 5LNWA 3HG2A 1MEIA 4J3UA 4QLKA 4YCOA 3G6YA 3T0AA 2JGQA 4XZBA 3VIJA 3BK0A 4DJED 4Y90A 5DMNA 2PODA 3WNLA 3PZVA 3W7OA 3W7PA 4GE8A 4ES4A 4BA0A 2DZPA 1ML1A 1QWKA 2QULA 5BRQA 1HP5A 3AZTA 2XN0A 2ZTJA 5LZLA 2WVUA 1AJ2A 3URBA 3TA9A 3LRLA 3QH2A 1V93A 3BPWA 5KZEA 1KXQA 4C6KA 4CN1A 3SCVA 3OP2A 4ZR8A 1NP2A 1OX5A 3QLDA 4O0QA 3C2OA 3LRMA 1XG3A 4J1OA 2E6YA 1AMKA 4I7UA 1SM9A 5BWAA 2PTWA 1K03A 3U6WA 1Q8AA 1QUMA 2GUYA 3R25A 1RBOB 2G37A 5J8LA 4RL3A 4LYRA 4LBSA 3OBAA 3W7MA 4Z42C 4QWDA 3R0UA 4MWAE 2PDGA 4NYYA 2PDXA 4XZHA 3WD2A 1EB3A 1NFGA 3V5OA 3O63A 4OE7A 3LTYA 1JVNA 2XVKA 3A24A 3N2TA 3G6VA 1UOKA 2XZ9A 2GWNA 4A2RA 3EXRA 4ZXOA 1V02A 4W7UA 2Y63A 2F8QA 4M82A 5IHSA 3S8HA 4O19A 4IR9A 1NJJA 4L4OA 3VGEA 2DUXA 3TN6A 3OGSA 3PB0A 3BAXA 5G1YA 4DBWA 2HJPA 1DV7A 4RNOA 3VFLA 4GNKB 3N1AA 4YPJA 2XH2A 3WQWA 3KVJA 2E5DA 5I79A 2G8ZA 1YBQA 3TUUA 1R2SA 3MDWA 2I14A 1XINA 1DJNA 4AU0A 5ABEA 4JN6A 1KA9F 3PPCA 2QHAA 2D23A 3QOMA 3ABQA 2G5WA 1L2UA 1US2A 3S47A 2DSVA 2FTWA 4XZMX 5D9OA 1H62A 3VXGA 2EPKX 4FS1A 3LI0A 3B9EA 3WNOA 5DQIA 1P48A 4PMZA 4NILA 3UZYA 2J62A 2ZZ3A 4G8TA 3A22A 3ZT6A 1QI3A 3BQ2A 1YXCA 3PBGA 5C55A 4ZO9A 3CUHA 4UNKA 1CLKA 3USZA 3LNMA 4KMQA 4FNQA 2F61A 2HEJA 1EJ7L 3II1A 2CFFA 3ARWA 3KTSA 3N12A 4ACZB 3G3DA 3NPUA 4J9MA 1KO0A 3S5OA 2WMKA 4ALDA 4MYXA 4D6GA 3P5ZA 4DL2A 4MLRA 2YCJA 4XUYA 3GDTA 4JV0A 2DFAA 5FSEC 1YRRA 2R82A 4LNCA 3VIPA 3REQB 1HKMA 1FCQA 3I65A 4YWIA 2XGQA 3DZ1A 3G6LA 2FH6A 4F4ZA 1OCJA 3CHFA 2OU4A 4ORMA 1W9DM 2GGHA 5KT2A 1QDSA 5C6MA 3GVGA 2J7HA 3GK0A 4ICMA 3PUOA 4Q32A 1CEOA 3IJ7A 3NM3A 2JF6A 1GOMA 4U2YA 2VC6A 3VD3A 4JYFA 4B15A 3WG6A 4Q45A 3ABOA 1X7IA 4NZ3A 3EBVA 4U3CA 1K1QA 4TV5A 3WF2A 1PL9A 3ZWSA 4RNJA 5HMFA 2V67A 1A5KC 3M5VA 4ZQOA 1WQ5A 4MUPA 2H9AA 1W9UA 1JF5A 3N04A 3PZQA 4C6IA 2YKKA 1R3RA 2G3MA 1IR1A 1H0GA 2CEQA 4WOQA 3NQAA 4EX4A 1FUYA 5LNUA 3GIQA 1CBGA 1ODZA 1DQXA 4U6PA 3G1VA 4OGZA 1JDDA 2CLIA 4AHQA 3NAVA 3WDQA 4PTXA 4ZQNA 2L5HA 4FI4A 3DUGA 1AQ0A 2D0FA 2Z25A 1RCOB 3WK3A 3S0CA 4N42A 3T2PA 1F73A 4HKPA 4AIOA 5KG6A 3W7NA 1BD0A 3RIKA 3TVAA 3H2MA 1Y5XA 2R6OA 3QFEA 4IRKA 2Y24A 3KX6A 2DPIA 1PHQA 3F2CA 3ZSTA 3WDPP 2JKPA 3M0ZA 1GVRA 4X0NA 4BR1A 4PB4A 3Q8SB 3VZZA 1WXJA 2DIEA 4NAFA 2V2DA 1V79A 3WUBA 3FFSA 1J9YA 1I2PA 3WLSA 1FHVA 4PR4A 3MFHA 3VD4A 3UY8A 3S3GA 2ACQA 2ZZ2A 4ED8A 1ITUA 5E70A 2V2CA 5F2GA 1BVWA 2ZDRA 3TYAA 2ZXQA 3H55A 1FQ0A 4GQ0A 3EOSA 1TPB1 3CQHA 3U5YA 4JYEA 1GVFA 4W93A 4LXFA 2E0PA 3BW2A 3ZVHB 5CSUA 1XXXA 2VFIA 3TTQA 1W32A 1IEQA 3MHUA 1M7XA 4V33A 3I6EA 3VE7A 4PCTA 2C0AA 1E9LA 2XGBA 5A6SA 4HTBA 3CK5A 2VCCA 5EU9A 5JVLA 1EJRC 3BVJA 4NZJA 4HU4A 3VNKA 2ZBTA 2WKJA 3IK4A 3LHTA 5KFSA 2ONEA 1CPUA 3I7SA 4MJZA 2W9BA 4D6FA 1KFJA 4O11A 1XLFA 5DMMA 4LF2A 5KFQA 1TPFA 5LXEA 3CV7A 3PBWA 1FWAC 4RNIA 3ATYA 3CMFA 4US6A 3CIXA 3IIZA 4I8YA 4NNAA 1S2VA 2OGJA 2D0HA 2R8WA 2Q09A 2QDGA 3G77A 5HXMA 1K9DA 3EA3A 2OVLA 4G1KA 4FNPA 3ONBA 2AKZA 4JCLA 1KGWA 2VRQA 2INZA 3N9KA 2EJ1A 3IUIA 3BJYA 1MDRA 1G4SA 5D4YA 5CGQA 2QMKA 4MVAA 3PTMA 1MNSA 4RXFA 4NIRA 2CKSA 3VFCA 4Y7EA 1QPKA 1TPUA 1JPIA 1FWCC 3VOIA 2NQLA 2P9BA 2PD5A 1K70A 1I9CB 4F48A 3KM8A 2OT0A 4GACA 4I90A 1TV5A 4PMYA 1E4MM 3GNXA 1R2TA 2Q8LA 1RP9A 3CV6A 4IQJA 1QBAA 4ZODA 1HN1A 3W7KA 2QAPA 3Q8RB 3M0VA 1N56A 4NJIA 4M6PA 5JIPA 1XYAA 2XFYA 4PUNA 3TAOA 4LS2A 3PN8A 3DC8A 5U4NA 3TCSA 3AYTA 3IK2A 2I16A 3HGSA 3PW2A 1N8FA 2J9ZA 2SFPA 2F6XA 2WCAA 2QUMA 1AFSA 2XIBA 1ZCOA 1GOWA 2V4QA 4GVGA 2UY2A 3A5VA 4JIQA 4IUGA 4HNVA 1N7KA 2F38A 5HAOA 1B3YA 5KZDA 3HQOA 4HN8A 2OZ3A 5EMLA 3NXFA 4FX6M 4AX7A 1P0NA 5L1IA 1LTDA 4YU1A 5G1MA 1IM4A 3WNNA 4TX9A 3VIOA 4WEVX 1JZ4A 4HJFA 1Q4WA 4TVCA 2G97A 1K77A 2GVLA 4JOMA 3FHQA 2FGZA 3UWZA 4DXKA 4Q8VA 3GNDA 4HSOA 3L0KA 1CLVA 4JL1A 4ILSA 5HUOA 1B31A 3CQKA 4J9JA 3GNOA 3LPGA 3B8UA 2FTYA 1HXJA 1EQCA 4N6EA 1DXIA 4CD4A 5I3FA 4G9PA 2NQJA 2ZRYA 5KINA 3MP4A 3W24A 4S3KA 3OGRA 1MQPA 1S9FA 2PRLA 1KKOA 3VD5A 2FHFA 3QYQA 4AEEA 4XZIA 3PPGA 3EKLA 4YVXA 4XKMA 3KRZA 1PKYA 3PFRA 6XIAA 3W1NA 4Q8EA 4PMJA 3ISIX 2OWCA 3W1MA 1Q6EA 4F79A 2QJHA 3V6JA 2HK1A 4M51A 2WSKA 1S0NA 3VD9A 5EY5A 4WSJA 2ZX7A 4GC4A 1W1VA 4JHZA 3IJIA 4DZHA 2CZVA 5E09A 1RBAA 3LZ5A 4IX2A 3TFXA 3W70A 5FF7A 5BRBA 2EG8A 2VD9A 2C16A 3IV3A 3DI1A 3SSJA 1KTNA 3SBFA 3DEQA 4IRDA 3VCNA 4RDWA 2CCRA 3W7IA 1V3HA 4PMQA 3UR8A 2PWDA 1EHAA 1G69A 1FP8A 2Q71A 2DUAA 1E5JA 4YTSA 1HJQA 2W91A 8RUCA 5HR7A 1XC6A 1VFFA 2FJKA 3RXZA 1TTIA 3W37A 3MCMA 3E0IA 2ZX8A 2OWXA 4G7FA 3DFQA 5KZ6A 4KFNA 5I07A 3W26A 5E5CA 4X9SA 2NV9A 2QVNA 3WD3A 5A94A 3AS0A 3BGGA 2NUYA 3KBWA 3QC3A 1YLVA 4EEYA 1H7PA 5DANA 5CCZA 4G3IA 5C7VA 1M7PA 5HQMA 4PMNA 1J0YA 3TTOA 3GO2A 3LA4A 1I6NA 1OC7A 4GIRA 2Y70A 1R5YA 1L2QA 4N02A 1FWFC 3N4FA 1OABA 4XUGA 2WLZA 1F6PA 3BSMA 2Z6IA 1HO4A 2WLYA 1H5VA 4W5ZA