1POJA

Isoaspartyl dipeptidase with bound inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
388
structure length
387
Chain Sequence
MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLTHIGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isoaspartyl dipeptidase
publication title X-ray structure of isoaspartyl dipeptidase from E.coli: a dinuclear zinc peptidase evolved from amidohydrolases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 116
structure length 387
sequence length 388
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1pojA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1pojA02
4NI8A 2FVMA 3S2NA 4J35A 4CEXC 4HK5A 3WYZA 5HMEA 3A4JA 3URQA 4CEUC 2D2HA 2O4MA 3LA4A 3MDWA 3T81A 3URNA 1UIPA 1UIOA 2BGNE 3G77A 4J5NA 3O7UA 3TN6A 1RJRA 2WM1A 1ADDA 4IG2A 3FDKA 1DPMA 2R1MA 2FTYA 3N2CA 4IG2B 1J79A 5FSEC 1J6OA 1HZYA 3GG7A 2UBPC 4BY3A 4C6LA 1FWAC 4IFKB 3F2DA 4AC7C 2ICSA 4G7EB 4LAKA 1POJA 2FTWA 1A4LA 1NDVA 1EJXC 1YBQA 4H9YA 4IFRA 4EPDC 1YIXA 1P6BA 3E0FA 2E25A 3QY6A 4GX9A 4QRNA 3BE7A 4UBPC 2DVUA 4HK7A 1P1MA 3S2JA 4ERGA 1E9ZB 3RN6A 2XIOA 2AQOA 4LALA 2CZVA 4XAZA 3OQEA 3LSBA 4ERAA 4DLMA 4EPKA 3RCMA 1FWGC 4F0RA 2R1LA 3NEHA 1RAKA 4M51A 4F0SA 4Z42C 2FFIA 1V79A 4H9XA 1JGMA 4C6BA 3D6NA 1FWFC 4H9ZA 1ITUA 4KESA 3SO7A 2D2JA 2HNHA 3OU8A 4B90A 3GUWA 3IPWA 3QY8A 4V1XA 4LCRA 4RDVA 2Z24A 1A5NC 3T8LA 3LSCA 3MSRA 1PTAA 4I6VA 1ITQA 4R7WA 3LGDA 2EG6A 2YB4A 2R1KA 3IACA 2DVTA 2AQVA 2HQAA 4DNMA 4IH3A 4EPBC 1EZ2A 4UB9A 3E38A 4IGNA 4DYKA 2P53A 5LXXA 3LS9A 4HA0A 3GTIA 4DZHA 1J5SA 3B0XA 2YZ5A 4J2MA 4CNSA 2PGRA 2Z2BA 3B0YA 1KRAC 4IF2A 3B40A 3PANA 2IMRA 3E74A 3GU1A 3PNZA 4PBEA 4V1YA 4IQJA 4QS6A 1EJTC 4QS5A 2FVKA 3S2LA 4C6QA 4LAOA 3IGHX 1NFGA 2F6KA 1R9YA 4C65A 3TN5A 1XGEA 3EGJA 3K5XA 3UBPC 5FSDC 1POKA 4GOAA 2Z7GA 4F0LA 4B92A 4EPEC 3URBA 3IARA 4PCNA 4R88A 2GSEA 1KRBC 2A3LA 4DO7A 2VC7A 1EJRC 1RJQA 5E5CA 2EG8A 4ERIA 3WMLA 1E9YB 2OQLA 1FWHC 4H9UA 2I9UA 2YXOA 4LCSA 4YIWA 3RHGA 3GU9A 4CNUA 1FWDC 2Z28A 1KCXA 3QY7A 2HBXA 3GTXA 3V7PA 1V4YA 3MVTA 4GBDA 2HPIA 3UF9A 3FDGA 1NDYA 2R1NA 4ICMA 2OB3A 3GGMA 2PAJA 4LEFA 2Q01A 1V7AA 4GC3A 2Z00A 1EYWA 3QGKC 4LCQA 2W9MA 1RA0A 3TN4A 2Y1HA 3OJGA 4C6CA 1O12A 4PBFA 4CQCA 4LANA 3WZ0E 1YBQB 3MPGA 4H9VA 1EJWC 4LH8A 4WGXA 2P9BA 1NDWA 2KAUC 1RK6A 3OVGA 4XD4A 3DCPA 4C6NA 4KEUA 1W1IE 1XRFA 2AMXA 4R85A 3ID7A 3TNBA 4DLFA 1V51A 3IRSA 3PNUA 1WXYA 1ZZMA 4L6DA 2VR2A 2P50A 4XD6A 3ORWA 3NURA 3TN3A 4GK8A 3K4WA 4B3ZA 1I0DA 4RDZA 4ZSUA 2Z26A 2ADAA 2VM8A 4KERA 3QGAC 2O4QA 3HPAA 1YMYA 3MDUA 3PBMA 1GKRA 3EWDA 4C5ZA 1O5RA 3K2GA 3F2CA 2OGJA 1R9XA 2HBVA 4H00A 1RA5A 4EP8C 3F4DA 4GXWA 4RE0A 1A5OC 3LNPA 4IGMA 4D8LA 4WHBA 2GZXA 3DUGA 1EJSC 1K1DA 1EF2A 3ICJA 3GTFA 4XAGA 1NDZA 3C86A 4NG3A 3S4TA 1YNYA 1FWEC 4CNTA 3A3WA 4I6KA 4GX8A 1GKQA 4C6JA 2YB1A 4C6EA 1VFLA 4DZIA 3CAKA 3MJMA 4DI8A 4QROA 1V77A 2Q09A 4RDWA 1P6CA 4RZBA 4C6PA 2I5GA 1ONXA 1PO9A 1PB0A 3AUOA 4RDYA 3OOQA 1FWJC 3E3HA 4B91A 4LFYA 3HM7A 2QPXA 4KETA 2Z2AA 4KEZA 4P5UA 4GY1A 3PAOA 3KM8A 1A5MC 1YRRA 1PSCA 4BKNA 1FWCC 2D2GA 2GWGA 3MTWA 3ITCA 4H9TA 1GKPA 5HMDA 2GOKA 3UPMA 3GIPA 5CH9A 1FWBC 3MKVA 1XWYA 4PE8A 3IV8A 3DC8A 3EWCA 4G2DA 2QVNA 1M7JA 1KRCC 4H9MA 1K70A 3AU2A 2Z25A 4INFA 2UZ9A 3LY0A 1FWIC 3IJ6A 3ISIX 2Z27A 4DI9A 4C60A 2RAGA 1J6PA 4QTGA 4IFKA 1IE7C 3F4CA 1EJVC 4G7EA 1KRMA 3SFWA 1A4MA 1QW7A 2PGFA 4PCPA 1S3TC 1XRTA 3RYSA 4C6MA 3GIQA 2BB0A 4L9XA 2QS8A 3E0LA 4JOMA 4CQBA 3A3XA 5HMFA 1RK5A 4H01A 3HTWA 4IFOA 1A5LC 3GU2A 1RJPA 4KF1A 3CJPA 3MVIA 2HPMA 4KEVA 4XAFA 2QT3A 3GTHA 3FEQA 4NP7A 4C6DA 3UR2A 1FKWA 3GRIA 4MUPA 4TQTA 4C6FA 1M65A 3F2BA 2VUNA 4GZ7A 2DVXA 4AQLA 3LGGA 2PUZA 3O0FA 3AU6A 4QSFA 4BJHA 1BF6A 1EJUC 2WJDA 4XD5A 4C6OA 2E1WA 2VC5A 3E2VA 4C5YA 2ANUA 4GY7A 3OODA 2R1PA 1FKXA 4C6IA 1QXLA 4DIAA 4GY0A 4WVXA 3UR5A 5AKQA 2ZC1A 1R9ZA 2PLMA 4E3TA 1M68A 3S2MA 2OOFA 4XD3A 1UBPC 2VHLA 4GYFA 2G3FA 3T1GA 2WJEA 3URAA 4CQDA 1WXZA 1A5KC 4ZSTA 2EG7A 2Z29A 4HK6A 4OFCA 3JZEA 2WJFA 3CS2A 4XAYA 4HJWA 5G4HC 2GWNA 4LAMA 2Z4GA 2OODA 1UMLA 1I0BA 4KQNA 3NQBA 4KIRA 1ONWA 1K6WA 4C6KA 3R0DA 5A6TC 3LU2A
chains in the Genus database with same CATH superfamily
2FVMA 2PURA 5DGAA 1LT7A 2FPVA 3UJFA 1KM2A 5AHIA 3FY1A 5DBUA 5LGXA 2EKGA 2QDHA 4ZB5A 1WZMA 2BFGA 4A3RA 4OTKA 2YDAA 4HNNA 1V3IA 4J5NA 3DYMA 2GQ8A 3AI0A 3BUVA 4H8HA 3EBVA 3TC7A 2NQLA 1E55A 5H6HA 2QKFA 2HNEA 4B5XA 4JQAA 9RUBA 3LM7A 3W28A 3N2CA 2WSYA 3TYEA 5FSEC 1E3ZA 1OM0A 2FPTA 3FVDA 1JUBA 3HPZA 5EDWA 4AC7C 3WD4A 3SCSA 2QJMA 1N7KA 2WTFA 1A4LA 3M07A 4MAVA 3WF0A 1WE5A 2YBVA 1S10A 4CD5A 1UZ1A 3LEPA 4UBPC 4IIEA 4W86A 5HWNA 5A95A 1KM3A 1RCXB 2XIOA 4R53A 4ZR8A 2WZTA 3CIXA 4E6MA 5GNZA 3GYCA 5HDRA 3OGRA 3CGTA 1FWFC 3CZLA 1WNOA 3GD6A 4AXNA 2C1HA 3G1DA 4AMAA 8RUCA 4RNIA 3CIVA 2DVTA 3OLGA 1OCBA 3NJ3A 3PTMA 1BVWA 3SGUA 1XBYA 3KCLA 5KT6A 4U5IA 3E02A 3IIVA 1FCBA 2WNNA 2PC8A 5CZTA 4CNSA 2BHUA 1XFCA 4J9NA 2EJ1A 4ZQRA 2ZRZA 4AEFA 4KMQA 2FVKA 3S2LA 1EL3A 5AFDA 1TV8A 3TN5A 1Q65A 4ZQOA 3LK6A 1WKEA 2C0AA 1CGXA 3IJQA 4WDWA 4NXSA 3KBVA 4U3CA 1T99A 1D8CA 1G1YA 1VB9A 3CBWA 3M47A 4FB7A 3WMLA 3MKCA 2F38A 2WO5A 3DZ1A 4TU1A 3AS0A 4LCSA 4EIVA 1R8LA 3FLUA 3EKGA 4ZA0A 2CKRA 3BO9A 1XIBA 4RNHA 1V4YA 1ONEA 6XIAA 2DP3A 3NQ6A 3C52A 1LRQA 2ZA1A 4AYSA 4Q44A 4PULA 1RALA 2R1NA 3W6YA 5EWFA 4GNKB 4IP5A 2PAJA 4IMCA 3KRBA 3NZRA 1NF7A 3V5CA 1T3NA 2ZZ1A 2Y1HA 4QQUA 3EDEA 2FH8A 4LANA 1QPQA 1LL6A 5HBFA 1TPEA 1P6WA 4US5D 1V0NA 3CZEA 3AZTA 5MF5A 3DHFA 1E0WA 3CUGA 4E0CA 3IRSA 3TMLA 1N55A 3B8TA 1IT0A 1W5OA 3ZVIA 5D9OA 3CMFA 3W84A 1L8NA 4BI6A 3ZO9A 4MJZA 2VM8A 1AG1O 4A22A 1L6YA 3O07A 1GOMA 1E6PA 1GKRA 2BY3A 4R5EA 1GPWA 1EP3A 2X2YA 2ZADA 1JYVA 4ECVA 3QJAA 4O57A 3ITOA 4AD1A 3DFYA 1JUKA 4HSNA 4JIQA 2GZXA 1P48A 4HMEA 3WBEA 4LTSA 4PMJA 1NDZA 5KZDA 3NGDA 5ABTA 1XJBA 1RVKA 5DEZA 2Q8ZA 1KFCA 2ALRA 8A3HA 4PBGA 5F9NA 5G1MA 5EL1A 1EO7A 1B30A 2C14A 3B0VC 3GFXA 1EF3A 4C6PA 1H1ZA 4K8HA 4UTKA 3TUUA 2ZQ0A 3HQPA 2NUYA 3W7KA 3CQKA 1K02A 3CEUA 3FX4A 4LC8A 1TQJA 4WEVX 3P80A 4CU6A 1Q6GA 3KUMA 2HVOA 1NOWA 2QNEA 1IR2A 2XN2A 3MWAA 1QDSA 2X0HA 4GH3A 4NNAA 3UVAA 1LLZA 3QHMA 3N17A 1FWBC 3OBAA 1QOQA 3BMWA 4IICA 3ZJ6A 3LY0A 1V03A 2XVPA 1CI1A 4NYYA 2QAPA 4IFKA 3VGDA 4H6QA 4PMQA 3SFWA 5XIAA 3MUY1 1XRTA 1S2VA 1OFPA 3MBDA 1PX3A 1GQIA 1P0BA 5K4XA 3B4UA 3IN5A 3CJPA 1H51A 3A3HA 5D2VA 3NQ2A 3H2OA 5JBEA 3VOFA 1XCWA 3M9MB 2EJAA 1UWAA 3WDJA 4C6FA 1PTDA 1YTDA 1R85A 4BQ5A 4P2VA 3I6TA 3R0UA 3GX9A 4PUKA 3HFTA 1IZKA 4NXKA 3VCRA 1RCQA 4KWSA 5E0KA 1BSLA 1VYSX 3A6OA 5K4ZA 5D8WA 4NAEB 2A4AA 2XGZA 3H23A 1W2PA 3W7IA 3LI1A 3S83A 3T1GA 1E72M 5CPOA 1O6IA 3N11A 1BVZA 4ACZA 2PWDA 3RF9A 1J93A 3L66A 3B97A 5D38A 2XZ9A 4O10A 2TODA 5HOSA 3VNMA 3T09A 3EPGA 2GWNA 3AOFA 1F3XA 1TELA 3H22A 1Z41A 2OSXA 2V5JA 1XLHA 2Z1BA 4JYDA 2I1OA 1E9LA 1LQ0A 1FWRA 2Y8UA 4Q4MA 2OQHA 3CQIA 1OT2A 5CGTA 2EBNA 2BG5A 1ICSA 3AAMA 3R11A 3BOXA 4DJFA 4DUVA 3A4JA 4GKLA 3H55A 3B9DA 5EBAA 4CEUC 2FMOA 2FGZA 3ZT5A 2WNZA 1UIPA 2B7PA 4RNJA 3L67A 1I75A 1JDDA 3PK7A 5HJLA 2FDMA 3N2BA 1VYPX 4TVCA 1OC6A 3RDKA 4ZFCA 4BQ3A 4IG2B 2BOFX 2BY2A 1ZP4A 4CN4A 4GYPA 3BW4A 3A4WA 4ECRA 3Q4DA 1NDVA 4HTBA 1K9FA 3BZGA 3M5YA 4LPCA 3N2MA 2W7PA 1WXJA 3BWWA 4TVUA 5HWMA 1AZ1A 1I2PA 2WMKA 4Q33A 4EPKA 3HPFA 3TLLA 4KBXA 1ZB5A 2PRMA 4FXSA 3QSTA 1GW9A 4X0VA 3A9BA 4UFHA 3MQTA 3WK2A 4IMFA 3UJSA 4O8RA 4W8AA 3MI6A 3GC5A 3WEMA 5L6UA 4B5SA 3LGDA 1V3HA 3GXPA 2DUZA 1ZJIA 4QLJA 3EWZA 5U7SA 3EA1A 4U33A 2ACQA 1EXPA 1T5AA 1JCXA 3K8LA 3SQMA 1JI2A 4ORIA 3GTIA 1R46A 4MNKA 4R7JA 2DH3A 3T78A 1XRVA 3IRDA 1PIGA 3WKZA 2PWHA 3ZQ9A 1AODA 2J88A 3TR2A 4GFSA 1ZUAX 4H19A 1FBAA 3JS3A 1GOXA 1S5NA 2F6KA 3SUTA 1L6GA 2DZBA 4I90A 3APTA 3O6AA 4AWTA 3VX0A 3AJ7A 4GYKA 4JN7A 1VPQA 4DO7A 4QIUA 3R2GA 5E6YA 2WJZA 2OQLA 1VHNA 1CDGA 2RDUA 3WLHA 2WSPA 4O54A 1GG1A 2HBXA 4AC1X 2FIQA 3V7PA 1TTQA 4GBDA 3EDDA 1FRBA 4RL3A 4AF0A 1BYDA 4PUEA 4OIFA 5T8GA 7REQA 2FKPA 1XINA 3JRKA 2WHMA 2GQ3A 4LS2A 3WBAA 2Z00A 1EYWA 4HOXA 5EMLA 1UD5A 1BRLA 4G6CA 1GVIA 4EXQA 3WZ0E 1ZJHA 2DUAA 2YCKX 4IMGA 1TWZA 4FNPA 4G1NA 1AFSA 1VCGA 1DIDA 4JL2A 3PFRA 3E6EA 3VOIA 1UA3A 3ZMRA 2FMNA 4FO4A 2POTA 2Q8XA 2BX7A 3O3RA 5EMUA 4HYRA 2ADAA 2P8BA 4XVDA 3VI2A 3W74A 1ELSA 1V0MA 3T2OA 1E1CA 3PPCA 4C5ZA 4UTWA 3EPOA 1MNZA 4K39A 3W1RA 1C8YA 1OFEA 4BWLA 2ZBTA 3ELFA 3P84A 5EA9A 5AN7A 3M44A 4F4YA 2V2CA 4J40A 5D03A 5CC7A 2W9AA 2Q3OA 4JNYA 1PDYA 3H2FA 4XVEA 4NIRA 5KT3A 4O15A 3SAZA 3OLDA 4WIWA 7PTDA 2Y89A 2YDQA 3ZZ1A 3M0YA 4WQ6A 3BXWA 3Q58A 2GDVA 2WVVB 3T7VA 2TRSA 3W87A 2VX7A 1EYEA 3PJTA 4JDYA 3HGJA 2TYSA 4YMZA 4CCDA 1E3XA 3LHUA 1K7FA 4B91A 5HNRA 1Q7ZA 3DYOA 5I7GA 4IZGA 6PTDA 4KETA 2HK1A 2ISDA 4PRWA 1RP8A 1WKYA 5BZAA 1EQCA 4H1ZA 4FX8A 4F4RA 3EB2A 1WOBA 3JR2A 3QPZA 1T96A 4DJEC 3NSMA 4DJED 1XWYA 1S97A 2VP8A 4DAIA 1UUOA 3GNXA 4H9MA 5LYRA 1K70A 3RM8A 3H24A 2Z25A 2W67A 1FWIC 3IJ6A 3NXFA 2RAGA 1TZ9A 4AZ5A 1DVJA 1SZFA 3W72A 4HCDA 1EJVC 3GW3A 4JY8A 1W9BM 5BMXA 5G1TA 4PCPA 3EB4A 2Y5JA 4ML4A 1AJ2A 1RK5A 4O1AA 4GC6A 3WJWA 2XTKA 3OA5A 3N3TA 3CXOA 4QE4A 1GVFA 4L80A 1T40A 1XHGA 4ECZA 3T55A 4BI7A 4MJ2A 1O66A 4XKYB 3UCDA 3ZLHA 4EE9A 2VTFA 4GCAA 4KT2A 3GTNA 4M29A 4YWSA 1EJUC 5I6SA 2VC5A 3STGA 2TMDA 3HPXA 1V7YA 1QRQA 1WQ5A 1Q4WA 4TO8A 1HJWA 1Z3NA 4MSSA 3AUJA 4MZ8A 5I3JA 4HN4A 3WH5A 1HN1A 2G96A 1HO4A 3ANYA 4DL7A 1UHVA 4LAZA 1EZWA 2HEJA 3LCHA 2Z1SA 2VCBA 3QTPA 4GI8A 1C93A 1H0GA 1FUYA 4EOUA 4O3PA 5AOUA 3T5KA 4GUGA 1KCKA 3NQBA 5C55A 2R82A 4J9RA 4GVGA 4QWCA 1JXJA 3RILA 1CPUA 5A6TC 4AVOA 1C8VA 2AAAA 3UCQA 3HQ1A 3CL6A 3BAJA 1QHOA 2BGQA 3BQ0A 3KHGA 1A5CA 5FEWA 3T4CA 2VL4A 4JX6A 3I3DA 3GR4A 3R8HA 3ARYA 4YLWA 3O1NA 1UWSA 3LHTA 2PZNA 4TMBA 1BFNA 3FCPA 4GC4A 4WK9A 1S2CA 4QISA 1KXTA 2E6AA 1S0NA 3M0JA 2W8LA 3HF3A 4KFOA 4O3RA 2PC4A 3BOLA 5ABFB 1C9WA 2CKSA 2DPEA 4N0RA 5BU9A 3KLLA 4BI5A 1POJA 2XH4A 4F0KA 3M6YA 1A5SA 1VAHA 4FSAA 2QCCA 4MADA 3QY6A 3PZVA 4IPPA 4J9LA 3T42A 5KFCA 1L2UA 2GYIA 4ERGA 4A3YA 3GH7A 2RGLA 4XAZA 2ZUWA 4DLMA 3GV7B 3NEHA 3DH7A 3V6HA 1VFOA 4M51A 4AU0A 4B4HA 2J79A 4KESA 3T5JA 4CVWA 3AYRA 3GUWA 3LLDA 1JX4A 4IXHA 1VPXA 2V30A 3A13A 2JKEA 1HQTA 4FHAA 3GIMA 1O5KA 4IIDA 2AQVA 5DXYA 1GOIA 1Q85A 3SSZA 4Q8EA 1U1JA 3SUWA 1JF6A 1UH3A 5KFLA 4DYKA 3WBWA 3ZT7A 3MKKA 1W56A 1M1BA 2XVLA 1O68A 3COTA 1PIFA 1ME7A 3FNDA 3K13A 4FOKA 1HP4A 5IBXA 4JTGA 2P8CA 4DB7A 2PZ0A 3G1XA 1AMKA 3LN3A 3KOYA 3DFSA 2X8RA 3FSTA 2EPLX 4GLEA 4C6QA 2XIIA 3TW7A 3PTQA 1XGEA 4ADTA 4JX4A 5FSDC 4ZO8A 1E73M 2NQ9A 1POKA 3LBMA 2R91A 2XCAA 3IARA 4BEQA 4TX8A 1TR9A 4L61A 1VEOA 2EG8A 5DGBA 3CT2A 3L4TA 3WH6A 3NQDA 2VRQA 2CFFA 4Z08A 3QW3A 3O0KA 4L1GA 3A5FA 3PZNA 4E2DA 1HKKA 1VS1A 1TA3A 3T05A 5FL1A 5FJOA 3WQ6A 3QTGA 1AZ2A 3VO0A 3L2IA 1D8WA 1X8FA 2OO0A 3L4WA 1AH4A 3L5AA 3DHUA 4M3PA 1XS2A 2WPBA 1XW8A 4M6UA 5TBOA 3EDJA 1ZBVA 4PBFA 4CQCA 3SCNA 1QNRA 5KT7A 2INFA 2ACUA 1EHNA 4P8UA 4GQRA 4NAFB 4PFMA 1VFTA 1W1IE 3QRHA 5AB3A 3BQ2A 2GFTA 4PA8A 4FLRA 2FPYA 3EPIA 2W9BB 3NM3A 5DCBA 5C9UA 4L6DA 2J8TA 3ALGA 3C4UA 1MQRA 2D0GA 3AWOA 2YBUA 4N9CA 3QGAC 1TUXA 2YFNA 3NM1A 4O53A 4DVOA 5BOOA 2WB5A 5CKSA 1NWTA 3TTQA 4MB1A 1RA5A 4FLQA 4DXXA 4DN1A 3THDA 1W1ZA 3TYAA 3STCA 4RE0A 1A5OC 1JL8A 2O9OA 5B80A 3CO4A 4UMBA 4FS1A 2AMGA 3PUDA 1ZBWA 4DF2A 1M7PA 7XIMA 4LUIA 4H6KA 4IRKA 1K1DA 1V6VA 1XV8A 1E4LA 4S3AA 3WLOA 2R8GA 1DIEA 1NWSA 4ICNA 4E5TA 3OTRA 1JZ4A 2Y4SA 2BXZA 1BWVA 2G8ZA 4CNTA 5JUMA 3A3WA 2E5CA 4C6JA 1J0KA 4MYAA 2XIMA 1P4CA 4DZIA 1KBIA 1TJ1A 1SR0A 5D2XA 4DI8A 3RPTA 2DZAA 4XAPA 4Z2KA 5D04C 3UNDA 4QAWA 5LIXX 3Q65A 4O52A 2F2KA 5HXMA 4D6EA 2QJIA 3BLDA 1TPDA 4Z17A 2Z2AA 1XIEA 5CGQA 3OGSA 4JTLA 1AH0A 3N2TA 1WZKA 4BKNA 1IT8A 3FSUA 3W37A 1GKPA 4AYGA 4LVFA 4DL2A 4RE3A 1XUUA 4X9YA 4PCTA 3MKVA 2CHOA 3I7SA 5FA5A 3EWCA 2HS6A 4L6OA 3I3BA 3KS6A 3APYA 3EX6A 1OGBA 4UCFA 4S3JA 4AHPA 3VOJA 1NWUA 1PCKA 3VM5A 3XISA 3ZJ7A 3OHBA 2QMKA 1GVSA 2D69A 2VGIA 3VPLA 3AC0A 3SGGA 1SO4A 5D02A 4ADSA 1TV7A 1T6MA 3VDGA 1HT6A 2G97A 2CLMA 3MV11 4GIYA 3W7NA 2DQXA 2QVHA 3T9PA 1PVNA 3WELA 3VGGA 4FBTA 1JVNA 1DV7A 4AUBA 5GJNA 3OIXA 3TP4A 4URIA 3SUSA 4I8YA 1GVOA 5CPQA 1P43A 4OOZA 5GNYA 2ATLA 1O5XA 2DZUA 1TZ7A 4NLGA 3NQFA 4JIHA 5XIMA 4JKMA 4IXXA 1F8IA 3S2MA 4GNJA 4GYFA 3PJWA 3M7SA 3WD1A 1E6QM 4UQCA 3BJSA 2DSVA 1NELA 4CQDA 2PWFA 4I9JA 5F7UA 1W9DM 3N6JA 2WBGA 3GDBA 3BW2A 3SW6A 3NVDA 3EB3A 1CGWA 2WKJA 3DBNA 5G4HC 3EX3A 4RPQA 4Z2JA 4PMUA 3ZR5A 4PCFA 1QW9A 1SJBA 3H2CA 3VU2A 4W9TA 2J25A 1UWIA 3GG1A 3H7RA 4GYJA 1WZAA 3EWYA 4O18A 2ZXBA 4FZIA 2C3ZA 3GIYA 1BGAA 3FXYA 3UCCA 3CUFA 3URQA 1UD4A 1X7FA 8CGTA 3QMSA 3UFYA 3HOJA 1WDDA 3DX5A 3GKFA 4FX6M 3E2QA 2NQ5A 4YXGA 4U5KA 2BVTA 2V5DA 2UVRA 2ASDA 1KTCA 2EO7A 1YDVA 2WZIA 3HBLA 4ZODA 1ME8A 2INEA 1J6OA 5JXQA 1VQTA 2BNJA 3UJRA 4PC8A 4JV1A 3PUGA 3KTSA 5JIWA 5JBDA 2XHYA 1W5NA 3W7HA 2DPIA 3SGZA 1XIMA 3TONA 3W00A 3LTPA 1UPMB 2PB1A 2OXNA 1R2TA 4KW2A 1RBAA 4MMWA 3ZWTA 4LNCA 2DW7A 3PP7A 4XZNX 2FLNA 4H9XA 4ED0A 5CCZA 3GG0A 2C71A 1BGGA 1WKDA 4EWJA 1YQ2A 4RDVA 2BQRA 4IM4A 3LSCA 1Y65A 1GOOA 2B4GA 4BFAA 3IACA 4ECSA 5I09A 1CENA 4LUTB 1V0KA 1W1TA 3BV7A 1W31A 4QP0A 3M0ZA 5E93A 1KBKA 3E38A 1WA3A 1J9YA 1E6SM 2P53A 4KWVA 3B0XA 1PZ3A 1UR1A 3CLWA 1XH2A 1YTEA 2NQJA 1PX4A 3MSGA 4U3AA 3W53A 3U3HA 2WC4A 5FESA 1EJTC 3VIKA 3RIKA 4LB4A 4ZFMA 3SUVA 4S3EA 3PJXA 3UPWA 2HTMA 4N42A 4H6RA 2PLJA 1OINA 4N6EA 4GOAA 3U2ZA 3BDKA 5I3FA 3VMPA 2G3MA 3R1ZA 3RAQA 3RMJA 3TWBA 3GNOA 3JUGA 3I3EA 1QFEA 1W3JA 4GVIA 1E9YB 1LF1A 2VD8A 4E2OA 3J7HA 3GHRA 4GNVA 1L8PA 3DXIA 2HPIA 2VO5A 5AZ0A 1JXLA 1GQLA 1OX4B 2HXTA 2VQUA 4HYWA 1AD4A 4HU0A 3TA6A 2JE8A 3GFYA 3O15A 1JIBA 3P5ZA 4PSRA 4LCQA 1KM0A 3PSVA 4S2CA 1H50A 2F7FA 3BLIA 2WV8A 4C7GA 1IV8A 4GD0A 1M01A 4H9VA 1U22A 1EXBA 2X1IA 4GXPA 1SJDA 3II1A 1HNYA 4PUWA 4DF0A 3TNBA 3BG9A 4UTTC 1RR2A 2I5IA 3MU7A 3OZOA 1PZ1A 1JPMA 4ZOEA 4X0NA 3TNOA 2CYGA 3ORWA 2ONEA 3W07A 3OPSA 2VZVA 3PJUA 2Y5SA 5F1VA 4NAEA 2JF6A 3V16A 3WIJA 1WYIA 1Y0EA 3F4DA 3GAYA 3R8GA 1R86A 3W1TA 3FKKA 1W1B1 2PF0A 3GB6A 1QI0A 4D8LA 3RB4A 1S2AA 3CTTA 2OELA 1TR1A 5A6KA 2X2GA 4XBSA 3BZJA 3ICJA 2RJGA 3IJ7A 3KAOA 3VDCA 3VIOA 2E4TA 1EPVA 4YR0A 5FOOA 5JMUA 5KFKA 4F2TA 1IT7A 3L2LA 1WBHA 1IQ8A 4CN1A 1QBBA 2E1DA 4FS2A 5I5RA 3ITVA 4KGLA 4UFKA 1JRCA 3AHXA 4KCTA 3SM0A 3K8KA 1JG9A 2Z1KA 1GJPA 1EJ7L 3CLMA 4EXBA 2XVNA 1OFAA 1IM4A 4IOTA 3GBDA 3VGBA 3W73A 3KBNA 2WC3A 1JR1A 4CD7A 2GSJA 5J5RA 3CQ0A 3L0GA 1R3TA 2AKZA 4PE8A 3DC8A 2Q3RA 2BOEX 5HAOA 5HINA 2V5CA 2WLZA 5DT5A 4R8UB 4FEZA 2ZX8A 1TV2A 1ZTVA 2PBOA 4PMNA 4O3SA 1KKOA 3WBXA 1VBHA 4GZIA 4JOMA 4QNEA 1E6XM 1C8QA 3FKRA 5HMFA 3GH4A 3I4EA 3T5HA 4JX5A 4Q45A 4L1XA 3DECA 4XAFA 2WKGA 5DMMA 3V0UA 3RRAA 4C6DA 1FKWA 2BQUA 3NG3A 2DUXA 1P0NA 5HANA 4JPGA 2CZ5A 1UR2A 3W71A 3CK5A 5EMMA 3LCLA 2VDGA 4BJHA 1S2WA 2BP1A 1G7UA 5FEXA 1KQYA 1Y5VA 2AL1A 1N8IA 3BARA 5AYIA 4GY7A 1R3YA 5D2YA 3VCNA 4HGXA 3I4KA 1R3VA 1XLAA 3RX2A 2QUMA 1RHCA 3W1UA 5ABGA 1IGSA 3U4FA 4I9TA 2WJEA 3NEVA 4W7VA 4MGGA 2WAGA 1M53A 4FF5A 5BWFA 4Q8TA 2AU0A 5D33A 2FH6A 4R33A 1AW2A 1WDWA 4PTVA 1VIWA 1O1ZA 5A8PA 4UTUA 4ZOAA 4BQ2A 1I0BA 4EBCA 2CLKA 1E1EA 3ECQA 1OWQA 4IR9A 2XJ7A 2V2HA 3K1DA 1JDCA 4LOCA 4JKLA 2ZUMA 1UZDA 2VR4A 3GH5A 3PZUA 4IGHA 3SCUA 3DAQA 3TA9A 2JEJA 3W7LA 3NAVA 5JH2A 4HNUA 2NVAA 2J7EA 2EPHA 3F03K 3URNA 3ANVA 3PR2A 5KT4A 2VJXA 4Q6XA 5KETA 1Q6QA 1V5XA 2BVYA 4ZCWA 1BPLB 3H53A 3MO7A 5FIPA 3VCCA 4A8NA 3AWNA 3KL3A 5KINA 2ZICA 1I8JA 3QV9A 4MKVA 1OGGA 2BV9A 1PUDA 2FTWA 2V69A 3A5VA 4XB3A 3RLGA 3HN3A 5AVHA 5T26A 4A21A 3XINA 2VCAA 1XLKA 4H8NA 2YXXA 1Q6LA 3A4XA 1A80A 4JEJA 3QZEA 1W1PA 1NH6A 3QGVA 2WZHA 3N13A 3TEVA 3Q45A 3OQEA 1S38A 1KFLA 5BROA 3P3BA 1CGTA 1ZPTA 1X6UA 5A6BD 3N34A 4XZWA 3SO7A 4MWAB 3UXLA 3E0IA 3B8VA 3OZPA 3QR0A 5IOBA 4LCRA 3UYIA 1I1WA 1TTIA 1M5WA 4JR5A 4DYEA 2YB4A 3F7JA 3LCFA 1UD8A 3AICA 1W9UA 4C1KA 4XZIA 4IIBA 3QV7A 4N2YA 3W2LA 2H3DA 5C9XA 1EDQA 3F1QA 4JTJA 4HA0A 1J5SA 2YZ5A 2BODX 2QAFA 1KRAC 5AYXA 1DE6A 3S0CA 3DENA 2ATSA 3STEA 4A4AA 3ME3A 4WCJA 3BW3A 2UVUA 3CPUA 4MWAE 2H8ZA 4NX0A 4RW3A 1EOMA 4M5PA 1RY8A 4HHHA 2WVVA 2JEFA 4TTGA 3MR6A 4MJ4A 3MFIA 1N82A 1MRQA 4C7DA 1NP2A 1NAL1 3CHVA 1XC4A 5D05A 4HCHA 5I00A 3VIPA 1JCJA 2VR5A 3A64A 3PWAA 4MF4A 2RDJA 4FOJA 4UQ9A 3D47A 1ZALA 4RCXA 2YXOA 1OCQA 1F05A 3H2EA 1HL9A 4IRCA 2DSZA 3UWYA 7A3HA 1BG4A 4YR3A 2JALA 1GVEA 1HL8A 4JNZA 4ZXOA 1YX1A 3DI1A 3SCOA 5A2BA 1OFRA 2IXUA 5LKYA 4S3FA 1NF0A 2E9LA 1US2A 2XIQA 2V38A 5TIMA 4ZO9A 4HBKA 5FACA 2IQ0A 2V4QA 4E4PA 1HKWA 1K7EA 1YBQB 3MPGA 5F1UA 4O0QA 4OUIA 1DP0A 2WBKA 5EFFA 3QSRA 2YCIX 3UETA 4RNMA 1XLIA 4GI6A 1XR2A 1VLWA 2XU2A 2VFEA 4HA1A 1IHIA 2QW5A 1TVPA 1ZZMA 3RR1A 5JQ9A 4Y9AA 2XFWA 4XKYA 3TYZA 2PDIA 4RNFA 4YS1A 3D5HA 4HJFA 3OYZA 4K1WA 1FWNA 3G6VA 2IUZA 3OG2A 2HBVA 9XIAA 3M0VA 4EP8C 1ZAJA 3SADA 3VX1A 1NSJA 4ZQPA 2GUYA 1LRNA 2PTDA 3W27A 1YKWA 3TK7A 1EF2A 1XGZA 3WUFA 2IBKA 2Q02A 1J0YA 2E5BA 2OTDA 1EGZA 3CAWA 2YB1A 2C91A 3O63A 1DJWA 1XSJA 4PTDA 3PUEA 1S2UA 1XLBA 1JQXA 3GAKA 4QWAA 3LBOA 4M1BA 4GACA 3TXZA 1Z44A 3RCNA 4PGLA 4K1GA 3QHNA 4LFYA 3BURA 2QPXA 4JKKA 5D30A 1IF2A 5HUPA 3VGHA 3UR8A 4P5UA 3ABSA 3KHHA 4GQ0A 1EEXA 1TRDA 4HKPA 4ED6A 1B9BA 2J74A 1E5NA 1RCOB 3C8FA 1IIHA 4W5ZA 5K9XA 1LM1A 5KFBA 2JEPA 1UWRA 2FDSA 2YR1A 4RR4A 4RUCA 2BWGA 5LHEA 3TXVA 5ABFA 4QTGA 3P5YA 3ABOA 3L0NA 2ZX7A 4XZLX 2BR0A 3NYDA 1QW7A 4OBRA 1ZETA 2J13A 4MM1A 4F3HA 2OLHA 3GIQA 5EYWA 1BTCA 1PYMA 2J8FA 2ASLA 1P1XA 2PTXA 3VIIA 4WGHA 3U6WA 4Q8WA 3SRFA 4DNHA 4W7UA 4WOZA 5FJRA 2P0OA 3ZJKA 4NJJA 1FDYA 3ARWA 2DVXA 3KL0A 1N48A 1H1YA 1OADA 4AWSA 1H7XA 3P93A 4UR9A 2OLSA 4MPQA 1NQKA 4K6AA 5IHRA 3W1XA 3NDYA 3AZRA 1QUMA 2Y62A 2GGIA 1UASA 5G4EA 1OHLA 2G3FA 1KQZA 3F5JA 1G6CA 3M9NB 4GO8A 3IK2A 3GVRA 3SBFA 3W2JA 4HVXA 1A5KC 3LZ5A 3PF3A 1EX1A 2C7FA 4ZSTA 5KSWA 1Q8JA 4D6GA 4ZO6A 1NOFA 3LV5A 3ZSSA 3L9CA 4WD0A 1UMLA 1I2QA 5EB8A 3CZGA 1B3YA 2H8XA 3S5NA 5HJYA 1K9EA 3VNIA 3LU2A 5I03A 2NUXA 5D9PA 1DWJM 3TMQA 2FFCA 1F3TA 4HK5A 3MCNA 3T0AA 1I4NA 4NJKA 3WQPA 3L0KA 4HD5A 2QUNA 2ZRXA 3NIYA 5BCAA 2E9BA 2JBMA 1MDRA 1XIIA 3KCOA 3LA4A 1V3KA 2CEQA 3R4IA 1W9XA 4X9SA 3MR2A 4QE1A 3C2EA 3AHYA 1B3XA 3C2FA 3FFSA 5KFAA 4ED1A 1DJQA 2NT1A 4Q4QA 1K8ZA 4QDMA 4WY0B 5FJUA 1FCUA 1VBGA 1DPMA 4IUGA 1QHZA 3C0SA 2PDUA 2P76A 4LAUA 1J79A 1WDSA 2UBPC 1HO1A 1FWAC 2W92A 3WQWA 2J6SA 4LAKA 1S1RA 3VZXA 2PE4A 3PUOA 4Q7NA 3W26A 4YTRA 2GPTA 1YIXA 4DBWA 4NAFA 4QRNA 1UUMA 3RN6A 3BG3A 2J24A 4J27A 3IJIA 3B03A 4M7TA 1C9DA 1KNWA 3GVWA 2PDNA 1FWGC 1X38A 1DQXA 3L12A 4LX4A 4AX6A 4HNCA 5FF7A 3QYSA 1JF5A 3U57A 3C61A 2X7WA 3P67A 2H90A 4C91A 5AC7A 3N4EA 3WN6A 2A2IA 3F4NA 3TSBA 2CXGA 2ZE0A 2HQAA 4AWUA 1EZ2A 4O8AA 1UKOA 3DC0A 3FYOA 5K9CA 3E49A 3W4RA 2BS9A 3HG3A 4G3IA 2WVUA 5H8UA 3ZFHA 2Z2BA 1T0OA 4O1CA 3BAKA 1XQKA 4V1YA 4IQJA 2WSQA 4HU8A 3IK4A 3S47A 4NZ1A 3H7UA 4S3KA 1KFJA 3ARUA 3M41A 3W7PA 2OWCA 3UW6A 4UQAA 4DO4A 3EGJA 3UBPC 4RK8A 4Y9NA 1ITXA 4K68A 1YNPA 4PUJA 1BWLA 4A3UA 1J01A 2MANA 1GYNA 4MNMA 3HG5A 2VC7A 4YJ5A 4JQ2A 5KFIA 2CU0A 2VVNA 3CYJA 2VNCA 3G1VA 4RV8A 4BS0A 3KWXA 1UB3A 3K8MA 4B5WA 2JFEX 2OKTA 4K37A 3TQKA 3RHGA 4CNUA 2NVDA 4GPNA 1CX9A 1QCWA 5DQIA 4HOWA 3QPEA 1R7AA 4DZAA 2FB3A 3SB0A 5AC8A 5E6ZA 1Z6KA 3K46A 4MYXA 1LOLA 4AZCB 2V5BA 2OB3A 4QWBA 1XGDA 3AXKA 3HJEA 3M0HA 4I9AA 4LEFA 1OX6A 5A6SA 2Y6ZA 4DUWA 4J3TA 3M0XA 3W25A 3VOHA 2DY3A 3WFZA 2E3ZA 1VPYA 2J78A 3EPMA 2Z6JA 1OYBA 5F4SA 1DWIM 1CLKA 2JKAA 4LV4A 1W6TA 1DKWA 1M7XA 1UA7A 1ISZA 2YYTA 3BAWA 1ZQ5A 1PBGA 1QU4A 1MFVA 2XYLA 4CU7A 3K4WA 4B3ZA 1PXGA 2ZTJA 3MR3A 2HZGA 2IKIA 4KEMA 3SQLA 2ZRVA 4U28A 1MQPA 3VNZA 3MUZ1 2YDRA 5CJ5A 1Q66A 1DWAM 1LWIA 1E1CB 4N7QA 4O4VA 3WCZA 1UQYA 3QZAA 1F3EA 1GPFA 3KL5A 1AQHA 3LNPA 4IGMA 3OA3A 4B2DA 1ENUA 2UY4A 1HF6A 1VF8A 4HA4A 1TPWA 2PU0A 1TZZA 1LUCB 3C86A 4BZYA 5FD0A 1YNYA 1RUSA 3D0CA 2IPGA 6ENLA 4J9SA 3CAKA 3AXXA 3TW6A 3MJMA 3GXNA 4IISA 4DJFC 3KVMA 3W7RA 4DJFD 3KS5A 2JEGA 1S39A 3OVRA 4ZVJA 1B31A 3N9SA 4OV9A 5FI8A 4GY1A 4WOQA 1H09A 4XK2A 5I3GA 3HG4A 4ECUA 5DO8A 2NXGA 2BXYA 2GOKA 5KG2A 2NWSA 3B8UA 3ZT6A 3DHDA 1ZP3A 4W87A 4N4QA 5C9WA 1T8QA 1BEUA 4OZOA 1EIXA 5ECVA 3IV8A 2YIHA 3GKAA 3R6IA 2P1FA 4GYPC 4HTYA 4JCMA 2ABAA 3PM6A 4O28A 3FHQA 3NQVA 1SFSA 3F5LA 3N4AA 1DWHM 4XG1A 4O3NA 2ATMA 1MDLA 3NGFA 1DJIA 4J3SA 3MV01 2ZZ7A 5HUOA 2Z7KA 5A6AA 1VYRA 2YCEA 2IKGA 2RUSA 4IT1A 4LYQA 3B8WA 3VKKA 2A7NA 2DT2A 1OSEA 3WFLA 3OQ8A 4EXAA 1YW1A 2TSYA 1CXFA 3T0TA 3GLCA 3EKZA 1A5UA 2YX0A 4J3UA 1AJ0A 1FVPA 3GNRA 2OT1A 1S5TA 1V6YA 1BG9A 1BYAA 3SCVA 6XIMA 3LZ3A 5E9AA 4BA0A 3O0FA 4C1NB 2XGIA 1DQUA 3C3UA 3LTYA 2ANUA 5CZ0A 1SJCA 2C2DA 5C54A 3TFCA 1K1QA 3N6HA 3UA4A 4LF2A 2JK2A 2PDKA 2ZC1A 4LUTA 5M5DA 2OOFA 3W7JA 5EU9A 4PMDA 2W7OA 2J66A 3CV7A 2QCFA 3GDKA 3H4GA 3KHJA 1JDFA 5E09A 1U2YA 4UWMA 1TVLA 1ZSXA 1FHDA 2EG7A 3LPFA 4LYPA 2PWEA 3TJIA 1RQEA 4MLJA 1GK8A 2WYSA 4QG6A 5D9MA 3M9YA 4LAMA 4FXRA 5CC3A 1ISVA 1E71M 3HGSA 4NSBA 5BXTA 1JNDA 3M0LA 2GOUA 1AW1A 3Q8SB 2J7HA 3T08A 3PZIA 3NFUA 3EWUA 4LSBA 3ARRA 3NZGA 4PL2A 1XKYA 3KP0A 2W27A 2DQWA 1GVRA 2IPWA 1DXIA 3NQAA 4QBXA 1UWQA 4F40A 4MY1A 4NT0A 3ZIZA 5KFSA 2C16A 2PCEA 3MDWA 4JS3A 3MSDA 3USZA 1SYTA 1RH9A 3O7UA 2F2HA 4HNTA 3S1GA 1QBAA 2DIEA 3N3MA 4CD4A 4H8UA 1OX4A 4Z1AA 2R1MA 1NOUA 3GG7A 3MCMA 4C6LA 3F2DA 1A50A 2C28A 1S1PA 3VMOA 3WDQA 4D6CA 3ARQA 4L4OA 4OGZA 2PDHA 4PR4A 2D73A 1CXKA 3SY5A 3NQ7A 1P0DA 5DBTA 3MSYA 4LWWA 4JYEA 4U10A 6ALDA 3MS8A 3TROA 2XG9A 3DG3A 3T5LA 2VRKA 5D37A 4C6BA 4AIOA 4UTWC 3QR3A 4IIGA 1GHRA 3BGJA 2O92A 2I5QA 4ZB2A 3QH2A 3R58A 1LYXA 4GZEA 3ZLFA 2V2DA 1E1FA 5DFAA 1AUSL 4TV6A 1TQXA 2Q71A 4IJCA 2R1KA 2P3ZA 3PB2A 4M8UA 2HXUA 4MDPA 4DNMA 1TE6A 2C6QA 4ML9A 4AG0A 4QWDA 3CZKA 3AO0A 3F5KA 4UTIA 3AHZA 1KGWA 1QNVA 1MZHA 4P8VA 2WQDA 4LUSB 5I77A 3SN0A 5U4NA 3B05A 4DELA 2XWEA 4PRRA 1HJUA 3GU1A 1LTDA 4PB3A 1YPXA 1UKPA 4QS5A 3R43A 3ITTA 2NLYA 3W7DA 3UGRA 3I68A 5C9RA 4LAOA 3O6YX 4JQ4A 1JPDX 1UH4A 4GA8A 1GJUA 2YYUA 3EX1A 2VC6A 2GSEA 4F4XA 3BPWA 4YTSA 2O7SA 3DHPA 1H7OA 3NQMA 3B9NA 4ASTA 2E68A 3FGCB 4D6JA 4CLMA 1XL9A 3NQ8A 3ZWSA 1FWDC 4QM1A 4HZ7A 3QY7A 3OGVA 4V2XA 1T7LA 3WNOA 3FXGA 2DZTA 4TOQA 1NDYA 3CZJA 1F76A 2XIJA 4MB4A 1XLJA 3S6OA 3UY8A 3LCXA 3S9YA 3EMZA 1GGOA 2W9MA 5ABHA 4JY9A 2VFFA 4R8UA 3EKLA 3TYDA 5CAKA 2E09A 3EOLA 3C0LA 2G50A 5FJJA 3B3DA 4K8EA 2FVLA 1YXDA 4IQDA 2FGBA 2RFGA 4XD4A 4BR1A 1H60A 3ID7A 1D2KA 2RGMA 1CEOA 4L7ZA 5C9ZA 4DQWA 3GXIA 1GONA 1ODZA 3V18A 2OPJA 3ES8A 4LEQA 3UYCA 3G1YA 4REQB 2VFIA 1H5YA 3GK0A 3MW7A 4RDZA 4RXGA 3O06A 4KERA 1E0VA 5BWAA 3GIJA 5KG4A 2J47A 1NFPA 3MZ2A 5I78A 4HU3A 1MW1A 2J6UA 2CZDA 2XZ7A 1CECA 5KFRA 3NQEA 1J0JA 4UQEA 3EXSA 4DWSB 3H6OA 3AIUA 3W2MA 1E4NA 3SCPA 3D3FA 1E6ZA 1IIGA 1UR3M 3ERPA 3OHMB 4AWEA 1KXHA 3HFYA 1O94A 2PWVA 5K7JA 5LXEA 2J7GA 2BASA 3DN5A 4S3DA 4I6KA 4DO5A 4NJIA 1ECEA 1DJZA 3GVGA 1UYQA 3AMGA 2ISVA 2ZRUA 2VYOA 2D23A 3BMXA 3T44A 2CITA 1RBOB 3HA1A 4J9QA 5ENLA 3LUTA 2GK1B 2WWCA 5DG8A 1S2TA 2J27A 3WEZA 5KZMA 2BXVA 4JTDA 2VGGA 2D2GA 5LA0A 1NQ6A 5C5JA 2CBJA 2E28A 2XGBA 4H7VA 3P0WA 2I17A 2NX1A 4DHGA 3DKJA 4XV0A 4NX5A 3TH6A 2X16A 1VCFA 3W6LA 1EA0A 3QV8A 1OYAA 5CLTA 1LG2A 3UXKA 1A4MA 4F9JA 4XWUA 2PGFA 3CTLA 2Y24A 4KS0A 4UQBA 5K2ZA 4L9XA 2YSWA 4J9JA 3T0BA 5L1LA 3HTWA 1Z69A 2Y2WA 3MVIA 2ZUNA 3H21A 4YTQA 2QT3A 2IXVA 1X98A 4NP7A 2YCLB 3WJSA 2R8JA 1PYFA 4TQSA 2BVWA 1BKHA 2DW6A 3RU8X 3C0JA 3LGGA 4QNWA 5BMWA 2E67A 4MWAA 4ZBCA 4D6IA 2B0MA 2E77A 2XGPA 1TV3A 1SW0A 3IUIA 3LRMA 1F8MA 4NZ5A 4OQVA 2ZXQA 1QOXA 1UOZA 4GY0A 2C79A 4K36A 4AD4A 1LLWA 3P7YA 3W70A 2PRHA 3DFNA 5J8LA 3OBEA 5IBXC 2J7BA 4GUIA 4JTFA 5T9CE 2HROA 3GY1A 3GXFA 3S5OA 4A8RA 1FHVA 1GVYA 5I02A 1MI3A 1RD5A 4J4KA 4DRSA 4Q8UA 2EEXA 5IHSA 1J2BA 4KRZA 1OBAA 1PHQA 3DG6A 1OYCA 2WVSA 3K30A 1B0IA 3NOYA 5BYWA 5KG6A 2ZXDA 1VENA 4DL5A 4IPIA 4C6KA 4EYHB 3L21A 3OLIA 3M64A 2P0IA 2WOQA 1KTNA 4DEFA 2NSXA 2VVSA 2NXHA 3QM3A 2X1SA 2D2HA 1G69A 1K3UA 1F5ZA 2OWWA 2BGNE 3W7GA 1TJRA 5KFOA 3TN6A 2P3EA 1S0MA 2ZCGA 2HRWA 5L1JA 1SM9A 2FJKA 3B06A 3VVGA 1K8CA 3THCA 2D0HA 3CUJA 3L23A 1WDQA 3SCWA 2B7NA 1OK6A 1KCZA 5LZLA 4ICCX 4ECQA 5H2ZA 1YBQA 2HSAA 3BJTA 4QEEA 5M17A 3M9OB 4CCEA 3KLKA 4GX9A 3KE0A 2JIEA 1HIZA 2I56A 3M0IA 4AZHA 2O9PA 1HTIA 3C2RA 4ERAA 3B8SA 4OE7A 3E9AA 3EDFA 4F0SA 2A0NA 1JGMA 4KCWA 1MO0A 3VIHA 1N8WA 4PUNA 3NSXA 2HNHA 1FHUA 4RU9A 4WDXA 5JH1A 3N04A 3L7RA 3GDLA 4DPQA 4UFLA 1ZHAA 1CB7B 4H2HA 3UY7A 1FH7A 2FGLA 3R89A 4R7WA 3ARTA 2EG6A 2ASHA 3QEZA 3EX2A 4RNOA 1KXQA 3OG3A 3C3NA 3ZXWA 1E4MM 4GE8A 4J3WA 3VOCA 4TMCA 3W85A 5HQMA 4P8XA 2IKJA 4C1LA 3LS9A 3AALA 4RZ6A 5KZEA 4OWGA 4Q7IA 1U5JA 3B40A 1PTGA 2V3EA 4B9YA 1SFLA 3PNZA 4OJYA 3WF3A 2DGAA 5CJNA 3WL0A 1UP0A 3SY8A 3RBDA 1ZJAA 2GGGA 3PPFA 4FLSA 3QW4B 2QXWA 1TCMA 4OT7A 2PA6A 1H0IA 4JFUA 3PWIA 1XYCA 1CW2A 3TX9A 4ACYA 2DZXA 3N9RA 5KFTA 3CL8A 3DYPA 2ZC8A 3VM7A 2FJUB 5KEZA 5DY3A 2GUBA 4LBSA 4GC7A 5E5CA 1QW8A 4E8CA 4NASA 4AZGA 3IS4A 2NZLA 1BQGA 4W93A 1W5PA 1IZJA 4FALA 1JCNA 3LRLA 4GJ1A 3G1SA 4DJDA 2XH0A 1HJQA 1KLYA 2PGWA 3CASA 1S46A 3NSNA 3AISA 4HYVA 5EGRA 1E5JA 1E0XA 1EJWC 4DYJA 2GJNA 3H4DA 1J0HA 1VJIA 2DZWA 3WLIA 5LIYX 5AHMA 4YL2A 2PU1A 2GJRA 2VR2A 2PLKA 1SJAA 2MNRA 1T8XA 4W8BA 1TV4A 5KZ6A 2ZE3A 4GK8A 4B15A 3TCEA 5D32A 4GUHA 3KRSA 4OOUA 3G0SA 4AHQA 1KO0A 1O5RA 3GHSA 3W7MA 5IDZA 1PKNA 1UBSA 3M16A 2POZA 4WSJA 3F2CA 2VQTA 4K38A 5CBJA 1U1HA 3RG6A 2ZTKA 4GXWA 4FNSA 4M82A 1MZRA 4JQ3A 3PC0A 3WLRA 1LL7A 2FHFA 4L9YA 5FJTA 3LCIA 3HQOA 5CEWA 4O3QA 3WK1A 1OIFA 5FEZA 1XBVA 2AOSA 1BTMA 1GZJA 3TKFA 5C7HA 1HW6A 4GISA 4ZL1A 3WF1A 1PEZA 5CGMA 4MJMA 3WDHA 3DFOA 4V28A 2WVTA 2XSAA 1Z7AA 4O1EA 3RGTA 3W1NA 2W8KA 1XFBA 4DY1A 2XVKA 3LDVA 1LT8A 3IJ9A 2OH2A 4YTTA 1VIZA 5T91A 4HCLA 3SEPA 1OG0A 1MQQA 2OLAA 5DELA 3UZJA 4ES4A 1US3A 1VHCA 2INZA 1R2RA 3HURA 1KBJA 3BSMA 3DFTA 3GHUA 5I3DA 5KT5A 4DBEA 3MTWA 2A7PA 2DIJA 2PTYA 2ALZA 5L9XA 1IEXA 3MWCA 1XG4A 3F4WA 2W0UA 3E2RA 1AQ0A 4FNTA 1PS9A 4WY0A 4JHZA 1QNQA 1KV5A 1L6SA 5A5WA 1VR6A 4PMRA 1J0IA 3PW5A 2UZ9A 3ISIX 2R14A 1J6PA 3LPGA 3MUAA 3TAOA 1YYAA 5DRCA 4HIBA 3O8AA 2VMFA 1C7TA 4H7CA 4HN8A 4IL0A 4I9MA 4O16A 5CJMA 3SSJA 3ALFA 3DFQA 5I24A 1LBLA 1CTNA 4E4UA 3GC2A 1EO5A 4KFNA 2NWRA 4QWEA 4Y2WA 5M03A 5KFMA 3P8JA 3ANUA 5D4YA 1SMAA 5G1YA 5E0FA 3RPMA 4AQLA 1GZ1A 3E12A 1UJQA 5DG7A 1GTHA 5HNNA 1EC7A 3R5EA 4G56A 4N6FA 3CHEA 4NQ1A 4ORMA 5DLCA 2C18A 3CV2A 3AIQA 3G6YA 1V08A 5KFVA 2V0TA 3HMCA 3LERA 3WQ5A 2VHLA 3EAUA 2GDQA 1Q45A 4E2BA 4HSOA 3CL7A 2WNQA 1WXZA 3GDRA 5LNRA 3VC6A 4RLIA 1FXQA 4CNPA 2ZZ3A 5LHFA 1FP8A 1WX0A 4NY2A 3S5SA 3HZ3A 3RB3A 4MTVA 4OFCA 2D1ZA 2OX1A 4IGSA 5FJIA 4UCGA 2FHCA 3O9NA 4UTMA 3G1FA 4HYKA 2QCLA 3KEHA 5FF3A 3KXQA 2ZOXA 4AZ6A 2NQZA 3UZXA 1G4SA 2WCAA 3BSGA 4GVFA 2WANA 3KOWA 3BLFA 1VLIA 2CLFA 1KGUA 4NI8A 3S2NA 4QCEA 4I7WA 3ZYZA 4GH1A 1EA9C 3O16A 4S23A 4LY8A 4F0HA 5ABEA 3QQ1A 1QPRA 1VZWA 1JGIA 3ITYA 1LJYA 4IP7A 3V75A 3QYQA 1IWPA 4Y96A 4TQRA 3VC5A 4NZ4A 5CPNA 4ECXA 4X63A 3OZMA 5A2AA 1JULA 2HE8A 5C71A 3N1AA 3I7RA 3DBPA 1YPIA 3BMVA 4AZCA 2FTYA 2CBUA 1C3FA 4M1RA 3RB6A 4G7FA 2OX4A 3WNNA 1M3UA 1GCYA 3WK0A 3UWQA 3HO8A 3GZ3A 3UD6A 1TCDA 2VX5A 3ATYA 3YPIA 5H8MA 4UXDA 3NL2A 3RUBL 4BHYA 4QGCA 3VMNA 5AHNA 4LALA 4Y6GA 2CZVA 4JTAA 4MFEA 3LSBA 3TFXA 4L5ZA 3RCMA 1Z48A 4JN8A 3W22A 2H9AB 3WMSA 1GEHA 1XDJA 4O19A 2VZOA 2CW6A 1FWSA 2XUCA 4V1XA 3KOZA 5TAOA 2A3AA 1A5NC 3GQCA 1AMYA 1VGAA 4XBKA 4B5VA 3P81A 4A3QA 3N14A 1SW3A 4YCOA 1P0EA 4YQWA 1LROA 4L4MA 3UNTA 4D71A 4EPBC 1HFBA 4PODA 1ZAHA 2IA6A 4LT9A 3STFA 1XQLA 6REQA 1AA1B 1JIHA 1N8FA 2PGRA 4HPXA 2WQPA 3QFEA 2OYLA 4GABA 1LUCA 3AMLA 2PD9A 1JPIA 5HWJA 3QR1A 1DOSA 3VNYA 2XH2A 4LXFA 4JTHA 1A0EA 2UY2A 1B3ZA 2GVEA 1FQ0A 4WDUA 3RPDA 1H7RA 2RHGA 4AB4A 2BMBA 3M5VA 4NF7A 3AMCA 3K5XA 1NFBA 4EPEC 3MY9A 3URBA 1G4PA 4AFYA 4Q8VA 3CPRA 3BVJA 1KD0A 1F61A 3WNKA 4KCUA 4YYFA 4LRSA 1S9FA 2A3HA 3VABA 2Z1XA 4PYSA 3RCYA 3WDPP 3BGAA 4RPPA 3WL1A 4HP5A 3WNPA 2V82A 2G41A 3PBGA 1DWFM 3MHGA 1EBHA 3UQNA 1ODUA 5DX7A 3BQ5A 1JYXA 1G94A 3W1PA 2Q01A 1CB2A 4M80A 3C56A 3QGKC 3VKJA 2PWUA 3EMQA 3LHWA 2RDXA 2QHAA 5LA1A 5DRIA 3N19B 1H63A 3IVSA 4Q4KA 3KZSA 3TOPA 1KM1A 4IQEA 2DEPA 3U2OA 2AMXA 2GJXB 3GIIA 4BF9A 3LPPA 3EWBX 3NL6A 5BRBA 3UA3A 1B90A 3FJNA 2O7QA 1VH7A 4RUAA 3UXAA 3WLKX 2ZX6A 3PS7A 3TN3A 5AC5A 1DHKA 5DQPA 3WLSA 4ZSUA 1TWSA 2ZXAA 1MW0A 2X0YA 4C1NA 1QMLA 5G5IA 3VAVA 2PRLA 2QUVA 3MA8A 8XIAA 1RPXA 1XIHA 1VFMA 2EHHA 4B9ZA 3TCSA 9CGTA 1LZOA 1S5WA 3QMTA 4WHBA 3LTSA 1JUEA 1UOKA 1UKSA 5A6LA 1TWWA 2QMJA 1PKLA 3BCFA 4F2UA 5A8GA 3LXCA 3D46A 1HKVA 1REQB 4ADUA 3IVTA 2YL9A 1MEHA 1QI4A 2D22A 4ED3A 1C92A 4LC6A 1PB0A 3WFAA 4IJBA 1IZCA 3AIVA 2ZWZA 1E43A 1UJPA 5BU6A 3TJ4A 2W5FA 3L65A 1WV2A 2NLIA 3I6RA 4PL1A 1H49A 3UG5A 2O56A 2OZ8A 5AC4A 1SZEA 3KX6A 2VEGA 3SRHA 1KXVA 3UWEA 2J4GA 3RITA 1F4HA 1K4HA 1TMHA 4I5XA 4Q8FA 5FF4A 4EACA 3KFTA 1MVYA 3LQLA 2CERA 4UMAA 4P7QA 1M7JA 1Q7MA 5IM51 2QJNA 1SQ7A 3RLHA 3W1AA 1IE7C 1XCFA 3EOEA 1QVBA 2V68A 3PW2A 3OBKA 1S3TC 4C6MA 4HOZA 3ZLGA 4YHGA 1QATA 1B1YA 2QIIA 5L9FA 2LLEA 2A5HA 1F2JA 1ZBCA 1XLCA 1ITCA 3CAQA 1XF0A 1XIJA 3HV8A 4ZTYA 2NV1A 1OEPA 4HA3A 3AMDA 3FJ4A 3NL3A 4PTXA 3TJXA 4IX2A 5A8NA 1RZMA 3C8NA 5H1WA 2DJLA 1GORA 1YDNA 1TV5A 5KFYA 4GFIA 3M7WA 1QXLA 2AGTA 2Y8VA 5AHEA 2KZHA 1SO5A 1G0CA 2QR6A 1EGVA 1GT8A 2OU4A 5CPMA 1SZRA 4XSLA 4ZMGA 5A2CA 1C7SA 5KFUA 1PZ2A 3KZPA 5A6MA 3LD5A 1VFSA 4XZMX 3L4UA 4FIRA 4LUSA 1PKMA 2G5WA 1W3LA 2A79A 3HQNA 4HK6A 3VE7A 3NA8A 1ME9A 1JFXA 3NNTA 2WJFA 3T0DA 5F4XA 2FLIA 4HJWA 4L56A 2F8QA 2ZFAA 2QDDA 3NOEA 2R8HA 2OODA 2BOGX 1MXGA 3NPVA 5EY5A 2ZX9A 1RY0A 2E40A 4Z2GA 4DUXA 2EAWA 1X1NA 5C5YA 5HR7A 1GWJA 4WR3A 1W3KA 1AK5A 1I2OA 4UZUA 3V36A 2B7OA 3PHAA 4MNLA 2YJQA 1UR0A 3G0UA 5AECA 1I2RA 3VIMA 1YADA 3MHUA 2FZMA 4NU7A 4Z1YA 2IS7A 3FGCA 3LG3A 3ENLA 5I79A 2O4MA 3UG4A 3VZYA 3WG6A 2CCRA 3VUSA 2VD9A 3WD0A 4A6GA 4Q8PA 4A8IA 1RLDA 1ADDA 4NILA 1JI1A 5A3HA 1JYNA 5FF0A 3CNYA 4DM1A 1ICQA 3BTNA 1YNQA 3C2YA 3GVVA 2RDWA 4IPNB 3HMJG 3R7MA 5D09A 1U1UA 2ISWA 3T6CA 1SGJA 2EXOA 1JZ8A 1VJZA 1B3WA 4JCLA 4UUIA 3S2JA 3KOXA 2J7CA 3WJXA 1ZJBA 1O4UA 4MKSA 3W29A 4KPLA 4N9EA 5EBUA 2ABBA 3SRDA 3NDZA 4NZ3A 2QYGA 2DT1A 5CPSA 2HWGA 1DHPA 1EX5A 4REQA 3B9AA 3SRKA 3DFHA 3B9EA 4B90A 7CGTA 1QWKA 3VD9A 4A3HA 1XH1A 2BLEA 4GJJA 3W9ZA 1J8VA 4R9XA 5A8QA 4I6VA 1ITQA 4K7YA 4NZJA 2VX6A 2ZZ4A 3KHDA 4JHOA 4TUFA 4WSKA 4JGDA 2WLYA 4NRRA 2UY5A 4TV5A 3WJYA 2ZA3A 4Y8EA 3MT1A 2BQ3A 3WUEA 3EA3A 1OCJA 1JFHA 3L5MA 4DWSA 3ABQA 4JD4A 1FH9A 4GGHA 1BXCA 4DZHA 3O6DA 3S2CA 3A47A 4AIBA 3BL3A 5DLGA 3FA5A 1FOBA 5MKGB 3WQFA 1XIGA 3AXHA 7TAAA 3TQPA 5F2MA 4P7OA 3GWQA 5KITA 2VUYA 3NTYA 4AHOA 3UGVA 4IMAA 2CLEA 3CH0A 3G0XA 1DXEA 5D9NA 2X1RA 4Z2LA 4Z1BA 1C90A 1BVNP 2EQDA 4PCNA 2GK1A 1BF2A 5HATA 2YL5A 1R30A 3VDAA 4OV4A 1OQFA 1HGYA 3S1WA 3UZWA 2ZYFA 4H9UA 3VE9A 3H2MA 3MR5A 4JHMA 3N25A 5C2XA 3GDTA 4NJHA 1CXEA 2Z0IA 2V4RA 3LGEA 4WKHA 3LMZA 3B8DA 2PDPA 3G3DA 1UR9A 2BTMA 2EPNA 3IIPA 2XN0A 1QK2A 4DL4A 3QLLA 3AXIA 1XM3A 3AYSA 4MZ1A 1IEWA 5KFQA 1R3QA 3OJGA 3AHVA 2PLCA 1TIMA 3OO2A 4QQ3A 3THAA 3A21A 1WB0A 2VZUA 2VDHA 3QQ0A 1W2VA 1TX0A 1XYFA 1HVQA 3SCTA 4CNOA 4RUBA 3WF2A 3RO6A 4FMVA 1RYSA 2QEZA 4LBUA 3GFZA 3IGXA 4D72A 4R9OA 5JBFA 4GINA 2GL5A 3RB0A 2YCLA 4MB5A 5TD4A 4GIAA 2ZZ2A 3W24A 3SFKA 1I0DA 1JAEA 1XD0A 4W89A 4J1OA 1O1HA 1U83A 2YL8A 1A3WA 1L6WA 2AGOA 4R3UA 4Q22A 2GDUA 1FHLA 5BRPA 1JQVA 2OZ0A 1EWEA 4AMCA 2JGQA 3B04A 4MUZA 3THUA 5SWUA 2DORA 3M4HA 1ISYA 3P60A 4IP4A 4MFDA 3DOPA 1ISWA 1JZ7A 3SIMA 3MP4A 4GZJA 4X61A 3DUGA 3S6TA 2YA0A 3V6JA 1F6PA 5KTLA 3GTFA 2CNCA 1IXNA 2ISFA 2PDBA 3S4TA 1FWEC 2ESCA 1J2WA 4H04A 4EF8A 3LLFA 1DJNA 1V6TA 3VINA 1MSSA 1AH3A 2EPKX 3VZZA 1QNOA 2WPGA 1KM5A 3TSMA 3JZUA 4U2ZA 2VC9A 1RVGA 3W81A 3OOQA 4O13A 2DSWA 2VFHA 3EXTA 1VC4A 2ZA2A 3QZ7A 1FY6A 4DBDA 4A2SA 2X30A 2R6OA 4HHPA 3BCDA 1PSCA 1V3JA 3EWWA 1J0ZA 3HIJA 2D0FA 1QPKA 3LBCA 2PS2A 3NDOA 4QAIA 4J3ZA 5JU6A 5CSYA 5AHFA 3VKDA 1TO3A 4B16A 2G3NA 8TIMA 4F0MA 4FNRA 2I7GA 4LF1A 3LENA 3VD5A 4RZ5A 4C60A 1IEIA 3RJXA 3F4CA 1U30A 3W83A 1NARA 4AEOA 1DJYA 1SVDA 4MLRA 4MKNA 2C1GA 1G4EA 4AW7A 3AYTA 2QV4A 3H12A 3FS2A 3ITXA 3L4ZA 4IFOA 1A5LC 2EPOA 4KF1A 2J9YA 2PDGA 3EXRA 1ADOA 4J28A 2E7FA 3H4WA 1HVXA 2A1YA 2J6TA 4E38A 1JDEA 3PZPA 1EUAA 3VD3A 4GZ7A 4M0XA 4LW7A 3U0HA 2GJLA 2YL6A 4O12A 2ZRYA 6A3HA 3VKAA 1YTKA 3RLVA 2WJDA 3FV9A 1JZ3A 2C19A 3SUUA 4UNIA 2C1IA 3OODA 1FKXA 1E0UA 2YBTA 4L4PA 1FTXA 2V5KA 4C6IA 3T2QA 4WVXA 4IJRA 4KKXA 3LHVA 1LQ2A 1JZ6A 4EEYA 5DMLA 4DBSA 4C90A 1OCNA 5LGZA 3GZAA 4DL3A 3R0KA 5F2GA 2YW3A 1XLLA 3TV8A 3TDFA 2VCCA 4FF7A 5C6MA 1R38A 3JZEA 2WWDA 1TRIA 3FJLA 3BLPX 1PL9A 2WSKA 3N29A 4JTRA 1F3WA 4KIRA 3U5UA 3QZ6A 1WUFA 2GGJA 1YDOA 5G2IA 4ZO7A 4JFTA 1C8XA 3BJFA 4LYRA 3AIWA 2QF7A 3PW7A 1TWDA 4WKAA 1KV8A 2NSOA 3FVMA 4NYUA 2X40A 2CC0A 1W1YA 1LWJA 4CN6A 1TPVA 2OJPA 1NY1A 3O6CA 4IRDA 1UQZA 3R12A 4UOZA 1SMDA 2FZ8A 4FX7A 2B81A 2YFOA 4MPKA 3FA3A 4GQBA 1QOPA 4GG9A 2J8GA 2XFYA 4D9PA 4WDTA 4UR8A 3VD4A 4ECYA 4K3ZA 2OFJA 4GUFA 4D6DA 4CQ9A 3QPYA 1HG3A 2QGYA 4CUCA 1GEQA 3FEMA 1P6BA 5DY2A 1KFWA 2EGZA 1M04A 4D1JA 1KC7A 4DO6A 2PDXA 4IUOA 4EBDA 1M03A 1R3SA 1ALDA 5I06A 1UD3A 3AIBA 3JW7A 5DQGA 1TIWA 5CXPA 3TVAA 1CLXA 2X42A 2Z1VA 4L9ZA 1J4EA 4Z0JA 4AVNA 1US0A 4AZBA 5BW6A 1U5HA 3USBA 4P61A 4KWUA 4JTTA 1K03A 4AY1A 1NTHA 4B2DD 3GR8A 3VIGA 1XDMA 3POCA 4HSHA 3HB9A 4UTLA 4UB9A 4J7RA 3CUIA 3AQUA 3EYPA 5LXXA 3MYOA 1TFVA 4RE2A 2PWGA 3P0XA 4H2CA 1QPNA 2DU2A 2D3LA 1AW5A 5CBIA 1DYSA 3PZQA 1TG7A 3CMJA 4UNLA 4DF1A 2IMRA 3CB8A 4A2RA 4GHRA 3V6KA 4Z1DA 5BXRA 3LLXA 4V15A 4E8DA 5KG5A 4WUIA 3OVQA 5I0DA 3IGHX 4HPGA 1LBMA 3T8QA 5E9XA 2P88A 2PCQA 4JIEA 5CSUA 3PBWA 1U5VA 5FJPA 4PH6A 3WENA 5FCZA 1JEZA 1MMFA 1OB0A 3PZGA 3M0KA 1VFHA 4A35A 2R8WA 4O0KA 1S3HA 1IXPA 1TWIA 1ICPA 3M0MA 1DTUA 3Q8RB 1W17A 2Y7FA 4X22A 3CC1A 3BQ6A 2Z28A 2ZDSA 1Z32X 5HK4A 5KG7A 1E6RA 3IJDA 2CHNA 1YE6A 5BOEA 4K7VA 1Y5WA 4TXEA 5KFEA 4CCZA 1Q6RA 5FEPA 2RDIA 4YPJA 4AH7A 3VK5A 1NP0A 5KFPA 4AD0A 1VBJA 1CYGA 1O12A 3E96A 1LDCA 1OD8A 3T07A 4UIOA 4Y7EA 3PPGA 1KTBA 1X1OA 2BGSA 4WGXA 4YHEA 4NL1A 2JIWA 3OVGA 4I5RA 3EX4A 3LNMA 3OYXA 1Z89A 4JDBA 3EOUA 5BXSA 3A22A 3ITLA 3CV6A 2QCMA 2ZKMX 4MDOA 1E15A 4XD6A 3R10A 2VWSA 3NURA 1BXNA 2OYMA 4ZOBA 5E70A 3UWWA 2VELA 3R13A 2Z26A 4QFUA 3MP5A 2QJJA 3QMRA 3HPAA 4ZOCA 4WXYA 2WMIB 2OGJA 4I5UA 4XX6A 4H00A 1YDYA 1X6LA 2OMAA 1NVMA 1W3TA 1OFDA 2VZTA 2JQXA 2W6RA 4DEZA 1H5VA 4XUYA 1UWTA 2OOGA 3REQA 3SZ8A 4JIIX 3B9OA 4OHQA 5REQB 5HNUA 3V3WA 1OIMA 1WPCA 1QAPA 4QLKA 4JTUA 3AJXA 1DJXA 1E51A 2CBIA 6TIMA 2YPIA 4Q4OA 5KFGA 3O05A 4WJ8A 5KFZA 1XLEA 3VFLA 4G1KA 3ARZA 1HJVA 2QF8A 3BAXA 5TQLA 4PN2A 5F4WA 2QIWA 5I23A 1FWJC 3AS1A 2XVGA 3C6CA 1XBZA 2E6DA 3P74A 3HM7A 1MYRA 1LL4A 5L1IA 4H7ZA 3QBUA 3M5XA 3M46A 2Y5EA 1FWCC 2ISSA 1WAUA 1IXOA 4Q4RA 1F9CA 2I14A 5E0CA 4UZSA 3PFMA 5EKYA 1F07A 1DORA 4FP1A 3VGFA 4EX4A 3W2NA 3IAPA 4MB3A 2WHKA 3BG5A 3MI2A 3AU2A 3ZVHB 3SDOA 1LLOA 3VDHA 3W82A 5DXXA 5AYYA 2D3NA 1Y5XA 4XKMA 2H3BA 2JEQA 1R47A 2WCGA 1BD0A 1W8SA 1B9ZA 5JIPA 2C15A 3C0QA 4KRUA 3CEPA 2HPMA 4KEVA 1LQAA 4GBUA 1LBFA 3NXLA 4N9BA 2GVLA 3IWPA 3GRIA 3QLDA 4FLOA 4ATDA 1ZBKA 2H9AA 2CWXA 1KBLA 2PUZA 2FZDA 5KMYA 5HQLA 1OF6A 3WLNA 1IGWA 4IIFA 2VT0A 3DDMA 3BAIA 2X1UA 2W79A 1QTWA 4WZHA 2DZPA 1FXPA 4PEKA 4OUEA 4M6PA 3BCJA 3CT7A 4YP3A 2HVMA 2WM0A 4FI4A 4QW9A 3BAYA 4MZYA 4XD3A 2PDJA 1TREA 3LXAA 3C2VA 5A69A 2AQWA 2MUCA 1KR1A 1EUNA 1QR7A 3IUDA 3V35A 3ZR6A 2VFGA 1IYXA 3MI3A 4XBJA 1M41A 4LGXA 2XN1A 3CS2A 4DWDA 4KFPA 1A49A 2Z4GA 5GVJA 2QDEA 2ZZ6A 4JTKA 3GNNA 2PP1A 3OLEA 1OD0A 1MXDA 2XFRA 5EPDA 4JUZA 3V5OA 3LMYA 2NUWA 4ZENA 4L64A 3VNKA 1D3CA 2G95A 2GUUA 3AMKA 3WYZA 1OGSA 2V5LA 4JN6A 4M6VA 5K3VA 2Q8LA 2BHZA 3T81A 3WH7A 2UWFA 1UIOA 2GQAA 4GXMA 3A4AA 3NYZA 1UCWA 1EP2A 2FTPA 2DPJA 4ZTXA 2AGQA 1XP3A 1CZ1A 4UMCA 3RXZA 2HDJA 3G22A 1B3OA 2OO6A 3CUXA 1HZYA 3QC3A 2PF8A 3IJ8A 5HULA 2W61A 4BCEA 1I45A 2E8ZA 4ED7A 4OECA 3VXGA 3KWSA 4LUYA 1TE1A 4L65A 4JZ5A 3AROA 2VGFA 3LRKA 4EPDC 2L5HA 3BICA 3M43A 1P1MA 1FCQA 4HK7A 2CLOA 4YCPA 2HVNA 7ODCA 2V63A 5RUBA 3WNLA 3Q8PB 3AHTA 2GJXA 1Z8AA 3WLQA 5KG0A 1KGXA 2PDMA 3D6NA 3WUBA 4WSHA 4AXKA 3MZNA 1Q6CA 2ZIDA 1RLCL 1XKJA 3WQCA 2E9MA 5DCDA 1D7KA 1PHWA 3W88A 1K6AA 1PTAA 2YGYA 1N56A 4Q8QA 2XC9A 1D3HA 1SU5A 5KG3A 4ED8A 2CWNA 1OY0A 2AAMA 1HKMA 1LOSA 2NX3A 3CHDA 2Y70A 1CBGA 1UC5A 3W7OA 1WOAA 2PPGA 4JEQA 4IF2A 4D8ZA 3L68A 3PZTA 5AHLA 2NX9A 2G37A 1REQA 4AX7A 1MWOA 4IHCA 4JV2A 3TQ1A 2QPSA 1R3WA 1Q2RA 1MW2A 2DH2A 1XPGA 3U5YA 4LNYA 3R8RA 1NFGA 1EKOA 1XLMA 2W9CA 3WLPA 1WBJA 2QGHA 1EPXA 3IIXA 3WD3A 3WQOA 4F0LA 1K8XA 4S2BA 1H4PA 3CQJA 1IWBA 1ZU8A 3HGRA 1KRBC 4ZQNA 2WC7A 5EWGA 1W3NA 1QI3A 3PBYA 1EJRC 1HGWA 3NPXA 1MUMA 3TTYA 2VURA 4GCXA 3GV8B 4HU4A 2UVWA 5XINA 3MMUA 1RQHA 1W54A 5CZKA 2QLYA 3SY1A 1TMQA 3GDMA 4YR2A 3Q2DA 5B7ZA 3S9ZA 4M7SA 3APGA 1AJZA 2PP3A 3UF9A 3CO8A 1RSCA 1SO3A 3BK0A 1F73A 4QR6A 3H70A 4UFIA 2XWDA 3A23A 2A3EA 2J6VA 4YU1A 4KGJA 2YZRA 1P0KA 1HKJA 1ZGDA 2O0TA 1WDRA 3MMDA 2YW4A 4ZZ9A 3PZMA 2E5DA 1CWYA 3QZ8A 2REQB 3DCPA 4KEUA 2FYMA 2HK0A 3OIHA 3PTKA 1RPKA 1B2YA 3MUXA 5HMSA 1W91A 2QJHA 1FDJA 4MWAC 3LI0A 4MWAD 1A3XA 1GZGA 2UY3A 3U8GA 4UTHA 4HMNA 3IJLA 2E0PA 3FA4A 2JGYA 2O4QA 4I3GA 3MDUA 2ALDA 3EWDA 4PRTA 2CZEA 3TTSA 1DTNA 1R9XA 2AGPA 3NO3A 1BSIA 2C22A 2XM1A 2A3BA 1Q7QA 3BLKA 2WHLA 3RAXA 2HMCA 2OVLA 3PG9A 4HHLA 3MCOA 3WF4A 3WQ4A 2OKOA 4NKCA 2Y7EA 3MYPA 4ZB0A 4Y9PA 1BHGA 3FOKA 2OG9A 4PMZA 1Q2SA 4LBRA 4IIHA 1H7WA 3RM4A 3VYLA 3NZQA 2XGQA 1LG1A 5KFHA 1R2SA 4RDWA 1W0MA 4JFSA 1P6CA 5A1AA 1FH8A 3KOFA 4RDYA 1SW7A 4JQ1A 3TIMA 2PBGA 2GSHA 1X6NA 4PMVA 3GR7A 1E6NA 2A7RA 4FR6A 2CLIA 3W76A 4M81A 1J12A 3G1RA 3DEQA 1VBUA 4XTDA 2PFHA 2JKPA 1Q3NA 4QDWA 2ZUTA 4LS1A 4JIRA 4MG4A 3SI9A 4UFJA 3GC4A 3GNDA 3KDOA 2DV0A 3CZ8A 3DGBA 3IV3A 3G6LA 3C5QA 3NVTA 2G4JA 2WXDM 3IUHA 1VEMA 4P7RA 3CAVA 3BH4A 3GVQA 1XYBA 1UR8A 2G3IA 3Q8QB 3RR4A 3NZPA 3IIOA 4WJXA 3KTXA 1FWWA 2BB0A 3RLUA 5I2UA 4RZ4A 4K8GA 3A3XA 3S1UA 1D3GA 1R5YA 1RJPA 3UPBA 4US5A 2HJPA 2I16A 3M6DA 3GTHA 4MVAA 2DDXA 3SJ3A 1L9WA 1C29A 3KVKA 4GJIA 3GYEA 1M65A 1VFUA 2PP0A 2Q6ZA 2BY0A 4WF7A 5GJPA 3GV5B 2CPUA 1JZ5A 4FNUA 2RH9A 4E2VA 3P8IA 2SFPA 2E1WA 5CBBA 2P5NA 4WXZA 1XBXA 4C5YA 3OP2A 3PB0A 4E4FA 2XCPA 4AY8A 2C0HA 4DIAA 4UC5A 3K4DA 2RJHA 2W63A 1R9ZA 1V6XA 4M24A 2V9DA 3W23A 1TB3A 3UZYA 2IQDA 3W38A 1YE4A 4XSMA 4W7WA 1V3LA 2X0SA 1IR1A 4J9KA 1VCVA 1UW9A 2FLPA 2XPKA 1YEYA 4QE5A 2VFDA 3FK4A 5MKGA 1ML1A 1H1NA 4D8AA 5KFDA 4HZMA 1V3MA 1GJWA 2HISA 4KQNA 1K6WA 2W3ZA 4Q4PA 3ABRA 3HV9A 4YTUA 3IANA 3JVAA 1EGMA 4G9PA 1F4AA 3VKBA 3U9IA 4AD2A 4CEXC 1P7TB 3HPSA 3WDRA 3NR0A 1UR4A 1GG0A 1HX0A 2J75A 4RX0A 3TWAA 3G77A 4DJDC 4RXFA 4J2PA 2IKHA 3DU0A 3R79A 4DJDD 2OT0A 3VOGA 3PBUA 4Z0SA 3SJNA 1PDZA 1M9HA 3EDKA 1G7VA 4PB5A 1CNVA 4DXKA 2V67A 1F74A 4LV9A 2C13A 2FZBA 3NZ1A 1XRSA 3P2VA 5LIWX 2H6RA 3NGJA 1Q6EA 3L4VA 1W3IA 1EJXC 5EMKA 1GQKA 3FYYA 1F6KA 3E0FA 3W75A 4Y8FA 4Q8NA 3UWVA 4AZIA 4P8WA 3WSUA 4ROPA 3WK3A 3VIJA 4W88A 1S5VA 1V79A 2JEIA 1PAMA 1L2QA 2Y85A 1ITUA 2GGEA 4XZ9A 5IRPA 1YXYA 1H3GA 4LJ3A 1M6JA 1XYAA 3TC3A 2XM2A 3CUHA 2JF7A 2IPJA 3UP8A 5J04A 2WCSA 2XINA 4AZ7A 4LYKA 1RD6A 1HJXA 4OBSA 3LCGA 5C2CA 3VD7A 4NZFA 3EWXA 1S0OA 5BOFA 4QDPA 4Q8OA 1JXKA 3EPNA 1BXBA 4J2MA 5GJMA 2YDSA 6REQB 1X7IA 4I8DA 3FAXA 3PANA 5FAGA 3WX7A 1TTJA 1QK0A 1VJSA 3WLJA 3PWGA 4XIAA 3V0TA 4TX6A 4YVVA 1R9YA 4C65A 1ZFJA 3KTCA 1W5MA 4HNVA 2Z7GA 4B92A 4R88A 2A3LA 3UWUA 1V02E 4ERIA 4W85A 5JVLA 1O5QA 2TPSA 2WNWA 2J62A 1CGUA 1Z9AA 4JICA 1BWKA 1K8YA 2Y7GA 4IX0A 1E70M 4TIMA 4ZGYA 2OEKA 3W1LA 3RRXA 5AYBA 3SURA 3SIZA 3PG8A 1LP6A 4HHMA 2QDGA 4GC3A 1V7AA 3H2AA 4C7FA 1W9PA 4FS9A 1OZQA 3MMTA 3V1HA 1KFKA 1YLVA 2BHYA 2QCEA 1QO5A 4B5TA 4LH8A 1H7NA 3KBJA 2QULA 1RK6A 3PAJA 4O11A 3WQGA 1UD2A 2AL2B 2OEMA 4JTIA 4DLFA 4LB3A 4J3XA 3PNUA 3BLLA 5LNVA 1A47A 4RZRA 2P50A 3T4WA 2DIKA 2A3CA 3PVFA 1ZLPA 1JNEA 1SFTA 4DM2A 1E40A 2XIBA 2A85A 4YVPA 3ONCA 1CXLA 1XDLA 2GGHA 4BF5A 1RYRA 3LV6A 4AD3A 1I6NA 3UESA 5HA7A 4CGTA 3G18A 3O2LA 2OSWA 4NJGA 1IXQA 5CAHA 3EA2A 1EJSC 5D8ZA 3TZNA 4XAGA 3GE7A 2V3FA 1A0DA 5AYZA 3WQ8A 4QEHA 1OJXA 1G67A 4P7NA 4U7CA 3KW3A 4NVTA 4XO6A 4E8GA 1W37A 5AC6A 1UKQA 4DXVA 3U7BA 1OK4A 1J18A 1GVQA 3AXMA 4WY0F 1I1XA 5M3WA 4ZQCA 3VILA 1I2NA 4RZBA 1A3HA 2I5GA 3SN4A 5HJXA 3AUOA 1BKSA 3E3HA 4YNGA 5CC5A 1DBTA 2PDYA 3U48A 5BRQA 4LY4A 1JPHA 3GO2A 4H4IA 1P5BA 1VBRA 5CSRA 2CLHA 4ILSA 1FFQA 4NI3A 3PAOA 4D6FA 2DT3A 3ES7A 1CXIA 3L5LA 2X09A 3AIEA 4GIEA 4AD5A 3LPOA 3CV1A 3TE9A 2O9RA 4TR9A 1OABA 2VEIA 1NEYA 5CH9A 3ZOAA 2ZVRA 4BQ4A 4QXIA 3G1AA 2OZ3A 3RX4A 4G2DA 3KHLA 2QPUA 1OF8A 4IL2A 3LXBA 1JYWA 3CM4A 1KRMA 4CD6A 3H54A 1K9DA 4H83A 1QO2A 2QS8A 3E0LA 2QCDB 4H01A 2B31A 4UTJA 2OGYA 1UD6A 3DFPA 4POCA 2RDTA 3LM3A 4U2YA 1ZS2A 3N4FA 4IPLA 4ZQMA 5D2TA 3LB0A 1DIKA 3ARVA 2XH7A 3HGOA 5FAJA 2VUNA 4UOJA 2W62A 4UQDA 2HS8A 3G3MA 4XD5A 4OBTA 3CUZA 1F6YA 4BWLC 3DESA 4FXJA 2GVYA 4LUJA 3QXBA 4YWIA 5TF0A 1M68A 2DZSA 1E56A 2ZZ5A 4ECLA 1UBPC 3PULA 4WLCA 3GXDA 1QNSA 5I3IA 1DL3A 1K9TA 2W4XA 3TYBA 4D1IA 1O60A 3FYPA 2X05A 2Y8KA 4KH2A 2D24A 1EHAA 2NVCA 2WKLA 2VEFA 2Z29A 5LIUX 2R24A 1R0MA 1R6WA 4CQAA 3WUGA 1PCWA 4J3VA 1Q4NX 1VEPA 4QX4A 1Q5MA 3BANA 1MUWA 3UERA 1V6WA 3AS3A 4A29A 1W32A 1K4GA 4KWOA 5CG7A 5C7VA 3RAOA 2WMGA 4QG8A 3NO5A 3GM8A 1QPOA 3IAQA 3PTDA 3KDNA