1POJA

Isoaspartyl dipeptidase with bound inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
388
structure length
387
Chain Sequence
MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLTHIGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Isoaspartyl dipeptidase
publication title X-ray structure of isoaspartyl dipeptidase from E.coli: a dinuclear zinc peptidase evolved from amidohydrolases.
pubmed doi rcsb
total genus 116
structure length 387
sequence length 388
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1pojA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1pojA02
2BGNE 5HMFA 3GTIA 3URAA 2I9UA 3LNPA 3MTWA 4C6DA 1A4MA 4CNUA 3GU2A 1PB0A 2PLMA 2AQOA 4XAGA 4WHBA 4EPBC 3HTWA 3LGDA 4IFKA 4L6DA 1RA0A 4HK6A 1GKRA 4H9ZA 4GX9A 2HPMA 4GK8A 3URBA 3MSRA 4P5UA 3F4CA 3LA4A 5FSEC 4DZIA 4QS6A 3NEHA 5LXXA 2D2JA 4BY3A 3LSCA 2YB4A 3FDGA 1FWFC 4GY1A 4F0LA 3OVGA 2KAUC 2FVMA 4RE0A 1J79A 3SFWA 3ORWA 3RCMA 4C6NA 3TNBA 4KEUA 5HMEA 1P6BA 4EPEC 1K1DA 3PBMA 4CQCA 3B40A 4KERA 4H9YA 4C5ZA 1IE7C 4CNSA 3T1GA 4DO7A 4H00A 4R88A 1XWYA 2UBPC 3LY0A 3QY7A 4UBPC 4CEXC 4DYKA 4J35A 1WXZA 1EYWA 4ZSUA 4DZHA 4DLFA 3S4TA 1ADDA 1BF6A 2AQVA 1V4YA 3S2LA 1PTAA 2A3LA 3MJMA 3GIQA 3E2VA 4C6FA 4GOAA 4B91A 4G7EB 1FWDC 1ITUA 1RK6A 1YBQA 1KRCC 4GYFA 2DVTA 4LEFA 3NURA 4NI8A 4RDWA 2DVXA 3GRIA 2E1WA 3DUGA 1ONXA 1UMLA 1EJTC 3QGAC 4AC7C 1J6OA 1V51A 4LCSA 1S3TC 1M7JA 2Z29A 2OODA 4MUPA 3OOQA 4XD3A 4WGXA 1P6CA 1FWEC 1R9YA 5G4HC 3OU8A 3QGKC 3O0FA 2RAGA 4XAFA 4D8LA 1M65A 2R1LA 2P50A 3FDKA 3IACA 4QRNA 4B3ZA 4RDYA 1A5MC 2FFIA 4H9TA 4R7WA 4HJWA 4JOMA 2PAJA 2OOFA 2VC7A 3AU2A 1NDWA 3WYZA 4I6VA 3CAKA 1FWCC 4EPDC 4LH8A 4IF2A 4RDZA 3LSBA 4GC3A 3GU1A 5CH9A 3ID7A 1I0BA 2OB3A 3F4DA 1NFGA 3GGMA 3IPWA 1DPMA 3AU6A 4H9UA 3GTFA 4C6IA 1I0DA 3MDUA 2Z00A 4CEUC 1RJPA 4LANA 3MVTA 4DI8A 1E9ZB 2Z24A 3DCPA 4CQDA 1RJRA 4H9VA 3B0XA 1ITQA 4HA0A 3UBPC 4QS5A 2XIOA 2YXOA 3EGJA 1XRFA 1JGMA 3ISIX 3TN6A 3PNZA 2VR2A 3N2CA 3LGGA 4R85A 2OGJA 4ICMA 2R1PA 1RK5A 4PCPA 1XRTA 3BE7A 3UR5A 4C6KA 2IMRA 2WJEA 3K4WA 4C5YA 4C6PA 2G3FA 1FWBC 1O5RA 1PO9A 3OODA 2WJFA 1XGEA 1RAKA 4BKNA 4XD5A 3UF9A 3G77A 4YIWA 4GY0A 4LCRA 1KCXA 3T81A 3IJ6A 3NQBA 4NP7A 4ERGA 3QY6A 1V77A 3K2GA 4C6CA 2YB1A 2O4MA 2VC5A 3OJGA 1KRAC 3O7UA 1POKA 4C6OA 4OFCA 2P53A 3RN6A 3GIPA 4KESA 1E9YB 4ERAA 3FEQA 2I5GA 1QXLA 2ZC1A 4B92A 3AUOA 1EJSC 2R1NA 2CZVA 4IG2B 4IGMA 3URQA 2Z4GA 2EG6A 1K70A 3E38A 2PGFA 1V79A 1GKQA 2BB0A 2Q09A 2VM8A 2YZ5A 2Z25A 3CS2A 4C65A 1FKXA 3S2NA 4GXWA 3GTHA 4QSFA 4HK5A 4H01A 1WXYA 2Z2AA 2FTYA 4PCNA 1R9XA 4XD6A 4LFYA 1W1IE 1FWGC 1YRRA 1KRBC 4LAKA 1K6WA 3A4JA 2WJDA 2VHLA 3MPGA 4KEVA 4F0SA 3PNUA 2PUZA 3PANA 2ADAA 2AMXA 3V7PA 2D2HA 3S2JA 4H9XA 2Q01A 4J2MA 3HPAA 2GOKA 5A6TC 1EJUC 1J6PA 1NDYA 4DNMA 4KEZA 4LAMA 3IARA 4UB9A 2HBXA 2F6KA 1VFLA 4DLMA 4C6LA 3F2CA 1V7AA 4EPKA 4LAOA 1EJRC 4IH3A 1QW7A 1M68A 4XAZA 2QPXA 1YIXA 1O12A 3UR2A 5AKQA 4DIAA 4B90A 4GBDA 3PAOA 3S2MA 4IQJA 2DVUA 4KQNA 1HZYA 2GSEA 2R1KA 4PE8A 3KM8A 2FVKA 3MDWA 4H9MA 4WVXA 1NDVA 2FTWA 3LU2A 4C6JA 2E25A 3E3HA 4KF1A 4LCQA 2QT3A 1UIOA 1YNYA 3A3XA 1PSCA 4IFKB 2Z27A 3GG7A 3IV8A 4IFRA 4V1XA 1A5NC 4RZBA 2GWNA 4C6EA 4IGNA 3DC8A 4F0RA 3GU9A 3EWCA 3QY8A 4C60A 1EF2A 3F2BA 3D6NA 3JZEA 2Z26A 1FWHC 2OQLA 4CQBA 4E3TA 4J5NA 3LS9A 2W9MA 3E0LA 3EWDA 1GKPA 3RHGA 2Y1HA 2WM1A 2Z2BA 4I6KA 4GX8A 4V1YA 4G2DA 2VUNA 1UBPC 4Z42C 1FWJC 4QROA 4ERIA 3ITCA 3TN5A 3IRSA 4AQLA 1YMYA 4QTGA 2GWGA 3GTXA 3IGHX 1A4LA 2QVNA 1A5KC 2O4QA 1UIPA 3SO7A 2HBVA 1P1MA 3K5XA 1EJXC 3F2DA 3B0YA 1FWAC 2HPIA 4IG2A 4ZSTA 5FSDC 4IFOA 1EZ2A 2GZXA 3HM7A 4M51A 2HQAA 3GUWA 1YBQB 4EP8C 1ZZMA 4G7EA 4XD4A 4NG3A 4LALA 3OQEA 4C6QA 4PBEA 3TN3A 3RYSA 2R1MA 1FWIC 2P9BA 4HK7A 1A5OC 1POJA 1A5LC 1EJWC 3E74A 5E5CA 3ICJA 2UZ9A 3R0DA 5HMDA 4L9XA 4BJHA 3URNA 1NDZA 2D2GA 3WMLA 3WZ0E 2QS8A 1ONWA 3TN4A 1FKWA 4KIRA 4GZ7A 2PGRA 1J5SA 2Z7GA 3A3WA 1EJVC 4GY7A 4DI9A 3UPMA 4TQTA 4XAYA 2Z28A 1KRMA 3MKVA 1R9ZA 3MVIA 4KETA 3CJPA 4INFA 3T8LA 3E0FA 4C6BA 4RDVA 2EG8A 2ICSA 1RA5A 3C86A 2EG7A 4CNTA 2ANUA 2HNHA 4PBFA 4C6MA 1RJQA
chains in the Genus database with same CATH superfamily
3G6MA 1S10A 5LYRA 2G37A 5JH1A 3S1VA 4DWSD 1MUMA 1PB0A 2PLMA 1ISYA 3NQFA 1SZNA 3LHVA 3XIMA 1TQXA 2Q3RA 4EWND 1FX6A 2PZ0A 2P3EA 2I7GA 1W17A 4GX9A 1BEUA 3W00A 4DM1A 3CB8A 2V4RA 5I00A 5HINA 4KFNA 1T96A 1RLCL 4W84A 3U8GA 1KFCA 2D2JA 3KL0A 4AYGA 1AG1O 4ZO8A 3PPCA 3CUIA 2HNEA 3QM3A 4GD0A 3O15A 3GXTA 8RUCA 3SFWA 3GNNA 2VOTA 4O1DA 5KFMA 1VYPX 4LB4A 1X6LA 2GGIA 3PWIA 5KG0A 4H00A 3SIZA 3TKFA 3MWAA 2Y7DA 4L4MA 5BXPA 5D9NA 2W9AA 1Q4NX 3KRZA 4HU0A 5D2VA 5KFXA 2BVWA 2OZTA 4FXRA 3TCEA 3PB2A 4LEFA 2EGZA 4GQBA 4H04A 4QDPA 4Y9NA 3THCA 4A6GA 1JD7A 4P2VA 3AWOA 1ONXA 4X2RA 1E1CB 1JPDX 2JALA 1V51A 2H8ZA 4XSLA 4QWCA 1F07A 1D3HA 1V08A 3QGKC 3O0FA 1DXIA 3KRUA 2E1DA 4NJGA 2BY0A 3IACA 3F4WA 4LAUA 3T55A 3B97A 4R7WA 4BI7A 4WOQA 2UY3A 3CL8A 3CAKA 3H4XA 4LWWA 3TMLA 3W9ZA 3C8FA 3ES8A 4CNNA 3CHFA 3C0LA 3FJNA 4P61A 3WQGA 2QVHA 3IUHA 2XINA 4GRSA 3WSUA 5M5DA 2DJLA 3CASA 4CD8A 4NJKA 2YDAA 4FEZA 4JIHA 1XRFA 2R82A 1VFFA 3T5LA 4RUAA 3WD4A 2FDSA 1OX5A 3UXIA 2R1PA 3UR5A 3UZ5A 1OCQA 4C6KA 4KWUA 4IMFA 4AZBA 3EB4A 5F2LA 1N2VA 3VIPA 1CLKA 1M53A 2RDTA 2YBTA 3HQPA 3TEVA 1IV8A 3RAXA 4NP7A 3IJ6A 4GABA 1GZGA 3CV6A 3BLKA 1L6SA 2A7PA 3FSTA 4W86A 2VEKA 3OJGA 3CHCA 2VDHA 4EYHB 3LLFA 3EXRA 1E5NA 1HF6A 1UD3A 5CPMA 3FAWA 1FH9A 3T44A 2BWGA 3TJIA 2WHKA 3URQA 5GNXA 4NZ5A 3ABSA 3ARRA 1GKQA 3WN6A 2Q09A 3VILA 1SMAA 1KC7A 4L4PA 3UJFA 3RR1A 4C65A 2QJMA 2J8GA 4QSFA 3RM4A 3MS8A 3ZWTA 3UWUA 1R3WA 3ITVA 5KZDA 1HX0A 3IGUA 3TJXA 3U2EA 2NT1A 2OG9A 2CLIA 1EC9A 2VQUA 3MPGA 1TE1A 4EANA 3STCA 2QCCA 4F0SA 1DWGM 4MJ2A 2D2HA 1DQWA 1KFJA 2GOKA 2QAPA 3R7MA 5KT2A 3E0IA 4J3VA 2NVCA 2BVYA 1R2SA 2OYMA 3NIYA 1LORA 4GVIA 1EJRC 4LQ1A 1OC7A 3VINA 2J47A 5I77A 1H62A 1J0YA 3B06A 4JHMA 4B90A 3WLOA 3LXBA 4UFJA 5M1TA 2IQDA 1LDCA 2NVDA 3TYBA 2CLLA 2TMDA 4Z17A 2ATSA 3W7KA 2RGMA 3OGSA 3S5ZA 1EEXA 3AXKA 2W79A 5CPNA 3ANVA 1OINA 3VNIA 4LU0A 4LS1A 3GG7A 3BQ0A 3IJLA 3O1NA 2FIQA 3MZNA 5L9XA 3EPGA 3BICA 4FX8A 1Y5XA 1EQCA 5IFPA 3TOYA 2OO6A 3U48A 3GE7A 3UJ2A 2FJUB 4G1NA 1PWLA 4F79A 4J3XA 5CGTA 2Y5SA 4OHQA 1GZJA 4CLMA 4RNJA 5FF7A 2AU0A 2AQWA 2PTWA 4IX0A 4AWSA 1O7AA 3GV5B 2BQUA 8A3HA 3WJYA 5EMMA 1JDAA 3BWWA 4HOZA 3SO7A 3M0KA 3CAWA 2NWRA 1GK8A 2PF8A 4NKCA 3GZAA 2X7VA 3ITOA 4QW8A 1B9BA 5K7JA 3ME3A 4PUJA 4MY9A 4UTWA 4X9SA 1RHCA 4Q8OA 4ZGYA 1W9VA 1XRSA 3WY1A 3R4IA 5KG5A 3MMWA 1PJ9A 3NPWA 3OQEA 3ZVHA 5I02A 2XN2A 3AIEA 3CEPA 3TSBA 1US0A 5IHSA 3KZSA 2YOCA 4MUZA 2Z0IA 4ECVA 3LMZA 4UQBA 2W92A 3BGGA 3PZMA 3TV8A 1JZ4A 4BJHA 1E51A 4ZBCA 4GNJA 2PU1A 4HOXA 3PSVA 4IXXA 4HGXA 1WUEA 3WBWA 4YR3A 3II1A 4TQTA 4QDWA 5C71A 2A7RA 2O9RA 4PUDA 2DEPA 3UVIA 4E5TA 1C92A 3NDOA 3CJPA 5CPQA 1TPH1 3K1GA 2V4QA 1DWJM 3UWVA 1FHVA 3PW0A 1KXVA 3GFZA 1RYRA 1VFUA 2HNHA 2YYTA 3K1DA 1T5AA 2E3ZA 1MXSA 4F9JA 1HUVA 4OBTA 1ITCA 4UTTA 3K13A 1BWVA 3RR4A 1RCXB 4AD2A 3HTWA 2HMCA 3NOEA 4LW7A 3GXMA 4KFPA 4ED0A 3EB2A 2BQ3A 2NXIA 4ZOCA 1Z69A 2DZPA 4MNMA 5DXYA 1NSJA 1BG9A 4YPJA 2CYGA 2GJXB 5B7YA 5XIAA 2A1YA 8CGTA 2XGPA 4U3AA 1I8JA 4W8AA 1RQBA 2PP3A 2VZSA 4AWTA 1XF0A 1NFPA 2JEJA 3N29A 3AROA 4PUWA 3V6HA 1EDTA 4LVBA 1XIMA 1KA9F 3IN5A 2QMKA 4F0LA 3EPIA 1P7TA 4DBEA 1P6BA 4KERA 3NXLA 3PZNA 3K8KA 4JTRA 3XISA 3CUHA 1N8WA 1BHGA 1VYRA 2CLPA 2G96A 4UTJA 1UB3A 2RGLA 3LCXA 4PL2A 4IRDA 4PRRA 1XFCA 3R10A 1YLVA 3UQNA 4JQ2A 3M5VA 4ORIA 1VR6A 3C0SA 3NQEA 3B8UA 1RK6A 1J96A 4EYIB 5K4ZA 3LCHA 3BV4A 5A94A 3DUGA 2W67A 1W32A 1XP3A 3SY5A 5EY5A 2QV4A 2H90A 2Y8KA 2WZEA 3LM7A 4ICCX 1N8FA 1UPMB 2OODA 3WBYA 2HVNA 4WGXA 1YNQA 4MADA 1FWEC 3T0TA 5K9CA 2OZ8A 2R1LA 2QZRA 3VTRA 1IWPA 2CXEA 3AHYA 4XAPA 3AU2A 2BOGX 3GNRA 4C7DA 1U33A 2OSXA 3H22A 5GNYA 5M3WA 1OGBA 1K8CA 5KFFA 3ZQ9A 3AU6A 4H9UA 5EMLA 2E5CA 3R89A 3S1GA 4QXIA 1Y5WA 3HQ1A 1EOKA 2EKCA 4GIRA 2P8BA 4AD5A 1JGMA 3KHLA 1OX4B 5HBFA 1KM0A 1EX1A 2O92A 3BE7A 3W37A 2H9AA 4J9MA 4NJIA 3TTYA 2WZIA 4O50A 3T8QA 1O5RA 2PDWA 2XTKA 4DEFA 4QG6A 3NQBA 2VZTA 4ERGA 4KRZA 3R58A 4GZEA 1ISZA 4JFSA 1XDJA 3WQPA 1KRAC 4C6OA 4AUBA 1XPGA 3VOCA 4LY8A 1GEHA 3B9AA 2I5GA 3NR0A 1ONRA 3R8RA 4B92A 4R7OA 1X6NA 1IZKA 3KX6A 4LC6A 1XH1A 2CZVA 3Q8SB 1IIGA 1O6IA 1RVGA 5KG2A 3NXFA 2C3ZA 3M16A 3RLUA 1YTEA 1IXPA 2A3AA 1BXNA 3GKAA 1NP0A 1Q6LA 4D8ZA 3UY7A 3W02A 1WAWA 1H7RA 3G22A 1GVSA 4JFUA 1QBAA 1D2KA 3V36A 2RH9A 1VCVA 1XIEA 3O0KA 3LTYA 3KEHA 2YX0A 4L64A 1RV8A 4MKNA 3TOPA 4GGHA 4GISA 5AC4A 4TX8A 5AN7A 1E71M 1QNVA 4NX0A 4UZUA 3ARPA 1UKPA 3SEPA 4A4AA 1OFEA 4IQLA 1EP3A 1V7AA 3KTCA 4HTBA 4ZO6A 3ABZA 1UP3A 1QW7A 5ABHA 3CQHA 3EA3A 4H3DA 4ACZA 1REQB 1XGDA 1W91A 3PZ9A 2VVNA 1ZPTA 1FCVA 1S2TA 1WOAA 3CIXA 5BRBA 1DP0A 4ECSA 4S3KA 1IT8A 1TZ9A 1JZ6A 3IV8A 2OSWA 3SCQA 1N82A 4PMDA 4C6EA 2R6OA 1VBGA 1H2JA 3RX4A 4FX6M 1TELA 5JVLA 4QNWA 2PCQA 1GW1A 4LYPA 5KFVA 4ONVA 1JCJA 4OJYA 5AVNA 4XWUA 1DYSA 1ZJHA 4QCFA 3NGJA 3RGTA 4G8TA 3WBAA 1VPXA 1EH9A 3LPGA 1HQTA 4JTKA 3AHVA 4HB7A 4JEQA 2OMAA 2NWSA 4FI4A 1TPUA 1BF2A 1A5KC 5B80A 4JIRA 3MUIA 1EF3A 3CB3A 3MQTA 4I90A 2WSPA 4MAZA 3G1HA 4F4XA 3R13A 2V5JA 2G5WA 5DRIA 5JU6A 2HPIA 3SJ3A 3MHUA 4XO6A 4IIDA 2HQAA 4FALA 1GOKA 5DMLA 2DSUA 4PTMA 3L23A 3ZZ1A 4Q4MA 2ZCGA 4Y6GA 3VOFA 3LN3A 4XK2A 2V81A 4L61A 3WNLA 3HFTA 3GXNA 1C7SA 5L1JA 3GLCA 2VX5A 3NUKA 2J6UA 3OIHA 3DG6A 4YMZA 3WMLA 5BU9A 4RE2A 3CGTA 2R8JA 3LV6A 5LIUX 2GUYA 1B3YA 3PP7A 1EJVC 1GVOA 5FJOA 1E1FA 3KE0A 5DQHA 3WLNA 2ASJA 5EDWA 4I5XA 2DT0A 1TRIA 4L6OA 4LUSB 3TXVA 3G1RA 1RCQA 4AHPA 3BOXA 2W5FA 3GH5A 4JS3A 1QMLA 1CX9A 2ICSA 1FWTA 3W7NA 3W73A 3VIKA 4RZRA 4F4YA 4EXQA 3MBFA 1HKIA 3MR5A 3UEQA 3MHGA 4CNUA 5H8PA 3B8DA 2VMFA 5KEZA 5TF0A 4H8UA 3V4BA 4JDBA 2O9PA 3G1SA 1XYMA 2OPJA 3VX1A 4O28A 2QCNA 2UVRA 1NF0A 4RK8A 2YDSA 1OABA 5H8MA 3AI0A 2B31A 4S38A 2JQXA 4UOZA 1OT1A 3NL5A 2OLHA 1AZ2A 2VNCA 1EQPA 1RUSA 3U9IA 4DJDC 3QFWA 4EWJA 4LBRA 1W3NA 4E8CA 4QE4A 3TWBA 4MAVA 4I3GA 4QS6A 1K9EA 1PHQA 4LUJA 1J0IA 2YB4A 1VHCA 4IIBA 2NLIA 4GY1A 3E2RA 3J7HA 3MUCA 5BW6A 1R38A 4ZOEA 4RE0A 1YE6A 1QHOA 5DXXA 1YE4A 1SW3A 4YHGA 3S6DA 1F3TA 4C5ZA 1XD0A 4DO7A 4B5SA 4R88A 4NYYA 5E0KA 1AW5A 5A8GA 3UA3A 1XI3A 2QUTA 3Q4DA 3QMTA 1QASA 2YFOA 3W82A 4MWAB 4IMAA 3N11A 2W8KA 2OKOA 4ADUA 3G0UA 1ECEA 1ADSA 2DZWA 3SCWA 1WO2A 3B05A 4A3YA 3IAPA 1FWDC 2J9YA 5A3HA 1YBQA 1UR0A 3ARYA 3T5HA 2DVTA 4OQVA 5FJJA 1E43A 1UUQA 1F73A 1CZ1A 1XG4A 3Q8PB 5FJPA 4ZQCA 5EYWA 2FHFA 4ZR8A 5CC3A 4PSRA 4PR4A 1M7JA 5J8LA 1JCTA 3W1TA 3RAOA 3W74A 3G5EA 5DLFA 1G9HA 3QSTA 4D8LA 3MMTA 4D9PA 1EA9C 3KLKA 2QCDB 3L5AA 2QYGA 2W8LA 3WUGA 4S39A 1WBHA 4UR7A 4KCTA 2VC7A 4OT7A 1NDWA 1JJKA 1A5CA 2C0HA 4LH8A 4RDZA 3ABXA 1G6CA 2OB3A 3ID7A 1ZL1A 2Y7EA 3SUVA 1ZJAA 4NRSA 2J25A 3FX4A 2F9RA 1I2OA 2Q8LA 1QW8A 2PRHA 2RJHA 3O6AA 9XIMA 2BY3A 2ZXAA 3TZNA 5DCDA 4Z0SA 2JEPA 5A95A 1YTDA 2P76A 5DANA 1E4LA 1GGOA 3LMYA 4N4QA 2C1IA 2DU2A 3OZYA 4MY1A 4IT1A 2CBVA 2ABBA 1YW1A 3M0YA 4QHRA 3BMXA 3K4WA 4TVCA 4O18A 3F5KA 4PMOA 3QZ6A 3W2UA 4L9YA 1KM6A 4H2HA 1F3XA 3LRKA 3Q94A 2BSLA 4H6EA 4U6PA 2WQPA 4N42A 4AZCA 5HPCA 1LUCB 3LHYA 1HNYA 2P0IA 7ENLA 3Q8QB 3LQLA 3LOTA 4XB3A 2OFJA 4MJMA 4GA8A 2VEIA 3LPFA 4US5A 4M19A 4K38A 2YL8A 2XSBA 4QWDA 1OF8A 1U1UA 4HKPA 2R1NA 1Y8BA 2J13A 3BW3A 4IG2B 3C56A 5FJRA 3HG5A 1FHDA 5HQMA 3P7YA 2X41A 1V79A 2OZ0A 2A3BA 3KFTA 3QR0A 3OA5A 2Z25A 3FA5A 2WJZA 5DMNA 2YSWA 4EAYA 4LBSA 2CKSA 1TA3B 2OWCA 3U4AA 1UWSA 3BQ1A 3W2NA 1LP6A 5FI8A 3I6EA 1QOXA 3WK2A 3VNJA 4DWSB 2IBKA 1S2CA 2X0YA 1WOBA 4DQWA 1L6WA 1OHLA 2A2IA 3BJYA 4UTHA 1DE5A 3DH7A 4W88A 3V75A 2DIJA 4K1WA 1VD6A 2QJGA 4MTVA 5KINA 1OY0A 3W6YA 2PWDA 5D32A 1GVRA 3JS3A 2PA6A 4UMAA 1KO0A 3KAOA 4XZWA 3SBFA 1KM1A 4RUCA 2GYIA 2CZ5A 1XIIA 3A6OA 1QHZA 3MI3A 1NY1A 3W87A 4C6JA 1LZOA 2Q71A 3BZJA 4KEMA 3KVJA 1AMYA 2PLJA 1R3RA 3TSMA 1W0MA 4ADSA 4EF8A 2PODA 2CLKA 5A1AA 3FYPA 2Z27A 4EBDA 1A5NC 2GWNA 4OTKA 3CUZA 1P0KA 2DW7A 3MUY1 5D05A 4F0MA 3M0IA 4NLGA 1D7KA 3RO8A 1FCUA 1DE6A 1FWHC 3T5KA 1T99A 3W88A 2OQLA 1QCWA 2X1IA 4K36A 4OU1A 4X63A 3RMEA 2PWUA 2UVVA 4NZFA 3NQ8A 4NAEA 1XDMA 1GVEA 3WO8A 5HOSA 2WM1A 1F2JA 3LQGA 2MNRA 4J9NA 3H7UA 4E2VA 4NI3A 5JBDA 4G2DA 3VNKA 4OV4A 2WZTA 3EB3A 2I5QA 1O1ZA 2GWGA 1A5SA 7REQA 2X7WA 1YDVA 4WKFA 5IFTA 3CL7A 3GZ3A 3TTEA 3UVAA 5KT6A 3EDKA 3FVMA 5FJIA 3TONA 2VCAA 4RW3A 1KFEA 4XZHA 1BXBA 4H7ZA 2ACUA 1AQMA 1MEHA 4REQA 4X0NA 4XQ6A 5L1IA 4Q7BA 4GXMA 3W22A 1IQ8A 2RHGA 3VE7A 3W71A 2POZA 2ASHA 4RE4A 1P0EA 7XIMA 1MXDA 3NSMA 1L6GA 3LXAA 4MIMA 3OVRA 3WBEA 2HTMA 3DIPA 5E5CA 5E0FA 4UTKA 4GQGA 1JCNA 2ZUMA 4U2ZA 1CXHA 3UXLA 2Y5EA 2HWGA 1KXQA 1XV8A 4UTMA 4KMQA 2NZLA 4PMXA 4DL4A 1J5SA 1HKJA 1VH7A 3KP0A 1ZRQA 1HJSA 4CQ9A 4DI9A 4WY0B 3AMLA 3P60A 2Z28A 2INZA 5KZMA 5L1KA 2PGWA 4GWEA 4BEQA 5L1LA 2QUUA 4UNIA 1P6WA 2VFIA 3AC0A 4S3FA 3RM9A 4AD4A 1GPFA 4V27A 1RA5A 4R9OA 1A5BA 4XVEA 2Q3OA 4S3DA 4C6MA 1K9TA 4IIHA 1BAGA 3UD6A 3RU8X 3LBOA 2XIIA 3VE9A 2UV8G 1AW2A 5AZ1A 4HCLA 1QWGA 2OH2A 1I6NA 4N9BA 3VIOA 3M41A 1CB2A 3BAJA 4HU3A 2VZOA 4U28A 5A8MA 4N4PA 3W29A 1GJWA 4GK8A 4C90A 1IXQA 5JBEA 1QPOA 1XM3A 2QIIA 1RR2A 1LCOA 4K39A 1LG1A 3L4WA 1J79A 1KQZA 5CPTA 5DBUA 5CLTA 4EPEC 4QWEA 1IYXA 1E3ZA 5IBXC 2GDQA 4XV0A 3H12A 5BRPA 4JIPA 2PDKA 3QY7A 2BMBA 3EOUA 2EPNA 4S3AA 1G4EA 1IEVA 3SURA 4RZ5A 4MJZA 4C1NA 2AQVA 4R27A 3SB0A 4E2DA 5KT7A 1SFTA 3UP8A 4C1KA 3WJSA 4B91A 4DJDA 4N9CA 1TWDA 3KLLA 3I6RA 5HANA 5CBBA 2BP1A 3S83A 1F9CA 3WENA 2XGIA 5D8WA 4HNOA 4NI8A 3PG8A 3IUIA 1XIFA 1EJTC 3EX4A 2IPGA 3QV9A 2KZHA 3NM3A 3B0UX 5C5JA 3STFA 2DUZA 4Y90A 4R53A 5I79A 4DJED 5CEWA 1BVNP 1P6CA 3OLEA 1TTJA 3W1NA 5FEZA 3WD1A 5CKSA 3SN1A 4Z2KA 1C8XA 4RDYA 1YNPA 1UPPA 2ZZ5A 2NUYA 3FY1A 4JOMA 2C2RA 1NVMA 3M46A 3QPEA 2XWDA 4CU8A 5AFDA 3S1UA 4PB5A 3S6TA 3UG5A 3GGMA 3GNXA 3W7OA 1JIHA 4JDYA 4ED8A 4AMAA 3RMJA 4C6IA 1O60A 4ZFCA 4M6UA 2UWFA 2YL6A 5JBFA 4PRWA 4ZE4A 3BAXA 3DHFA 2QCHA 4HNNA 4NXSA 3UBPC 1BKHA 4HQVA 3EGJA 2VR2A 5D02A 1DTUA 6CGTA 3PR4A 4D8AA 1X38A 2WNNA 3NOYA 1HGYA 1P48A 4KS0A 4HA4A 3U7BA 5H6HA 3L4UA 4B2DD 5T8GA 4C6PA 2G3FA 1JXJA 2GDVA 4KWOA 5REQB 1TREA 3WH8A 2JEQA 3ARUA 2A3HA 2CHNA 2FVLA 3G6YA 3TTOA 3GILA 5CAKA 1R2RA 9RUBA 2HXUA 4LF2A 4A8NA 3EDDA 1P4CA 3CEUA 3ANYA 5E6ZA 3SCPA 3G2GA 4OVXA 1KWKA 3NL6A 1XG3A 1KGXA 1XKJA 3L65A 2ZKMX 1YQ2A 1TX0A 2BB0A 3QHOA 2NUWA 4ORMA 4OBSA 3A22A 3EWWA 1T0OA 4HK5A 3IVUA 1PKYA 1PDYA 1JYNA 3IIPA 1JQXA 4KWVA 3P0XA 3XINA 1ZCCA 1Q2RA 2OYLA 1H0GA 2WJDA 2J4GA 4IIGA 1EDGA 3PHAA 2Y4SA 2Y6ZA 4RNIA 1CGUA 1EXPA 1NDYA 2POTA 1LRQA 2F6KA 4UQCA 1F5ZA 1YEYA 3DFNA 5TNVA 1B1YA 5MKGA 1GQKA 1JCYA 3EAUA 3T0BA 5IDIA 1US2A 4AHOA 1S38A 3C5QA 1UD5A 3M47A 3KP1A 2PWHA 5KFUA 3W01A 3V35A 2FTWA 3VZYA 1UMYA 2JKAA 4J28A 1GUVA 2QT3A 2VVSA 1W5MA 3LHWA 1PSCA 1V93A 4IFKB 1GVIA 1Q45A 3N2BA 2F84A 2VEFA 2QDGA 1MQQA 2BR0A 1X1ZA 3MFHA 3P82A 3BQ6A 1TJPA 3MYPA 2V2DA 3BCDA 3ITTA 4AD1A 3QHMA 2CLEA 3PZVA 1LOLA 2PD5A 3DKJA 3OHAA 3E2SA 4ATDA 1DJHA 2H6RA 2XPKA 2VUNA 3W23A 3FXYA 4FS1A 4YNGA 1QI5A 2ZBTA 3IVSA 3VKDA 3T0CA 3KHJA 2QVNA 5BWAA 1HP4A 2UY4A 4LC8A 4AIUA 4MWAE 3ZFHA 4LS0A 1KV5A 1P1MA 1EGMA 4G9PA 4WSHA 2BVTA 5DEZA 4GC7A 4L1WA 1M7XA 5I3JA 4NAFB 3MV01 2BXZA 1O4UA 3TJ4A 1HTIA 2INEA 3PTDA 1DXFA 2FGZA 4GQRA 4EP8C 1NWTA 1B2YA 1FWWA 3TU9A 2WMHA 5PTDA 4O4VA 2BGSA 3FGCA 4QLJA 4RZ6A 4GIYA 4IRKA 5DGAA 3FN9A 3P62A 1JUBA 3I3DA 3E74A 1FFQA 1F61A 1P43A 3DZ1A 4MB3A 4PTVA 4D6IA 2C2DA 4Q4KA 3WIJA 2XVNA 2UZ9A 1IF2A 4AC1X 4L9XA 4W8LA 5AHFA 4EEYA 3WZ0E 2X1RA 2TODA 1ONWA 1RYSA 2CHRA 3CPRA 2VEGA 3LUTA 1B5TA 3GDMA 3UPMA 2Z1SA 4JTLA 2WKGA 4TOQA 3ATYA 4AEOA 1GHRA 2O0TA 5F4XA 3CL6A 2JE8A 2WAGA 7PTDA 3R2GA 4OECA 1AH3A 4PBFA 1E0UA 1A80A 1IEQA 2REQB 4M8UA 1TB3A 3KS6A 4QFUA 1WKYA 3NJ3A 3PZIA 3KBJA 1NWUA 1H7WA 2YFNA 4ATLA 3CAQA 2AQOA 3G1DA 1KKOA 4QIUA 4TV6A 5K2ZA 4DPQA 4MYXA 4ROQA 4F3HA 1MQPA 5KFOA 1EBHA 1V3JA 2C15A 4PFMA 1AFSA 1J5TA 2XFFA 2J88A 4P5UA 4DPPA 1OFRA 1XBYA 4GKTA 3N04A 1VB9A 4F8XA 3IIVA 3HV8A 3THUA 1R3VA 3PJUA 3WQFA 3PVFA 1EL3A 4PBGA 3DYOA 4CQCA 3E2QA 3PPFA 1G67A 4PZVA 4CNOA 2PP1A 3LB0A 5HR6A 4L4OA 1QPKA 3C2OA 2JKPA 1KBJA 4UBPC 5CG0A 4Y9PA 4GLEA 3SIMA 4CN4A 3S5NA 4JXCA 1PXGA 4TMBA 5D30A 2BS9A 1DEDA 4PTDA 1UOKA 2IKGA 1XICA 4Z1DA 4M6VA 1MEIA 4H6QA 2R8HA 3MCOA 3NQMA 2XHYA 4FNSA 1LJYA 3KZPA 4HP5A 2J24A 4H83A 3GRIA 2E1WA 2YL5A 4AC7C 1OQFA 3GTNA 2JF6A 3L67A 1TR9A 4IGSA 3VDHA 5IBXA 1W3LA 3K30A 2J7BA 3MO4A 1EDQA 4IM4A 1E55A 3EXTA 1P0NA 1AH0A 3WLMA 2P50A 1VENA 2PDLA 3W84A 3SI8A 3RB6A 3SRKA 3COTA 3UCDA 3RO6A 3KHHA 5BXTA 3PB0A 5JIPA 2ZA2A 2GDUA 1TMHA 3PPHA 2NSOA 3F4DA 1TV7A 3QZAA 5F1VA 3IPWA 1DPMA 2P0OA 4I5UA 1H1YA 2XM1A 4FNTA 3BLFA 3GHRA 2QJIA 2Z24A 4X60A 1IEIA 4X3ZA 4HA0A 2C22A 1A0CA 3ARVA 3WUBA 1JAKA 4IXHA 3TN6A 1ZU8A 3W86A 4R85A 4ICMA 5AC5A 1PUDA 4ZTXA 1N7KA 3DFPA 4J3SA 3QJAA 4PTWA 5ABFB 4K37A 1W5PA 1DQXA 3AOFA 2D22A 3AMGA 3LZ5A 4AZ5A 3EXSA 1RAKA 2QF7A 1FP8A 4JX6A 5HNRA 4MY8A 2JGYA 2XH4A 1E6QM 2XFWA 1FOBA 3E0VA 1E15A 3B8IA 4Q4PA 4R8UB 4OFCA 3BW2A 4JFTA 2P53A 3T0AA 3GIPA 4GFSA 2E09A 4Q8PA 4IJRA 3BSGA 1FWSA 3MO7A 4NRRA 2PC4A 2AL2A 1MO0A 4HHPA 1W9UA 1TJ2A 5DCBA 1JDFA 4P7OA 2GLKA 1AQHA 2A5HA 1E0TA 5AB3A 2ZE3A 1VPYA 3H55A 4GINA 5AOUA 3ZS4A 3GTHA 1KLYA 1SPQA 4EACA 4O3PA 1H49A 3DFYA 1VBJA 1G4SA 1UKTA 1ME8A 4XZNX 3B04A 3N12A 1FQ0A 3N18A 2V0TA 1NOUA 3NZGA 4ECTA 4H8NA 5BWFA 2GGEA 4O52A 3H2FA 1K6WA 2BBFA 3WLSA 3BCFA 4I7VA 3TROA 4U10A 4XZBA 3G6VA 1GWJA 2VEMA 3BLIA 3TMQA 4GPNA 1J6PA 1FY6A 2G4FA 2HEJA 4NZJA 2ZOXA 4UR9A 1V5XA 3GHUA 1IEWA 2OEMA 4KBXA 5KFJA 1I1XA 5DG7A 4BR1A 3MANA 4LRTA 4CCDA 4YR0A 4LUTB 1Q13A 4DM2A 5G4WA 3QPYA 1Q6DA 1W1PA 3ZJ8A 5HJLA 1W6TA 3W1UA 2V68A 1G4PA 4GZJA 1JPHA 4NSBA 1K1QA 1JZ5A 1SMDA 4LCQA 1NAL1 1JCLA 4B5NA 3GIIA 2J7EA 2OX4A 3PM6A 3ERPA 3U2CA 1AJ2A 3EMCA 5C70A 3FHQA 5KFHA 3WKZA 2ZYFA 1PCWA 3RITA 5A2CA 3PUOA 3HMCA 1PIIA 1MUWA 1TSIA 3U2OA 1XQLA 5D8ZA 1L2QA 2EEXA 1ZB5A 4AB4A 3M9OB 2PDPA 3OYZA 5CZSA 3E0LA 4EAMA 1M9HA 3OB8A 2YXXA 4LY4A 5MHBA 2F61A 4FX7A 3SCRA 3R12A 4ERIA 2XSXA 3L4YA 2H8XA 5HPOA 3M6DA 3T6CA 4J27A 4AQLA 4YN5A 3IEBA 2XGBA 1A4LA 4YU1A 4HZ6A 1Z89A 3DGRA 1GYMA 1LQ2A 4GQ0A 4GVFA 4S3BA 4AY7A 1TPDA 1Z7AA 3A47A 3MC5A 2J8FA 1O5QA 4UMBA 3VGBA 2XVKA 4QX4A 3M64A 1YADA 1QUMA 3V5FA 5C6MA 3NM1A 2BHUA 4FS2A 4DJFC 3WF3A 5C7HA 1JI1A 4O54A 4JQAA 3TN3A 1K4HA 4Y9AA 3TXZA 4MFEA 2AAMA 2DIEA 1EGVA 4HK7A 3MFIA 5KFBA 5FD0A 4JFWA 4RNFA 4JY8A 3PF3A 4WJXA 1M41A 4HNLA 5FIPA 2XC9A 1I45A 1JZ7A 4AEFA 1UZ1A 4KIRA 1ZCOA 3DHDA 4XVDA 4H6KA 6REQB 4BS0A 1JZ8A 3GV7B 2QMJA 3N15A 2P10A 4O1AA 4ZMGA 2CNCA 1CGYA 1R30A 3VDGA 2YLAA 3VU2A 1BRLA 4O0KA 5DY2A 1XR2A 5A6JA 3V6KA 2ZRVA 3BLDA 3S0CA 1IZCA 1LF1A 4KCUA 2YCLA 2J77A 3UY8A 1KCLA 2P88A 1SJBA 2CC0A 3EA1A 3WQDA 4IZGA 2ALZA 1I9CB 2VRQA 1V6XA 4HK6A 4E3VA 1SU5A 2XISA 3M0XA 4HZ8A 2MUCA 4GUHA 1RBLA 5FSEC 3KWSA 4QG8A 3KVMA 3WMBA 1GNXA 1JF6A 4GACA 1CGVA 4ZTYA 5F7UA 5LGZA 2VCBA 1R7AA 1VEMA 2ZC8A 4JYDA 4PMRA 3GVQA 3K8LA 3OVGA 1T94A 4C6NA 1WQ5A 3PBMA 3MA8A 4CNSA 1DHPA 4BEUA 1XWYA 1UHVA 1UC5A 2G0WA 5ABEA 3W26A 2G3MA 3PW5A 1GCYA 2CLFA 4Q33A 1SR0A 4QGCA 3S9ZA 3S4TA 3T2OA 3DFTA 3D5HA 4AX6A 4DL7A 3LXCA 2A3LA 4WXYA 4C6FA 4HNTA 4JYEA 2DH2A 2DZXA 3AAMA 3FJLA 4MVAA 4QAIA 1KTBA 3MHFA 4ZOAA 5F9LA 2ABAA 3EKZA 4NJHA 4DXKA 1GOQA 2DP3A 4LS2A 2OWXA 4P7LA 3T9PA 1FH7A 1LTDA 3FDKA 2A3CA 5A8OA 1DORA 2X8RA 4AW7A 3K4DA 3NNTA 4ZXOA 4IRCA 3GNDA 3WJXA 1NFGA 3UWQA 3EX2A 4QLLA 1C90A 2C28A 2XH7A 3V1PA 4JTTA 3GTFA 5EPDA 3L66A 3MUZ1 3P14A 3TLLA 4PMUA 4HNVA 4DI8A 4A3RA 1JFXA 4CUCA 4ZO7A 3VIJA 1ITQA 2FH6A 4YWSA 4UC5A 1DL3A 3DX5A 4P8VA 4JTSA 3W70A 3PS7A 1EHAA 3N2CA 2OSYA 5KFSA 3O3RA 4V28A 3BJSA 3ELFA 3GQYA 2O9TA 2GL5A 4IWWA 3SQLA 3N19B 1QPRA 4D2JA 1A3HA 2PWEA 3OODA 1XISA 5FL0A 1CYGA 1IXOA 3EPMA 5D2TA 5KFTA 3NGFA 1U83A 2PMQA 1J11A 2J79A 2YB1A 4DJFD 1J12A 3R5EA 2ZX9A 3BW4A 4JNMA 1O68A 4QDMA 3QV7A 1KW1A 1J0ZA 5HNUA 4WRHA 1E6ZA 3KCOA 4Q8UA 5KSWA 3S5YA 2ZRUA 1NEYA 3CBWA 4MKVA 4U33A 3R25A 2PGFA 1V03A 3R8GA 1M1BA 4AHQA 1TPB1 1UG6A 3RCYA 2E7FA 3W7JA 5H8UA 3ZM8A 3VDBA 3ZVHB 5DMYA 4LXFA 4ECYA 4H01A 3DDMA 3QMRA 4PCNA 3M6YA 3W7EA 2J8TA 3W7HA 2GSJA 5E6YA 1LYXA 1VFSA 1ZAJA 3Q67A 3TAKA 1R86A 3D0CA 3AIVA 2VURA 4JN7A 2VHLA 3ARSA 1ICSA 2CW6A 1W2PA 1I2NA 1OB0A 2FB2A 4GH3A 2DUAA 2Q01A 5FL1A 3ENLA 4MZ1A 4DNMA 3GG1A 2V8ZA 4C6LA 1BGGA 3W2JA 4N02A 2HSAA 5KFAA 3VMNA 3H2AA 3EWUA 3DECA 2OWWA 2PWGA 2DVUA 4JICA 3KM8A 4LV4A 3VPLA 2VWSA 2HS8A 5L6UA 3W1XA 1XBXA 4NY2A 1ONEA 2LLEA 1H50A 2FZ9A 3UXKA 3PK7A 1XLFA 1J18A 1DVJA 4FXFA 2W9BA 4O17A 3W2MA 4MWAC 3EWCA 4IQDA 3F2BA 3BCJA 4Q3MA 2D0HA 1QO5A 3LERA 3UZZA 5I5RA 1EX5A 4I7UA 3UWZA 3OPSA 4Y9OA 3N2OA 5CAHA 3GXIA 4S1FA 3P2VA 3TH6A 3AIWA 2W63A 3W81A 1UWTA 1LBMA 4EOUA 1EXBA 2ATLA 2J6SA 2W62A 5FKYA 1XPYA 1HJVA 4LTSA 4P8UA 3VO0A 4CGTA 4D6JA 3VNZA 3CPGA 2B7PA 1W9XA 5BMXA 2DPJA 3GUWA 4YS1A 4Y9MA 3NQ2A 5D09A 4J9QA 3G1FA 1FWIC 1VAHA 2NVAA 5D33A 5HR7A 1A3WA 3H6OA 3W6MA 3V3WA 2GGHA 1M6JA 1OVDA 4CN6A 3CM4A 3DOPA 3BLEA 3FAXA 3GH4A 1J0KA 1TVNA 1X98A 5LNSA 2QPUA 2PDMA 1M3UA 1W3HA 2Q8ZA 3ONBA 3W28A 3LHTA 3SZ8A 4JV0A 5D2WA 1XW8A 1JNEA 5E9AA 3VD3A 3G1XA 2QGHA 4HZMA 1PVNA 1F4AA 2IUZA 4AD3A 3WQ4A 4ECZA 4G3IA 3FJ4A 3MSYA 5HQEA 3W53A 3T8LA 2TYSA 1XS2A 3WQOA 1XYFA 3WK3A 1VLIA 3GG0A 4K6AA 4K8HA 1XCWA 1RJQA 2ZVIA 3HG4A 5KFYA 5G1TA 4Q8VA 1XLKA 3VYLA 1E5JA 4Q4QA 3CO4A 3FW6A 3A5VA 3V1HA 3A5FA 5E0CA 2H9AB 1JCMP 2XIQA 2W3ZA 3VGHA 4L80A 4NNAA 2NW0A 3EEGA 1Q4WA 3QKEA 5KFNA 3E9AA 4CNPA 3N2TA 2C8NA 1WDSA 3OHMB 4ROPA 1IHIA 2DSZA 3QMSA 2V30A 4JTFA 2XU2A 1DJYA 1DTNA 3OLDA 3AJ7A 1E6XM 1J4EA 2WO5A 4DWSC 4H7VA 4DVOA 1IZJA 5C9WA 4HPGA 3TCSA 2OJPA 3T1GA 3TFXA 3LY0A 4BQ3A 3F4NA 4J7RA 3STGA 1B30A 3GM8A 2G95A 1THFD 3W38A 2E8ZA 5BOOA 3MSDA 4G7EB 4GHRA 3POHA 1ITUA 5LGXA 3UFYA 3S46A 4Y7EA 2J6XA 4QITA 5TD4A 3SUUA 3RIKA 1OYBA 1IGSA 2P3ZA 1BQCA 4HMNA 2HVMA 5BCAA 2KX9A 1D9EA 1BYBA 1TV5A 1V7YA 3MCNA 1TV2A 3JW7A 4B3ZA 4IP5A 3HIJA 1K77A 3EOLA 3BLOA 4HMEA 2FFIA 2OGYA 2VP8A 5K3VA 3GHTA 4ACZB 3N9KA 5FOOA 4JQ3A 4MWAD 3TYDA 1GOXA 3G1AA 3BK0A 4WDXA 2VTFA 3K46A 4FIRA 3IWPA 1RJPA 3QH2A 2RDJA 2ZUWA 4CQDA 2F7FA 1G7UA 2IMWP 3SN0A 1ZENA 2XIOA 2D69A 4NZ4A 1WE5A 4YTTA 3BMVA 3IK4A 4KW2A 4GUFA 4MG4A 1TV3A 3PAJA 4OOZA 3CUJA 3WQ6A 5XINA 1SR9A 3ABRA 5LIYX 2VX7A 1VJZA 2CLMA 1U30A 2Y70A 3BAIA 3PUEA 4O57A 3CPUA 2YLLA 3MT1A 3OG3A 3FVDA 3O7UA 5CC5A 4TX6A 4AD0A 3RFAA 2OEJA 3W1LA 4AEEA 1W3JA 3M07A 1GVYA 4ERAA 3EDJA 3PBYA 4QQUA 3AJXA 2Z4GA 2ZZ7A 2CBJA 2GGGA 3UW6A 3RF9A 3VGDA 2VM8A 1D8CA 3TC3A 1RPKA 4BHYA 2VCCA 1YHTA 3ATZA 4B3LA 1OT2A 3CS2A 2X40A 1FKXA 1PBGA 2QCGA 5DF0A 1A5AA 1IEXA 1CGTA 3E1F1 1NH6A 1OFAA 2B7NA 4TV5A 3TYEA 3GYCA 3GG8A 3WH7A 5KZ6A 1IGWA 4QG9A 3A4JA 5LNUA 4RU9A 4Z08A 3CC1A 3GQCA 1TV4A 2ADAA 3PANA 4HT3A 4O3QA 3V7PA 3RPDA 5FEWA 1TJRA 3BG3A 4ZE5A 3QC3A 2V9WA 1WBJA 3UYIA 1QNSA 1NQKA 1XLEA 5D4YA 4J3WA 2V5DA 4IICA 4WKHA 4X9YA 3N4EA 1OYAA 2F38A 4LAOA 4Q8MA 1M68A 5GVJA 4ZXLA 1YIXA 3JR2A 1H5VA 5AKQA 3I7QA 2TRSA 4PODA 1VIWA 4LRSA 4F50A 4H9MA 1IXNA 3H4BA 3C8NA 4O1CA 3OGRA 1JG9A 2I5IA 4GFIA 3E3HA 1WB0A 2ZADA 4YCPA 4JHOA 3W2LA 1AVAA 4IR9A 5U7SA 1G01A 1U22A 3P67A 1UWQA 2VA3A 3VDCA 2Z1BA 1VBUA 3H70A 3GFYA 3H7RA 4RCXA 4BF5A 3EWDA 2ACQA 3R43A 5D37A 4O11A 3LHUA 4K68A 4AAJA 4I6KA 4RNHA 2I1OA 1FP9A 2C91A 4M3PA 4Z2IA 5A69A 2L5HA 1AUSL 3IRSA 5CGQA 1KFKA 4YL2A 3WQEA 1NOFA 5DQGA 4IPJA 3AHXA 2J9XA 1RY8A 1AJ0A 2IXVA 2CITA 1R3SA 2HZGA 3DESA 5I03A 4LJ3A 3FNDA 2ONEA 4ZSTA 2WZMA 1B3OA 2V9DA 1BKSA 1TKKA 1MNZA 2H3BA 4WDWA 3NQ6A 1YBQB 3UYCA 4E4PA 2FPTA 2IQ0A 4HA1A 4NG3A 2VC6A 1QWKA 1H63A 3NFUA 1XFBA 1JL8A 3KBMA 4P8WA 5BMWA 3N4AA 4HYRA 3T78A 2WMFA 1AH4A 2ZWZA 3RG6A 1GTHA 2HK0A 3RCNA 2DQXA 4X22A 1VJSA 3PR2A 4O14A 2QCDA 1X7FA 4GZIA 2E77A 1XH0A 3NYZA 1KRMA 4DYJA 5KG3A 4PMQA 3WK1A 3MVIA 3TR9A 5DQIA 4O3RA 3W7GA 1DV7A 3G8RA 3WDHA 1XHGA 1S2WA 4RDVA 4FB7A 3T5JA 5CZ0A 4GBUA 4CD6A 2YL9A 2ANUA 2WMKA 3GDBA 5DG8A 1XLDA 4B9ZA 2QDHA 5CPSA 3GNPA 1SSDA 3R8HA 3UU0A 3IV3A 2WSYA 2YCIX 5HXMA 3BVJA 1ZBVA 2NX9A 1VP5A 1XYAA 1EC8A 4PEKA 3REQA 4MF4A 1GG0A 3E12A 4EX4A 4MNKA 5EGRA 4NZ3A 4DAIA 4U3CA 4GYPC 4MKSA 3LA4A 1Y5VA 1BSIA 1KBBA 2VELA 3KTSA 5LXXA 3NEHA 3RB4A 4EXBA 4JL1A 5B7ZA 3NG3A 3OTRA 1KR1A 3ZIZA 1WDWA 1FCQA 2DSWA 2XCAA 2FPYA 4A29A 5AC6A 2EPMX 5BRQA 3PSWA 3VD5A 3H53A 3A12A 3WH9A 3DYPA 2CIPA 4DXXA 1W5OA 4GIAA 2FYMA 3CNYA 1XQKA 3BZGA 2X42A 4X0VA 3P8IA 3N3TA 4M80A 3NPXA 1CNVA 3W75A 3WD0A 3M9YA 1TCMA 1UQZA 1SZEA 4FS9A 3LCIA 3ARWA 1LL7A 2C13A 3IJ9A 1CCWB 1RXOB 5T14A 3P0WA 3HQOA 4FSAA 3ZSSA 4HNUA 2AQ4A 3G1VA 4PUKA 2GOUA 2ZX7A 5A6BD 1E9IA 2VDGA 4XUGA 4DWSA 3BAWA 4BA0A 4XD3A 4DWDA 1H3GA 1J0JA 3LTPA 3LHZA 2WTFA 1V6WA 1LBLA 2Z1WA 1YKWA 3W85A 5HWNA 2VGGA 1T7LA 3AISA 3KOYA 3M7SA 3LSBA 5C55A 1EOMA 1QO2A 3GU1A 3JVAA 2PEVA 2PTZA 5E9XA 4E0CA 1R7OA 3S9YA 3T40A 2UY5A 4XX6A 2Z00A 2HISA 2WC4A 4D72A 4HNCA 3DCPA 1XX1A 1RJRA 1CXEA 3BAYA 1Q7ZA 4GVGA 1J2WA 2AGQA 3LGGA 4JX4A 4MPQA 4LAZA 4JIQA 2WVVA 1VRDA 2DZTA 4F4RA 2WJEA 2D73A 3OZMA 2VX6A 5C2GA 1UWIA 4NAEB 1T40A 1I75A 4AWUA 4N6EA 1OD8A 2NLYA 2WKLA 4FAMA 2B7QA 1OM0A 4FXJA 4GY0A 3UF9A 1C3FA 1Q6OA 1XCFA 1QATA 3L7RA 5JMUA 2O4MA 2YR1A 7REQB 4XZ9A 2NV9A 4V15A 1XLMA 2PFHA 5D38A 2OT0A 5DX7A 1R8LA 1WZKA 3L0KA 5LA0A 3FEQA 4CU6A 4R7JA 2F8QA 3STPA 4BQ2A 3KXQA 1XD1A 2EJ1A 2DY3A 1U5JA 1VFOA 2PDHA 1UASA 3M0VA 3G0XA 1UW9A 4REQB 2B81A 4PRTA 5KG4A 3WMSA 1MMFA 3D3FA 3A3HA 4QE1A 3E5PA 4OBRA 2ODOA 3LRMA 1WDDA 1Y0EA 3NQGA 1PE1A 3LZ3A 3TTSA 5FF3A 2Z2AA 1MNSA 4ECWA 1TWIA 1XINA 1FWGC 3HZ3A 1Q5MA 4UNKA 3A9IA 1NELA 1MVYA 3OBAA 4NXKA 3D3AA 5KFRA 3W72A 4FR1A 1OK4A 1KM4A 1ZUAX 5J5RA 2PUZA 2QHAA 2AMXA 2V3FA 4UFIA 3OLIA 4J2MA 3TC7A 3OZPA 3THQA 1VKFA 5DBTA 3G3MA 2HBXA 4N9DA 4AG0A 2EKGA 2HXTA 3F2CA 4HSHA 1FXPA 2NUXA 4GNVA 3I4EA 3OLGA 4GCAA 4IH3A 5AC7A 3NZ1A 3FEMA 2WSRA 3UR2A 5KZEA 1QNPA 2X1SA 4IP4A 1UD2A 1A3XA 4ZQPA 1JR1A 2PDCA 4UQEA 3UWYA 2I9EA 4WDTA 3CUFA 4DN1A 3FV9A 3LU2A 4JQ4A 2FZMA 3RRAA 4DUOA 5H2ZA 1W9DM 1RY0A 4DL2A 4BQ4A 1IM4A 3VKJA 4JKLA 1PX4A 4D71A 2BOEX 1B0IA 3HU7A 5AHEA 3KRBA 4JQ1A 3GVVA 4UOJA 4KT2A 3WFZA 3UZYA 3SN4A 5LSMA 4HTYA 1Q65A 3B9EA 5A6MA 2ZTJA 5BYWA 1VCGA 1W1B1 1GYLA 2WW5A 4GVHA 4XO7A 1QPQA 2CCRA 1YMYA 2WBGA 4DBUA 2VR4A 3FHAA 2DH3A 3CYJA 2VJXA 2ZUVA 4WR3A 2ZXQA 1XLAA 3GIMA 1OG6A 4UFKA 7CGTA 3PVXA 4C1NB 4CD5A 4G56A 4GUJA 1Q6QA 3BANA 4IFOA 2NX1A 2GZXA 3A4AA 4E4FA 3GAKA 5XIMA 2PP0A 1TV8A 4PBEA 4PA8A 3RYSA 2P9BA 5EMYA 2Z7KA 1POJA 1XBVA 2GJLA 2OYKA 1EJWC 1PX3A 1PYFA 4F2UA 4RXFA 2OEKA 4X2PA 4BWLC 4MM1A 1QW9A 2PWFA 9XIAA 4C7FA 3MI2A 2XZ7A 4QE5A 1CGXA 3EWYA 3PZOA 3GK0A 3ARQA 4S3CA 5CPLA 3ZT5A 2P1FA 1TTIA 2YIHA 1TVLA 1I2QA 4LVGA 3VGGA 3GV8B 1L6YA 5BZAA 4A2RA 2CEQA 1G4TA 1W54A 1GJPA 1W1TA 5G4EA 3E0FA 3S5SA 2B4GA 8XIAA 2QLYA 4C6BA 4TVUA 2PLCA 3KOFA 3V16A 1A49A 3V5CA 1W9PA 5GNZA 5CSRA 4C6DA 3NQ7A 3Q65A 3QXBA 5CQ1A 4GCXA 3L2LA 5I7GA 4DRSA 3HN3A 4G7FA 4RL3A 1E6NA 3VOIA 2J7HA 4WHBA 4EPBC 3PFRA 1RA0A 1GKRA 4HN4A 4YYCA 3B9NA 3QQ0A 3SGGA 1ISXA 2XH2A 4IOTA 3URBA 1EFZA 1GOMA 3RRXA 4YHEA 3HPXA 3W7IA 2F2HA 4UQAA 5I3KA 4ZZ9A 1JPIA 1RLDA 3PN8A 4RX0A 5I3HA 5JQ9A 1KXTA 3P93A 2ZVRA 2Z1XA 1JXKA 1F05A 1K02A 3APTA 3B0PA 3ARTA 4UFHA 5A2AA 1TCDA 3FCPA 3KHGA 3E49A 1FHUA 3ITGA 2TSYA 3WH6A 2VQTA 2Y8VA 3NO1A 3ZO9A 3DFHA 3SY1A 2PZNA 4QNEA 2E9LA 3S2LA 5G1MA 4N7QA 4O16A 4GYPA 3DENA 3ZR4A 3PZPA 1L0PA 1FWRA 2ZZ1A 3C6CA 3NQDA 1OCNA 4IL2A 3TLQA 3EMQA 1MWOA 1EP2A 2WNQA 5I07A 1UMLA 2X16A 3LI0A 1CW2A 1BD0A 3TIMA 4MB4A 2CXGA 1G5AA 3SSJA 3WQWA 4HMCA 5G4HC 4Q7NA 1PTDA 3JU2A 2R8WA 4XAFA 1H7OA 3KRSA 3TJLA 3QOMA 5MKGB 1A5MC 2WYSA 3FA4A 4NJJA 5CBJA 1K1SA 1SO6A 4PYSA 2D3LA 4IMDA 1NOWA 1C91A 3K4AA 3R79A 4DO4A 4P8XA 2DT2A 4JTIA 5HDRA 1DXEA 1GORA 4B3KA 6XIAA 2CFFA 1I0DA 1SM9A 3MDUA 2UVWA 4U5IA 2J62A 3JZUA 3GHSA 1VYSX 3TX9A 2FJKA 4QCEA 2IKIA 1VFMA 5CGMA 2Q8XA 2XM2A 3CQ0A 1XRTA 4XTIA 4MLRA 2HVOA 1BGAA 1E1EA 1MFVA 2PRMA 4RZ4A 1VS1A 3C52A 5AHLA 3H2MA 3MUXA 1HKMA 4C5YA 3BPWA 3EA2A 3L2MA 2YYUA 1C7TA 3VD4A 3PPGA 3GC2A 4JBRA 4OUIA 1VIZA 2AKMA 3VOHA 2W9CA 4NF7A 4Z1YA 1T8XA 4KGJA 4MGGA 5CSUA 2Y24A 4LVDA 1ZJIA 4UQDA 1YTKA 3TWAA 1F74A 1R47A 2HE8A 3AZTA 5LIXX 2VZUA 1V3HA 4B5WA 2WMJA 1V0NA 4AF0A 2V5BA 3AQUA 1F6PA 3CMFA 5FCZA 5DG9A 4EBCA 4J3UA 5FACA 5GPRA 3V0UA 2GQ9A 2NXGA 1F76A 4NAFA 1KCZA 2EF9A 5K9XA 4PSPA 3ZR6A 2GJPA 2YZ5A 4A3HA 2YW3A 4RV3A 1BTCA 3CIWA 3QBUA 3NSNA 4TQSA 3FGCB 4XZIA 3EKLA 3S8HA 1UH3A 4JHZA 1RP9A 1S5NA 3W6LA 1JUEA 3NVDA 1QPNA 5LA1A 2QULA 2G3NA 4M1RA 4BF9A 1BXCA 3BDKA 4O8AA 3O16A 1TUFA 4R33A 2GK1A 2J6VA 5A6TC 1EB3A 1R87A 1QNOA 2Y63A 3SCSA 3B9OA 3W83A 3HB9A 2WWCA 3PBUA 4ES4A 1SVDA 4FBUA 4O1FA 4DEZA 3B8VA 2JIEA 4AXKA 3LENA 1XLHA 3G1YA 5HWMA 1NU5A 4GBDA 5AY7A 2V3DA 3ZLFA 3WF0A 4J4KA 3MDWA 2OVLA 2GGJA 2WHLA 4YR2A 1PZ2A 2J7GA 3GO2A 2FFCA 3U0HA 2YZRA 3KBNA 3SRFA 2ZX5A 1YNYA 1IT7A 3SQSA 4EVZA 1FFRA 3AIQA 2PDBA 3APYA 2VD8A 1DJIA 2J27A 3N2XA 5LNVA 3WLTA 4LVFA 4WSJA 3V6JA 4EBEA 1EKOA 3QYQA 4NX5A 3H2NA 5BXRA 3KBVA 2W7OA 1IR1A 3UGRA 3WNNA 2HJPA 3AIUA 1KM3A 3KCLA 4FK9A 1TPC1 5D04C 3UG3A 3O6YX 4Z2JA 3KS5A 3UXDA 1MZHA 4YTRA 4ASTA 2Z6JA 4ILSA 2W27A 3LK6A 3USBA 2ACRA 2Y88A 3KTXA 1XCXA 1HG3A 3FLUA 2DZBA 1PIFA 3B8WA 1QBBA 2ZUSA 4FOKA 1F8IA 1VZWA 2FZ8A 4UXDA 3SCNA 4JKMA 4PH6A 1XSKA 2ALRA 1QRQA 1UR2A 3DI0A 3SCUA 2BY2A 4LT9A 3I6TA 5DELA 2AKZA 4V2XA 1WV2A 2ISSA 2ZZ4A 3LGEA 4Q4OA 2FB3A 5A8QA 3QRHA 4U7CA 4IX2A 1UQYA 2IS7A 4JTQA 3IAQA 1Z6KA 2FLLA 2C7FA 1QFEA 3ICJA 3T42A 3LCLA 3W76A 1QI2A 1OK6A 3D46A 1NIUA 1FKWA 2PDJA 3U5UA 1NM9A 3U2ZA 4LNYA 3GDTA 5AYXA 2NQHA 3THDA 3KDOA 3L4ZA 3AHZA 4IPLA 3STEA 1DIOA 1N55A 3CZJA 1M04A 1NJJA 3UCCA 1IWBA 3P84A 1CECA 3HF3A 4ZOBA 3RM8A 1JZ3A 3G6XA 1NQ6A 2EG8A 4IJBA 3VC6A 1MW3A 3C86A 2EG7A 1KR0A 4W7UA 4CNTA 1XLGA 3T4WA 1SW7A 3SW6A 1TWSA 2GSHA 4DO6A 5ABTA 1M7OA 2DT1A 3BXWA 4A05A 2J6TA 5IM51 2D3NA 3PR5B 4XAGA 3GY1A 1CPUA 4L6DA 3S42A 4EK7A 4MLJA 5CCZA 3EOSA 2X2GA 1YXCA 4DX3A 1SQ7A 3H24A 1FWNA 1IR2A 2E0PA 3FKKA 1J93A 1YPFA 5I09A 3CHVA 1MI3A 3RPMA 4FLRA 2G4JA 2ZZ2A 3M5ZA 5KETA 5KFCA 2KAUC 3GR4A 2A3EA 2PC8A 3GBEA 2A7NA 2AL2B 3HURA 1B57A 4H9YA 1IE7C 1SFLA 3AXHA 2CBIA 3NQVA 5HUOA 3WDQA 3P80A 3N73A 1EYWA 5JH2A 2RDXA 4FPSA 3OSPA 1H0IA 3GIQA 2O7QA 4ZQRA 2OU4A 1E4NA 1EEPA 1KRCC 1Z48A 5LHFA 2XYLA 4AVFA 4F2BA 1OEPA 1ME9A 1KFLA 4NNCA 4GI6A 4N0RA 1J6OA 3WQCA 2ZRXA 4K8EA 4ACYA 3POCA 1B4EA 3CIVA 2Z29A 1X1OA 3WNMA 3WK0A 3VCNA 1ITXA 2GVGA 1DOSA 3QVQA 5EFFA 3BJTA 4R9XA 2J66A 1DWAM 4E2OA 1FBAA 3M0ZA 5T26A 3EBVA 4H2CA 4H9TA 4HJWA 1OC5A 3ITXA 4L9ZA 5F1UA 3G0SA 5A6SA 1ECQA 3VX0A 1UCWA 2HROA 1CTNA 3AFBA 3DHUA 3WQ5A 1GQJA 3VMPA 1GEQA 3MR2A 1HKKA 4I9MA 5I3IA 3VNMA 3B4UA 3AXMA 1UD4A 3CZ8A 4GI4A 2PGEA 1ZGDA 2VYOA 2ESCA 1C93A 1JFHA 4NU7A 5CPOA 4DJEC 3GW0A 3RX2A 2WMGA 3H2CA 4AX7A 3GR8A 5FEPA 3GB6A 4BFAA 3AXXA 4F0HA 4U31A 1P0BA 1V3MA 2Y62A 3QLDA 2ZXBA 1XIHA 4M5PA 3PW4A 1AK5A 1CIUA 2G3IA 1PO9A 1XGEA 1QOQA 4P7NA 3T4CA 3G77A 2J75A 1Q3NA 3T81A 3C3NA 1ZBCA 4L7ZA 5EMJA 3EZ4A 2GJRA 3N34A 1WNOA 3JRKA 2TAAA 1AMKA 1FXQA 1UBSA 3ZJ7A 4QJ3B 4KESA 2XDFA 4JTGA 4XZMX 3SECA 4ECRA 1F7BA 3PW7A 1K4GA 4LX4A 3A9BA 3IJIA 4ZQOA 1E56A 5FAJA 3M9NB 1WKFA 3GWQA 1G69A 3QKZA 3E0WA 1ICQA 3VMOA 1Y7VA 4B16A 2GVJA 4US6A 1FTXA 3S2NA 1UWUA 2J7FA 4HCDA 3SY8A 1KGUA 1XLBA 5DMMA 1WXYA 1HVQA 3BG5A 1D3CA 3N1AA 5GJNA 1P0DA 1KGWA 2VX4A 1V8EA 4MDOA 5D03A 4WOZA 2WANA 3R11A 4KEVA 1VRXA 1V3LA 2W4XA 3THAA 4J9OA 4OUEA 1N48A 2HK1A 3IIOA 2GQ3A 6REQA 4JNYA 2D0FA 4IGHA 4MB5A 3PUDA 3SCOA 1WZMA 2ZRZA 4NUWA 2ZUTA 3RNDA 1HJXA 1HL9A 1LRNA 1ZNNA 5FA5A 5D9MA 1Q6CA 4ML4A 1BRLB 3IIXA 4QEHA 3N6HA 1BLIA 3RLVA 4DF2A 2QUVA 4AISA 5M17A 3NZQA 4ZB5A 4M56A 1ZFJA 4XTDA 3HV9A 1CLVA 1R0MA 1LT7A 4WVXA 3FA3A 3CAVA 1E70M 2YCLB 4I8DA 6ALDA 3AS3A 3WD3A 2Z6IA 1H5YA 1QVBA 1TVPA 4HD5A 4GO9A 3NL2A 5F4SA 3AZSA 5F2MA 4IFRA 4GKLA 3IS4A 4HYKA 3C2FA 1GOIA 4WD0A 3V0SA 4N2YA 1RALA 1C8VA 1J0HA 1MRQA 2Z26A 1XYZA 1H60A 4KRUA 4NHVA 1RBOB 1UP0A 3QV8A 3FSUA 3CTLA 1CI1A 2Y1HA 2Z2BA 5DGBA 3GVRA 1W1VA 2Y89A 1BSLA 2PSNA 1RH9A 4B5TA 1S2UA 3WNOA 4QROA 1XL9A 3VZZA 1UROA 1ZHAA 2X1UA 3WQVA 4HA3A 3AICA 3CQIA 3I7SA 4HPJA 1H7XA 3NL3A 2SFPA 1VEPA 4ML9A 4FNQA 1QNRA 1UUOA 2DQWA 4KCWA 3CU2A 3VIIA 2UVUA 4H8VA 3PBVA 2WPBA 1V0KA 1TPVA 2I17A 5AZ0A 1GJUA 2NV2A 3H40A 1W1A1 4ECUA 3LI1A 5CC7A 1UOZA 4O3SA 4ADTA 4WY0F 3ABOA 4DBWA 2A0NA 5EWEA 1GPWA 3HA1A 1W8SA 2D1ZA 3MR3A 1G7VA 3KVKA 3CZGA 4AZIA 5A6LA 3C0JA 3TK7A 3SAZA 2W0UA 1S3HA 1WKDA 2Z7GA 1HP5A 3AXIA 3UJEA 1OG0A 3L4TA 1F8MA 1E6SM 3NZRA 2XN0A 2A4AA 2PDGA 3VNLA 1JYVA 4HBKA 5DLGA 1R46A 3W7QA 3WEMA 1OFPA 1KBIA 3WLLA 1JPKA 3GDKA 4M81A 5HK4A 4JTUA 3CHDA 1U1JA 5DFAA 3TFCA 3EEZA 2FLPA 3DHPA 2OX1A 1MDRA 1UR8A 1KBLA 1AD4A 4Y96A 3NGDA 3MWCA 2WMIA 3B8SA 2PBOA 2XZ9A 2AGTA 4XBJA 5CXPA 3U6WA 4W5UA 5CJMA 1U2YA 3PUGA 1QTWA 4MOZA 4RR4A 2OQHA 1YXYA 4K1GA 2BODX 2J7CA 3UESA 4XKYA 1ADOA 1B3ZA 1M03A 1UR9A 5CBIA 3TQ1A 4MNJA 3EYPA 1LLOA 1N56A 4BY3A 4GC4A 2R14A 2GQ8A 2WWDA 2XFRA 5KMYA 1VPQA 5HMEA 4O3NA 1UJPA 4Q22A 2X2YA 1R3YA 4ZENA 4PMJA 4F2TA 1TWZA 3VI2A 1WZAA 2VD9A 2UBPC 1ML1A 2G97A 1TX2A 3GXDA 1P5BA 3KUMA 4DZHA 1AQ0A 1XLIA 3QC0A 1BF6A 3TVAA 4FOJA 1BTMA 4RPPA 4DO5A 2YA1A 3MB9A 3MJMA 4B4HA 3WX7A 3TQKA 4X61A 4H6RA 3T09A 2Q02A 4KGLA 3PZQA 3M9MB 2P5NA 2QV5A 3QF0A 3QQWA 4FR6A 5CSSA 2QAFA 4PMNA 3WL1A 1K8ZA 4LCSA 1S3TC 4DUWA 4MB1A 1ZAHA 2HRWA 4S3JA 3AIRA 2IA6A 2A6NA 2BXYA 1R9YA 2XCPA 3RJXA 1PTGA 2RAGA 3IRDA 2ZUNA 1M65A 3HPSA 2WLYA 3SGZA 5EWFA 2F6XA 2Z2UA 2WXDM 1NP2A 2QPSA 2C0AA 2PDIA 3WUFA 1I60A 1OIFA 3UWWA 1E73M 3GNOA 4GC3A 2XGZA 4Q4RA 5KT3A 1BFNA 1DJWA 4NIRA 3BV7A 5HATA 4LPCA 4FP1A 2WHMA 2WVSA 4V33A 1PL9A 4O19A 1V6TA 2YXOA 1K8XA 2Y5JA 3TNOA 2FZNA 3FIGA 2W9BB 4DNHA 5BXSA 1KB3A 3W3OA 3SFKA 4CQAA 4PCPA 2CKRA 4WF7A 1CXFA 4ZFMA 3ZXWA 1SO4A 1ZS2A 3TTQA 3UGVA 2Y8UA 3S1WA 3PJXA 3GVWA 3SCVA 2WJFA 4GGBA 1DHKA 1MEWA 2QIWA 4XD5A 4UWMA 1SZRA 2EO7A 1NTHA 1DQUA 3FOKA 5GQBA 2DW6A 3QY6A 3D47A 1LLWA 1POKA 1CWYA 4IPPA 2ATMA 1S0NA 2PDNA 2DORA 4A3QA 4N6FA 1S1PA 1D8WA 1UKQA 3CT7A 3IANA 4DJEA 1MW2A 2IW0A 4D6DA 5DY3A 1QXLA 4AXNA 3WUEA 1EC7A 4DY1A 4UNLA 1K70A 4W8BA 4XBKA 2JKEA 4RJEA 3N3MA 3R94A 1W2VA 3PBGA 3F1QA 1VGAA 3VGFA 3OVPA 3OYXA 3VIGA 4K2SA 1K6AA 1R9XA 4F40A 3G24A 2PCEA 2ACSA 3AS2A 5FF4A 1SYTA 3VIFA 1H1ZA 3LG3A 4HJFA 1E6RA 4HIBA 4R34A 5I0DA 4KCVA 1EUAA 1E4MM 3IGSA 2E6YA 4KEZA 4LAMA 2CERA 1K7EA 4FZIA 4B2DA 3M43A 5CZKA 2NX3A 1DIDA 4O10A 4AVOA 1LM1A 4O3OA 1TG7A 2BVDA 1ELSA 4PCTA 4H4IA 2VFEA 3O8AA 3GDLA 3PULA 4DIAA 3PAOA 3S2MA 3RLGA 1VEOA 2EPLX 4XZLX 6XIMA 4KQNA 1DJXA 2WNZA 3NPUA 1QK0A 1GOWA 2YCKX 1XSIA 3HPFA 4RNOA 3QTPA 5DCEA 4QWAA 3UXAA 3BSHA 1DJNA 1TPEA 4WKAA 3GW3A 1H7NA 3F5LA 4MMWA 3TW6A 4N9EA 2EPKX 4WGHA 2DZAA 1EYEA 1TMQA 3EX3A 4LYQA 1PEZA 3GU9A 4IPNB 4Z1CA 1XLCA 4C60A 2DPEA 5BOEA 3H26A 4E3TA 4NYUA 3W0KA 4UCFA 2ZA1A 1EPXA 3BO9A 4D6GA 4D6CA 2V63A 3IVTA 1JYWA 3OZOA 1ISVA 2VDIA 1SO3A 4GX8A 3VGEA 3I68A 3AZRA 1WXJA 4S2BA 3RPTA 3SGUA 1UZ4A 1PIGA 3INPA 2WOQA 1CBGA 2VO5A 1CXIA 1JCXA 3SUSA 4D6HA 1PPIA 1I2RA 4JN6A 4Z2HA 2FMNA 2O4QA 3F03K 3FS2A 2EAWA 4E6MA 2PE4A 4UTLA 3ZJ6A 4H8HA 5AHIA 3CV1A 1WA3A 3B0YA 3SUWA 3L5LA 3ANUA 3TW7A 1KXHA 5HA7A 4AZ6A 4F4WA 2XWEA 4G7EA 5F9NA 4JV1A 4F9DA 1DKWA 3QZEA 3AYTA 3BH4A 1ISWA 2X1TA 5C7VA 3BQ2A 4HHHA 4FLQA 3ARXA 2HS6A 4ED6A 1RP8A 2B7OA 3N13A 4E2BA 3TN4A 2Y85A 2F6UA 4C91A 4GZ7A 3BL3A 1AW1A 2PGRA 4NQ1A 3M4HA 5M2FX 3ZT7A 3R0KA 5DO8A 4EXAA 4EIVA 3VFCA 3F5JA 4QBXA 3UWEA 1QU4A 5E70A 3GXPA 1UZHA 2CETA 3MV11 3Q58A 5KFEA 1S9FA 4LGXA 3WLRA 5EL1A 1S0OA 3ZWSA 3HMJG 4FLOA 3NDZA 4FBTA 1VBRA 5AYYA 1Q6EA 4QJ1A 3VK5A 4WEVX 4PB4A 2BLEA 1KM5A 2XH0A 2PB1A 3O2LA 3E6EA 3E5BA 1WX0A 4TO8A 4M24A 4K8GA 1M01A 1ZBWA 3VD9A 3OBKA 5L9FA 4I7WA 3GIYA 5E93A 1SO5A 1W56A 3SUTA 1EA0A 2E28A 5KG6A 4B4FA 1TO3A 3F4CA 3B8TA 3QZ7A 4I5RA 2QQ6A 2PTDA 3GSMA 4QAWA 3BQ5A 3W27A 4HYWA 1B3WA 2XGQA 3GYEA 2RJGA 4AY1A 2FVMA 1Q7MA 3RCMA 1W3KA 2JEGA 2YCJA 3GAYA 1PDZA 1C8QA 1ZSXA 2OXNA 3QPZA 4DYKA 1NFBA 1WXZA 4L6HA 1WUFA 1MFUA 1JULA 3S47A 3USZA 2PD9A 3B0VC 2ZDSA 2O7SA 1PTAA 5KFWA 1UYQA 3GFXA 7TIMA 4GOAA 5A6AA 1OYCA 3WLKX 1PX8A 3VD7A 4GYFA 3HG3A 1UA7A 1OD0A 1NARA 3Q2DA 2DVXA 2EBNA 1EO5A 1LWIA 4Q4SA 1O94A 3S6OA 4US5D 4M0XA 3UG8A 3ONCA 4QEEA 1W5QA 4MUPA 2YBVA 5C9RA 1AL7A 1EIXA 1ZALA 3TYZA 3NSXA 4IHCA 3H4WA 2YXGA 2CWNA 2WVTA 1QT1A 4U5KA 3WLIA 2DSVA 3GXFA 3WYZA 4I6VA 1E0XA 4IUGA 2FTPA 3DBPA 3UETA 1L2UA 1I0BA 1V6UA 1KFWA 4O0QA 2ASDA 5EKYA 4J3TA 2OTDA 1YXDA 5KFDA 2W6RA 4TTGA 2IQTA 4LANA 4JV2A 2FH8A 3ZMRA 5FAGA 4JTAA 1WP6A 3N9SA 4ECQA 1U1HA 4QS5A 3W1QA 3L4VA 1H51A 2E9MA 3WQ8A 3VNYA 3WNPA 5FESA 3CMGA 4O1BA 3NQCA 3KOXA 1RK5A 3KDNA 4TVDA 1WDPA 2R24A 4WXZA 2BXVA 3MKCA 3TZFA 2GUUA 2QDEA 2YKKA 1FWBC 1XIDA 1XXXA 3ABQA 5TAOA 3M1ZA 1KCXA 3AMCA 3CH0A 4TIMA 1EP1A 4O53A 1ZP3A 4GJJA 2QJJA 2AL1A 1UR3M 1EZWA 3MUAA 3W1AA 4Z2GA 1LOQA 2ZC1A 4W85A 1NWSA 1ZAIA 4ED1A 5KFLA 1YDYA 4Q8TA 2VGIA 3QV6A 3E38A 4L65A 5LZLA 4ZB2A 4JPGA 1LQAA 5G5IA 4RPQA 2NQ9A 4S3GA 2G50A 4DYEA 4ALDA 4TX9A 4QISA 2FTYA 4OGZA 3AALA 1RD5A 5C9UA 1CXLA 2V3EA 4PMYA 3WELA 1JPMA 3W4RA 1QI0A 4ZCWA 1RCOB 5CJNA 4E38A 3HG2A 3PNUA 1E1CA 3WBXA 3TAOA 3M5XA 3S2JA 5AYIA 2RKXA 1ZQ5A 4K7VA 3OGVA 4UTFA 2GVLA 3UCQA 4UB9A 3ECQA 4JR5A 3ITYA 4ZQMA 4A8RA 4H1ZA 3VA8A 4B9YA 2QGYA 3TQVA 5FF2A 1OX6A 2WQDA 3R1ZA 1OBAA 1O12A 4JCLA 4NZCA 4JIEA 2P8CA 2XIMA 1TE6A 3I3BA 2GSEA 3UZJA 3M7WA 2AAAA 4JAWA 4I9TA 4K3ZA 1V02E 2E6DA 1X7IA 3WLQA 1F6KA 2NT0A 4ZL1A 2ZRWA 3LPOA 3NTYA 4S2CA 4D6FA 4Q32A 3H4GA 4UUIA 1LROA 1R6WA 4K7YA 2FQIA 1IIHA 1UIOA 3A3XA 4POCA 2GQAA 4JTDA 4O1EA 1WDQA 3REQB 4JYFA 4RZBA 2QJNA 3IK2A 4NL1A 2BFGA 2MANA 4B5UA 3JZEA 4GI8A 4WK9A 1UWAA 2DJXA 5CC6A 4AIOA 3CWNA 2YA2A 4M7TA 3LV5A 3M0JA 3ZR5A 3TUUA 4G5DA 3ALGA 3S9IA 2Z1VA 2A21A 4OV9A 1WAUA 4Q8FA 2ALDA 3P8JA 4DELA 4DXVA 5I2UA 1UBPC 9CGTA 1X8FA 1LQ0A 2V3GA 1R85A 1TIMA 4QTGA 1QOPA 4AU0A 4BI5A 4WQ6A 5TIMA 1GG1A 1I4NA 3B9DA 2H3DA 4QWBA 3FXGA 1MW1A 3HFYA 4HPHA 2C18A 3LRLA 4DAFA 1XYLA 5I24A 4Y8FA 4FO4A 2X0HA 1TJ1A 3GX9A 1ZZMA 5EBAA 3KBWA 2JIWA 1FCBA 2XG9A 1XC6A 1F3EA 1U5VA 3EDFA 3O6DA 2C16A 4FOUA 2GVEA 5HJYA 3MMUA 1SFSA 2W91A 1VJIA 1ZBKA 4U4MA 3R0DA 3DC0A 2WV8A 4M1BA 2QCEA 2PTXA 1PZ3A 1CT5A 2HV5A 3WDPP 4FIQA 1RBAA 3EOEA 2WCGA 2YA0A 2TPSA 1TZZA 1JEZA 1UR1A 2J74A 2YJQA 4UIOA 1R9ZA 1PWMA 4H41A 4FNPA 3W7RA 2FMOA 4PMVA 3N25A 4S23A 4DJDD 1E9LA 1V3IA 5A5WA 5G2HA 3TDFA 1A4MA 3A23A 2QF8A 2XN1A 3PJWA 4JY9A 4MNLA 2ZRYA 3AMDA 1S2VA 4B5XA 1OADA 2WVVB 2ZX6A 1BYDA 4I9AA 3LGDA 2E9BA 3QZ8A 1A50A 1Q63A 1ODUA 4ECXA 2VC9A 1E0VA 3G18A 1UKOA 5IRPA 3RDKA 4W4QA 5HNNA 1D3GA 1E40A 1UH2A 1HL2A 2C19A 3LSCA 4GYKA 1FWFC 1R3TA 2WBKA 2YPIA 3VKKA 4I8YA 1DWHM 2VFHA 3PJTA 4D6EA 1YX1A 3LCGA 2E5DA 1KV8A 1VFTA 1HN1A 2BTMA 4GNKB 4RNNA 4F48A 3CK5A 1LT8A 2D20A 5I78A 3WF2A 1H11A 2OCZA 3WJZA 4RLIA 3BOLA 4IPIA 1SSGA 2Y0FA 4W7WA 1V4YA 1MRAA 1XIJA 3TYCA 1TTPA 1LL4A 3QR3A 3CUXA 1PV8A 5IXEA 5H91A 3E2VA 1MZRA 4M29A 4RXGA 5C2XA 5KG7A 3NURA 1PHWA 1E4IA 2UY2A 4ZO9A 2WLZA 2E40A 3H4DA 4YWIA 3QGAC 5IDZA 1QI3A 3FDSA 4FLSA 3HPZA 3VAVA 4JEJA 3OBEA 5C5YA 1SGJA 3KW3A 1H7PA 2C14A 1SJDA 3UR7A 1EPVA 4XISA 3CLWA 1TWWA 1HIZA 1TPWA 3CO8A 4XSMA 3APGA 4QQ3A 2PAJA 5AYBA 1GW9A 1FH8A 3W1RA 4EPDC 3OQ8A 4IF2A 2PU0A 3A4WA 4KPLA 4DF1A 5CH9A 2B0MA 4Z0JA 3VKAA 1FVPA 3SI9A 3VIHA 1TPFA 4R5EA 3ZSTA 4CVUA 1O5KA 4H9VA 4IL0A 3AS0A 1N8IA 4Y8EA 4BQ5A 2V69A 2IKJA 4GXPA 4NNBA 3C61A 5BROA 2R94A 3G3DA 2IMRA 2X30A 4CN1A 2BX7A 2OKTA 4PCFA 3R0UA 4PUUA 3CLMA 3W24A 2GJXA 4JTJA 1DJZA 2EPOA 1JUKA 2CPUA 5KT5A 4M6PA 1H4PA 1XDLA 3VVGA 3H2OA 1HT6A 3K2GA 3LX9A 4OKDA 3OVQA 4M7SA 1P7TB 1QI4A 3RILA 2ZXDA 1Z41A 5AYZA 2QXWA 1HJWA 3WFLA 1AJZA 3MJYA 5F4WA 3IJDA 4EE9A 4HZ7A 2QCLA 1ALDA 2EG6A 1HJUA 4ECLA 2CLHA 5LKYA 3L2IA 7A3HA 5DQPA 4J3ZA 4ZA0A 2Y2WA 4S3EA 3WF1A 3ITLA 2VFFA 3UNTA 1K3UA 1JGIA 1ENUA 1S5TA 4IMEA 5I3GA 1H41A 3N2MA 3TQ0A 5KFQA 2W7PA 1Z3NA 2VFGA 3Q37A 4WIWA 5U4NA 4E8GA 2VWTA 3OW1A 1XRVA 4A8IA 3SSZA 1TYGA 1KTCA 3WMCA 3W1PA 4JFVA 4EPKA 2PS2A 2D2OA 4WJEA 1Z9AA 3M0HA 3W1MA 3C4UA 2QPXA 2CBUA 3PTQA 4H19A 1WKEA 3VNDA 1A47A 2FVKA 2JFEX 4DJFA 3BMWA 1HO1A 3QGVA 1NDVA 2OR2A 3FKRA 5JUVA 4PEEA 4YYFA 4UFMA 4UR8A 2GUBA 2ZE0A 2OT1A 2V67A 3UT0A 4AY8A 1GT8A 3VOJA 4DZAA 3N17A 3GBDA 3DI1A 1T3NA 5CZTA 3BC9A 1OX4A 2ON3A 4DL6A 2D23A 4FMVA 3VIMA 3L68A 1F3WA 3D6NA 1RVKA 1ZLPA 4QM1A 1YDNA 2YDRA 3AYSA 4L4LA 2E4TA 3MR6A 2NQ5A 2AGOA 3LS9A 1C8YA 1ZJBA 3W7MA 3BARA 3LTSA 3DERA 3NA8A 2V5KA 1UC4A 5RUBA 4RV8A 1V0LA 5IHRA 4Z42C 1FWJC 2AOSA 4Q8NA 1G1YA 4Q43A 3QYSA 2AMGA 3MY9A 1KLZA 3LBCA 2BDQA 1YYAA 2GFTA 1EHNA 4XBSA 4DUXA 3UPWA 2HBVA 1V3KA 3I7RA 4UZSA 3P61A 3P74A 1CLXA 4FF7A 1H61A 1FRBA 1GVFA 4XKMA 1EZ2A 3VM7A 5KITA 2ISVA 1QR7A 1S5VA 1S97A 3TA6A 3NPVA 4AH7A 2XSAA 3UERA 3KWXA 1UWRA 3KCJA 2R1MA 5C9ZA 1ME7A 2C71A 5DLCA 2VL4A 2QNEA 3B4YA 3UPBA 5EFDA 5EA9A 5T91A 4BZYA 4OOUA 2DFAA 5IOBA 4JCMA 2EQDA 5HMDA 4MPKA 3CHEA 2J78A 1X6UA 3UA4A 1CXKA 3DFQA 5I3FA 2E68A 3PY2A 5SWUA 4JKKA 4B5VA 1ODZA 1EJ7L 4URIA 5FJTA 4PMZA 3PZTA 4XIAA 1PS9A 2FLIA 1W37A 4YTQA 4MYAA 3W7CA 3KL5A 5HNTA 4Q45A 1UD6A 3TW9A 5C2CA 4OWGA 5AECA 3N6QA 3VC5A 2HE5A 1Q66A 5J5DA 1REQA 4HMDA 4HU8A 2BGNE 3GTIA 3QW4B