1YMYA

Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
382
structure length
376
Chain Sequence
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylglucosamine-6-phosphate deacetylase
publication title Crystal structure of the N-acetylglucosamine-6-phosphate deacetylase from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 115
structure length 376
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.5.1.25: N-acetylglucosamine-6-phosphate deacetylase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1ymyA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ymyA02
4H9VA 4PCPA 1FWBC 4NI8A 2I5GA 4LH8A 4PCNA 3S4TA 3MKVA 1DPMA 3DCPA 4LAMA 3QY8A 4I6KA 1V51A 3QGKC 3E3HA 5FSEC 3PNZA 1V79A 2HPMA 3JZEA 4E3TA 4CQDA 4QS5A 4GX8A 3TN4A 4LANA 2R1KA 4B92A 4HJWA 5AKQA 2Z26A 1EJUC 2R1LA 1J79A 3IRSA 3UR5A 4DLFA 3ITCA 4HA0A 2GWGA 3ORWA 3HPAA 4CNSA 3GU1A 1M7JA 4LEFA 4KETA 2D2JA 4H9UA 3WYZA 4RDVA 4BJHA 2KAUC 1FWFC 1O12A 4KIRA 1FWHC 3QGAC 3OU8A 3URAA 3GIPA 3EWCA 3FDKA 4LCSA 2BB0A 3TNBA 1P6CA 4C6MA 4KQNA 1V4YA 3CJPA 2Z00A 5E5CA 2WM1A 3F4DA 3OJGA 2Q09A 4GXWA 3TN3A 4CQBA 5HMEA 4KEZA 2PLMA 2HBVA 1PTAA 2P9BA 1A5LC 2O4QA 2VM8A 4GK8A 4L6DA 4GX9A 4ZSTA 3E0FA 3IPWA 1KRCC 2Z24A 1A5MC 4QS6A 3S2MA 4DIAA 1EJVC 2DVTA 1YRRA 3OOQA 1EJWC 3DUGA 4F0RA 3S2JA 3LA4A 1P6BA 2D2HA 3URQA 1EJSC 4NG3A 4PBFA 2E25A 4R88A 4C6JA 2QVNA 1RJPA 1QW7A 3D6NA 2HNHA 1WXYA 2P53A 3ICJA 3RN6A 4XD6A 4DO7A 5LXXA 4CEXC 3LS9A 4IGNA 1XGEA 1EJRC 4DYKA 2O4MA 4HK5A 1POJA 1PSCA 1NDZA 4XAYA 4QRNA 3E38A 1K1DA 1KRBC 4LAOA 1P1MA 2Q01A 4L9XA 4RDWA 2PUZA 3LU2A 4H9ZA 4PE8A 4RDZA 2Z28A 4CQCA 3FEQA 4C6CA 3GRIA 4D8LA 2PGRA 2F6KA 1RK6A 3ISIX 3WMLA 1FWAC 3NURA 3PANA 2QS8A 4WGXA 1EZ2A 3E2VA 3K4WA 1E9YB 3O0FA 4ZSUA 1FKWA 4G7EB 1RJQA 3GTHA 4C65A 3QY6A 4QROA 4GY1A 2R1NA 4G2DA 1ONWA 4PBEA 3UBPC 4JOMA 4H01A 1QXLA 3HTWA 1YBQB 1FWJC 3LGGA 1YMYA 1ITQA 3LSBA 1NDYA 4GBDA 4C6LA 4WHBA 2W9MA 4XD4A 4IH3A 4DI8A 3LGDA 1FWGC 3TN5A 1HZYA 3RHGA 4H9TA 4ICMA 3WZ0E 4YIWA 2GWNA 4CEUC 3RYSA 4G7EA 2HPIA 2Z29A 1YNYA 3B40A 1EF2A 4P5UA 4QTGA 2HQAA 1EJTC 3E74A 1ADDA 3MVTA 1NDWA 2FTYA 3IV8A 1A4MA 4DNMA 4EPDC 2EG6A 3GIQA 4GYFA 3RCMA 2FVKA 2QT3A 3T1GA 2FTWA 4Z42C 3NQBA 3KM8A 2AQVA 3DC8A 3CS2A 4H9YA 2PAJA 1FWCC 4J35A 4LAKA 4V1YA 4GC3A 4C6NA 4IGMA 2VC5A 1VFLA 2P50A 3UF9A 5HMDA 2RAGA 4AQLA 4BKNA 4QSFA 3PAOA 3K2GA 4F0LA 1A5KC 3LY0A 4C5YA 4GOAA 1POKA 5CH9A 2R1PA 1UMLA 3IACA 3A4JA 1R9XA 3R0DA 4GZ7A 3F2CA 4H9MA 4ERAA 4HK7A 3A3XA 4C6DA 2Z7GA 3LNPA 4IF2A 3GG7A 3MJMA 4OFCA 3TN6A 3GTIA 1I0DA 3B0YA 3V7PA 4H9XA 4KEUA 4C5ZA 3GTFA 4J2MA 1ITUA 3AUOA 3MTWA 3C86A 3UR2A 4DZIA 3K5XA 3AU6A 2D2GA 1JGMA 3ID7A 4KESA 1IE7C 2UZ9A 2WJEA 4RZBA 3IARA 3G77A 1ONXA 3URNA 4XD5A 2VC7A 3GUWA 4CNTA 2BGNE 2GOKA 2WJDA 3MDWA 2A3LA 1J6OA 1RK5A 4R7WA 4WVXA 2IMRA 3O7UA 2VHLA 1W1IE 1RA0A 1ZZMA 1E9ZB 2FVMA 4RE0A 4DLMA 1J6PA 1EYWA 4IFKB 2OODA 3MDUA 2DVXA 1XWYA 4B90A 4INFA 4DI9A 4UBPC 2EG7A 3URBA 4BY3A 3F4CA 4LALA 3IJ6A 1RA5A 4UB9A 3GU2A 4IFOA 4IQJA 5HMFA 3SFWA 1GKQA 4V1XA 4LCRA 3MSRA 4C6PA 4TQTA 4C6OA 3T8LA 2Y1HA 3A3WA 3UPMA 1J5SA 4XAZA 4KEVA 4DZHA 4LCQA 4I6VA 3HM7A 4IFKA 3S2LA 2OGJA 4IG2B 3MPGA 3GTXA 4LFYA 2XIOA 2OOFA 4M51A 1I0BA 4EP8C 2ZC1A 4NP7A 2Z2AA 1YBQA 1XRTA 2ADAA 4XAGA 3T81A 3AU2A 4C6FA 2GZXA 4GY7A 1EJXC 3GGMA 1UIOA 3GU9A 1WXZA 1M68A 3MVIA 2Z25A 1PO9A 1FKXA 3B0XA 4R85A 2G3FA 2DVUA 4IG2A 4RDYA 3FDGA 1UBPC 1XRFA 1A5OC 1S3TC 3EGJA 1PB0A 3S2NA 4CNUA 3QY7A 2YB4A 2EG8A 2FFIA 3LSCA 1A5NC 2OB3A 3IGHX 4HK6A 2I9UA 1YIXA 1FWDC 2OQLA 3PBMA 1NFGA 4C60A 3SO7A 3BE7A 4EPKA 4ERGA 3NEHA 4F0SA 3OVGA 2YB1A 4EPBC 2ANUA 3F2BA 1RAKA 1R9YA 1BF6A 1V7AA 1GKPA 3OODA 4C6KA 1UIPA 2ICSA 1NDVA 2HBXA 3EWDA 3E0LA 2PGFA 4B91A 1M65A 3N2CA 4C6QA 1KRMA 2YXOA 4C6IA 4IFRA 2UBPC 2CZVA 4XAFA 1R9ZA 4KERA 4GY0A 1GKRA 1A4LA 4J5NA 2R1MA 1O5RA 2YZ5A 4KF1A 4AC7C 3CAKA 2WJFA 1FWIC 5A6TC 4EPEC 2AMXA 2GSEA 3PNUA 4XD3A 1RJRA 1K6WA 4C6BA 2VR2A 2Z4GA 4C6EA 5FSDC 2E1WA 3F2DA 2Z27A 4ERIA 1KRAC 1K70A 1FWEC 2AQOA 2VUNA 5G4HC 4MUPA 1KCXA 2QPXA 4H00A 2Z2BA 1V77A 4B3ZA 3OQEA
chains in the Genus database with same CATH superfamily
5TF0A 3G1XA 4FNPA 2AGPA 3MKVA 3QJAA 5JBFA 2OVLA 4O4WA 4H8NA 4C1KA 4PUWA 4CQDA 4FLOA 4AG0A 4E0CA 3GXIA 1UZ4A 3PZTA 5HNRA 2EPMX 1AZ1A 4E4PA 4FOJA 5E0FA 4L80A 1QNSA 5DFAA 3RRXA 3BGJA 3GVWA 4PCSA 4UQEA 1I8JA 3H4GA 5EMJA 4HYKA 4JYFA 5JU6A 1M7JA 4KETA 3RBDA 2NUYA 1Q4NX 1R3YA 2GUBA 2TAAA 2D22A 5CCZA 5GNXA 4N9EA 5FL1A 2PGEA 4X2RA 1M03A 3RAXA 2R14A 5CLTA 1XLIA 3P93A 1HF6A 7REQA 2QUVA 2QR6A 5HQMA 1TE1A 1U1UA 3ITVA 3LI0A 3N04A 1EPVA 4WKAA 3B4UA 2O4QA 4GX9A 4QP0A 1IEQA 1ICSA 2FLIA 4DIAA 5BXSA 1KD0A 1YRRA 1D7FA 3T55A 1F3TA 1CI1A 2VEGA 4HHHA 1FWWA 3S2JA 1GCYA 4FIRA 4UZSA 4YVVA 2ZZ1A 4TTUA 2UV8G 3PG9A 5AY7A 2V38A 1UKSA 1WXYA 3RN6A 2VR4A 1UWIA 3LBCA 3BMVA 2GSJA 3L4ZA 1XW8A 1JUBA 4O11A 2R24A 1J0ZA 3VZYA 4XAYA 2DW6A 3TONA 3EOOA 1G01A 1PIIA 1JZ3A 3TIMA 4NQ1A 4AD2A 4ADSA 5CJMA 3CO4A 4PE8A 1EL3A 5HBFA 1TPEA 4JS3A 2AAAA 2WZIA 3OG2A 5A95A 3NM3A 3W82A 4E4FA 4Q4RA 4UQDA 4BCEA 2F6KA 3S2CA 3PANA 4D71A 1E51A 4QEEA 3F7JA 1BSLA 1QMLA 1QU4A 3ALGA 3CQJA 4N42A 4E5TA 1AH4A 5H6HA 4QW9A 2PP0A 1YEYA 1X39A 4DUVA 1TTJA 3HJEA 4UZUA 2G4JA 2FB3A 3GDRA 1BF2A 4H6RA 3VILA 4GISA 4NAEB 4PB4A 4C7FA 3AHTA 4O16A 4DUXA 5IBXC 4MHBA 2WNNA 5DCDA 4IH3A 4ZO8A 4LRTA 5RUBA 3VDBA 4OBSA 3WLIA 4DB7A 4ZB0A 1PEZA 3M0VA 1JYVA 4ADUA 3OEXA 1UPPA 3MSDA 2V5JA 1AJ0A 1KLYA 3RFAA 1KXHA 3MBFA 3ZM8A 2AQWA 2YCEA 3EMZA 3OGVA 4Q8NA 2PLJA 3IV8A 4MTVA 1QI0A 2ZX8A 4K8HA 5EFFA 3UA3A 1IWBA 2BVYA 3AHZA 4GJ1A 3QR3A 4Q4OA 1UKPA 4AWTA 2YBUA 2WC4A 4Z42C 3CHDA 4AB4A 2XH7A 3ZVIA 2V0TA 3QHOA 2D0HA 4J35A 2PC4A 4P8VA 2QCNA 3GHTA 3FV9A 1VJSA 2I57A 3W7QA 1G6CA 4J9PA 2ZRZA 1BVZA 2QCDB 1QI2A 1PDYA 3OLDA 1F7BA 1SFJA 2VURA 3J7HA 3CZ8A 4WZHA 4UWMA 1TA3A 2BY2A 2B7PA 2ZA2A 4ERAA 4FXRA 4C6DA 5FJUA 2IUZA 1NY1A 1O1ZA 4HCLA 1KBLA 1KFCA 5D32A 3SN1A 4OUIA 3PZNA 4GUHA 4NZ3A 4UTUA 3F5LA 1KBBA 4Q8UA 3A22A 1KM3A 1OG6A 5FF2A 2ZDSA 2GK1B 2GOKA 2C1IA 1O94A 5I6SA 1E15A 1YXDA 3RCYA 3IUDA 1WZAA 2J6UA 3FHQA 3R0UA 1TWSA 3BG9A 2HS6A 1ZBCA 5LGZA 2FLPA 4AIUA 5E6ZA 1TIWA 4IFKB 2O9OA 3MUXA 3POCA 1CXLA 3D0CA 5AC4A 4HU4A 3V0UA 1W3HA 1W32A 5I78A 5AC8A 4GI9A 4RW5A 4J27A 2VFHA 3N34A 4UQCA 1K8YA 1ZU8A 5U7SA 3B3DA 3MPGA 2C1GA 3L4YA 1VHCA 3GGMA 4FLRA 2V5DA 4PH6A 4N0RA 2YL9A 2BGQA 2VI0A 1FH8A 1GOMA 3W28A 3VKAA 3E9AA 4BQ4A 5AYIA 1Y5VA 2WLZA 2DVUA 1GQJA 1UBPC 1A5OC 4H19A 1K03A 2VA2A 4F4WA 3M7WA 1H62A 4DAIA 4MZ1A 1S0OA 1GG0A 3NZPA 4JHZA 3PPGA 2W9AA 3IGHX 3WDRA 4IP5A 3LCGA 4TUFA 2FZDA 4W9TA 3KBNA 4RV8A 2BTMA 3SO7A 4YTUA 3IN5A 4F50A 4RXGA 4QNWA 3L9CA 2BZNA 2DZXA 3NPWA 2QF7A 3NUKA 3USZA 3TQVA 3N11A 3M0HA 4I8DA 3RO6A 3HQOA 5ABHA 3K8LA 3QV9A 2QF8A 3AUJA 3OIXA 4DQWA 2G41A 5EBAA 4QLJA 4A3HA 3M0YA 2EKCA 3W07A 1KCLA 4NRRA 1A50A 2ZUUA 1OX5A 1FWIC 5A6TC 4YVPA 3UGVA 2PU0A 4IIGA 3AALA 2W0UA 4O1FA 4B5WA 1RD5A 2F38A 4GCAA 4ZE5A 3C0LA 3UYCA 3BICA 3WH8A 1R5YA 3O2LA 1MW1A 4XZLX 2GGEA 1XSKA 3M0KA 3HOJA 1FWEC 4DJDC 2WNZA 5HATA 4P7OA 1YPXA 5DQPA 3U2EA 2I5GA 2Y7FA 2VWTA 1KC7A 3TC6A 3DCPA 1O5QA 4I6KA 4AY7A 4K39A 5CPOA 4QLKA 2YDRA 3W1TA 4Z1YA 2IS7A 3WENA 3MO4A 1BGAA 3SADA 4QS5A 1A47A 1AW5A 1GZ1A 2NLIA 4ATWA 3KVMA 4AY8A 5BWAA 1U22A 2BXYA 2YDQA 4XISA 4TX6A 4KFNA 5DF0A 4HSNA 5BXTA 3BQ2A 2WVSA 4JL2A 4GBUA 5DG7A 1YW1A 2OH2A 1T94A 4YLWA 1OFPA 1JCLA 5E70A 2DQWA 3N18A 1ZENA 5DT5A 3QMTA 1P6WA 3HPZA 2OZ3A 4GQQA 3LLXA 3M0MA 2PDFA 2YL6A 4RR4A 1WYIA 1WV2A 1XL9A 3NL3A 1W5OA 4GD0A 1DVJA 5F4WA 5CSRA 1CLVA 3WLRA 2ZDRA 4PN2A 3SB0A 1EOKA 2VFIA 1OCNA 2ABAA 1CGTA 3OBAA 2OX1A 1EJVC 3IVTA 4C7GA 3N15A 4IMGA 4PR4A 1MQRA 3DUGA 3TQ1A 1C8QA 4A6GA 6XIMA 2CLEA 2C6QA 3ZT7A 3VKJA 5H8MA 3BJSA 1R8LA 3MUCA 2VCBA 3TQPA 1W1B1 4GO8A 3CZGA 3GW0A 4HK5A 3M0XA 4M24A 1S9FA 1ZAHA 2HJPA 4O3QA 3UXIA 4LAOA 3POHA 4IOTA 4LOCA 5I3IA 1MUCA 4DN1A 3LU2A 4H9ZA 7TIMA 4LRSA 3NDOA 3WLKX 1XLLA 4UMAA 3GRIA 3FJ4A 2PDLA 1RK6A 3ITYA 3S47A 1GHSA 3W7DA 4HP5A 3N3TA 5REQA 2PSNA 1E6RA 3RX3A 1OYAA 2A85A 3NCOA 2A7PA 1VCGA 4S2BA 2PP3A 2UVVA 3CV1A 3E02A 3ABSA 1S97A 5E9AA 1E6XM 1HVXA 3N9RA 4HCHA 3H2FA 2R9RA 1I2NA 3W76A 4ICCX 4C6LA 3KCOA 1TZZA 2V9DA 1LOQA 4G7EA 1UUOA 1QHPA 4GFIA 2VFFA 3GLCA 1AMYA 2YIHA 3ZZ1A 3FS2A 4GXMA 4OT7A 1XLFA 4FPSA 1I4NA 2ZIDA 1BWLA 4EPDC 1TCDA 2VZVA 2HV5A 1G5AA 2PEVA 2QV4A 4DWSA 3GK0A 2XINA 3B9DA 5CXPA 3QC0A 1V0LA 1AQHA 3CS2A 4K8GA 3CMGA 1Q66A 4DM1A 4E8CA 3LV5A 4ZOAA 3GB6A 1EF3A 2OYLA 1MRQA 4AZ7A 5HMDA 4GNJA 2RAGA 4JL1A 2CZFA 2AAMA 4HPNA 2YLAA 3SGUA 1ZJIA 4GGBA 1SMDA 4ROQA 3VNKA 2JEJA 2PP1A 3SCUA 1EC9A 3A4JA 4O1AA 4O18A 3I4KA 2FHBA 2PBGA 4RZ6A 4IIHA 4S2CA 4WGHA 3DG3A 1VEMA 4GRSA 1QI5A 4B5VA 5A6LA 2G3MA 2OTDA 3VUPA 2JKAA 5HNNA 3MTWA 4XBJA 3FW6A 3AS1A 1AD4A 5A5WA 4GE8A 2WJEA 1JXKA 3OQ8A 2PDWA 4B16A 2IA6A 3GUWA 5I79A 3EOLA 1ME8A 1LOSA 2KX9A 4NIRA 4CU7A 4UMBA 3TQKA 1SYTA 3KZSA 3C0QA 3VAVA 3VK5A 4DZAA 3OPSA 5KINA 4RZRA 2PDXA 2A0NA 3FSUA 1EYWA 3GIYA 4Y8FA 1WDDA 4LUTB 3EKGA 4ENLA 1PIGA 4B90A 1RLDA 2DT2A 4R7JA 2C8NA 1Z69A 2WO5A 4F2BA 2D3NA 2J24A 1H2JA 1KM1A 3M5VA 2BY1A 1SW7A 1GVRA 3FYPA 3WNLA 1J11A 3A3WA 1GQNA 3F03K 3AS0A 3II1A 1GOQA 2DJLA 1FQ0A 1I0BA 4J3XA 2J79A 2VKZG 2FGBA 4JIEA 4DBSA 3UXDA 1CEOA 4MPQA 2GZXA 1EJXC 4A3YA 1NVMA 1LWIA 5TBOA 3UJFA 1WXZA 1XIIA 2PWHA 2WCAA 3C6CA 4Q8PA 5HANA 3T0CA 4ECLA 1J0JA 3MV11 1ADOA 2BP1A 4FXFA 3AIEA 3GDTA 2VFEA 4OKDA 1ODUA 1JI1A 1JI2A 1PB0A 4Y96A 3VCRA 2E1DA 1JL8A 1JAEA 4CNUA 1TJPA 4NJHA 3UU0A 1BYCA 1M01A 3EA1A 3HG4A 1KM2A 2W67A 3O05A 3ARQA 4H3DA 2WWCA 3BLOA 1SR9A 2QJGA 4MKNA 1YE6A 1LT8A 3V35A 3W73A 4ACYA 1QWKA 2XGIA 3BW2A 4CD4A 4W8BA 3F5JA 3SCSA 1TTQA 3T78A 1LBMA 1R3RA 2DPIA 1V08A 2XIIA 1A4LA 1JD7A 2R1MA 4HZ7A 4MG4A 1QPKA 2WJFA 4DUOA 3IIVA 1Z7AA 1WBJA 4AD1A 4Q8OA 3F5KA 4JX6A 1QPQA 2PDMA 2DIEA 3G6YA 4GJJA 4S3BA 3WLLA 3OSNA 4XIMA 1TSIA 1U5HA 3E5PA 2Y8KA 3AQUA 4FK9A 4LAUA 2HVMA 2W63A 4I7VA 3EX6A 1BSIA 3TTQA 3QR1A 4EKJA 1F74A 1B3OA 1ZB5A 2VGFA 4GH1A 1MRAA 1FWBC 3PB2A 4UCFA 3QHMA 1BXCA 5LA1A 3RR4A 2ODOA 4LAMA 3IGUA 1V51A 4PSPA 4L4MA 3CYJA 4XO6A 1FX6A 3NQAA 3C8NA 4LPCA 1UUMA 3OHMB 2WXDM 4PBGA 4TQSA 2B7OA 1J79A 3IRSA 1VEOA 2FPVA 3NVTA 4KFOA 2YDAA 4QM1A 4JV1A 4LEFA 1TVLA 4RE4A 4UNIA 1ZGDA 5T26A 3AZRA 5BRPA 2GYIA 3WBEA 4POCA 1JCMP 3PBYA 4B4FA 4Z1BA 1AG1O 5E5CA 4S3CA 1P4CA 1K9DA 1JX4A 1M6JA 1LZOA 2ZUNA 2VRJA 4ZSTA 3IPWA 1XXXA 4H6EA 2C15A 2PTZA 3HG5A 1F76A 2JEGA 1RCXB 3PULA 4XG1A 3QMSA 1TMHA 3Q65A 4CEXC 3TSMA 2PCEA 5LHEA 3FAWA 2PDHA 4M82A 2FZNA 5LZLA 3GXDA 3M7SA 4PUNA 1HP5A 4GVFA 3W02A 3RXZA 1IEIA 2NX3A 1KRBC 4IJCA 3KTCA 2DZPA 1XYFA 2DT3A 1QASA 3N13A 5GJMA 1NQ6A 4A2SA 3QBUA 4AW7A 2NQ5A 2BXVA 5A8PA 1CYGA 4JR5A 3P0XA 4XAPA 2QS8A 4ICNA 4AFYA 1XDJA 3V3WA 3W84A 4MDPA 1N48A 3T40A 2NVAA 1FKWA 3GIJA 2ASJA 2EAWA 1DWFM 2R8JA 4PFHA 3RDKA 2DUXA 2EPOA 4QG9A 1JNDA 1QXLA 3PS7A 3WNOA 2BS9A 3NZQA 2Y7DA 1Z8AA 1ITQA 1UWQA 3B8WA 3A9IA 2PB1A 3V36A 1D8WA 1G9HA 1EGVA 5M5DA 1KTNA 1HKJA 2W66A 3CO8A 3SCRA 1XPGA 2CZ5A 4ED7A 4US6A 2FPTA 1Z42A 2VDGA 4J7RA 2FTYA 3RITA 1YDNA 1TPUA 2C28A 1HKVA 1X6NA 1A3WA 4U2YA 3OZMA 2YL8A 4BA0A 5IOBA 4GYPC 2FVKA 4K7VA 3AIWA 1KFBA 3WQDA 2ATLA 4Q8QA 3I7RA 1IWPA 1ZCOA 2FGZA 3GFXA 1EC7A 3R2GA 3G6MA 4IGMA 2GVYA 2R8GA 1RBOB 3UWWA 4WSHA 4CNOA 4F2UA 3Q8PB 3GTNA 4MY9A 4X0VA 1T3NA 1I2OA 3QZ6A 3V6JA 3CL8A 3MHUA 2IKIA 4FBTA 2CYGA 5KFIA 2J25A 4AC1X 5CQ1A 1DP0A 3BG5A 3BK0A 1WP6A 2XFWA 3A3XA 2OT1A 4HT3A 3PB0A 1FDJA 1A5CA 3SRDA 3CB8A 3G1AA 1GYLA 4EBEA 3H26A 2G8ZA 4U2ZA 4WY0B 2PWFA 1R7AA 4KEUA 1XG3A 2OKOA 3GILA 1B90A 1V7YA 1EO5A 2WHKA 3GVGA 3S42A 3KDOA 4RPPA 4BZYA 2WSRA 1V6UA 4HHLA 5A6JA 4LC8A 4JTSA 3PZPA 3G6VA 4JCLA 5JH1A 3Q8QB 5TD4A 1N56A 1XIDA 3NYDA 5JQ9A 5G2HA 2VCCA 3T44A 3R25A 2W5FA 4J2PA 2VGGA 1YNQA 1NJJA 4DLMA 1OFOA 3GC5A 4P61A 4JTHA 4KRTA 2J9XA 3Q4DA 2ATMA 4AEEA 1HFBA 2X42A 2PDCA 2V3DA 3BURA 2BR0A 4AEOA 3RM9A 3BW4A 4B5SA 4ML9A 4PTWA 2OCZA 4Q8TA 2OLSA 2WKJA 4HMCA 5CSYA 5LSMA 5IRPA 4RPQA 4BI6A 1FCQA 4QISA 4LQ1A 4D2JA 4XK2A 1AL7A 1JCYA 4IPJA 3VNMA 1JCNA 1HX0A 2WZHA 4F0KA 5IHSA 1O5XA 1TTPA 5HK4A 1JAKA 4IG2B 4XIAA 1RYSA 2VOMA 4H7ZA 4NLGA 5J8LA 1AMKA 4Z0JA 4H8UA 2IBKA 4QQUA 4J9SA 4IP4A 4KT2A 5XINA 1UR3M 1F3WA 3B0XA 2G3FA 1YXYA 1Q8JA 1UWUA 4KH2A 1I1WA 1XRFA 1Y5WA 4IIBA 4KGLA 2VELA 3STEA 4W5UA 4S1FA 3G8EA 1TPDA 1WE5A 3UY7A 3QM3A 1B3VA 3WK2A 4XKMA 4OV4A 3ZJ7A 2ZZ5A 1YHTA 3GDKA 3QH2A 4MLJA 1LQAA 3VKBA 3H22A 1F4HA 5K4XA 3OHAA 2QUMA 5JH2A 4S39A 1K7XA 3TAKA 4LT9A 3S5OA 3WN6A 1JZ4A 2EO7A 2QJIA 3CIWA 5ECUA 1E4IA 1U33A 3TFXA 4UMCA 3ATYA 4UFKA 4WIWA 4M1RA 1RCQA 3G1RA 1ZBKA 1XCWA 2P8CA 2PWUA 2TODA 3T0AA 2XH0A 4PCFA 1AJZA 3C52A 5DLGA 3CZJA 2Z1VA 4O3RA 5KFTA 3G6LA 5JUVA 2SFPA 1K6WA 1XBXA 4H04A 2W8KA 2ISFA 1CB2A 4S3FA 2ZRWA 4GUJA 3VIGA 5FSDC 4A35A 4J9JA 1RALA 2A6NA 2XM2A 3PP7A 3MUZ1 3H54A 2DZWA 1TV5A 5D4YA 1KQYA 3KOXA 1SJBA 4UOZA 1NM9A 1NU5A 4D6IA 5KG3A 5DELA 4WDWA 2BLEA 2Z2BA 5CBBA 1R2TA 4CU8A 1IEWA 4PA8A 1Q2SA 4IT1A 4MWAE 3BLDA 1NOFA 2X0HA 3TP4A 1QBBA 3N19B 4J3VA 4E3TA 3WF1A 1TUFA 4A3RA 3NWRA 5DLCA 4H6KA 1NQKA 1RP9A 3V16A 1OFEA 3GO2A 5AKQA 3H8AA 2CLOA 3UR5A 5C0QA 5F4XA 2OZ8A 2FMNA 3GVQA 4MIMA 2JKEA 2Z1XA 5CG0A 1J93A 1MFVA 1QNRA 2D2JA 3HGOA 3C4UA 4RDVA 1TQJA 4BJHA 2W9CA 1FWHC 4MWAA 3T5LA 4LY4A 2DFAA 4LCSA 2PWVA 1XLEA 1B31A 3TNBA 1EKOA 3QTGA 3GIIA 1M1BA 3NQFA 2DIJA 4RU9A 3QV7A 5KFBA 3BCJA 5PTDA 3S2MA 1B4KA 5C7VA 3EKLA 4LC6A 2QPUA 1LWHA 1M5WA 1EJSC 1EUNA 4C6JA 4REQA 3JUGA 1ICQA 2QGHA 5KFOA 3CK5A 2XC9A 2DZVA 5KZDA 4XD6A 4ECQA 2XHYA 3W38A 3NQ6A 1OABA 2RGMA 3EX2A 3WDPP 1Y5XA 5I23A 1KV5A 1VJIA 1TX2A 3MKCA 2PTXA 1UC4A 4I7WA 3UJ2A 1E6SM 3NXFA 2J6TA 1UOZA 3WQVA 1WUFA 1P1MA 5HJXA 3RJYA 3CBWA 1VFSA 5A6SA 3DOPA 4K37A 2E0PA 5G2IA 2VX5A 1J01A 1Q6FA 2ASDA 3MU7A 3GX9A 2HMCA 1OFDA 5A6KA 5D9PA 5G2WA 5CGTA 5LNRA 3ZLFA 5ECVA 4GIYA 3T4CA 1AZ2A 3KBJA 1EX5A 5F2MA 1TV2A 2HK1A 3S46A 2CHRA 2OU4A 2EPNA 3XIMA 4L9YA 2RJHA 4NL1A 2VJXA 4HHMA 4CU6A 4F4YA 1WO2A 1GOKA 3O15A 3KS5A 3HV8A 2W7PA 3EPOA 4KFPA 3AISA 4JIQA 4PB5A 4PRRA 6ENLA 1OT1A 4YIWA 4JKLA 3WBXA 1PDZA 3V4BA 2GWNA 2O56A 1VFOA 2I56A 3GR8A 4BI5A 4J9QA 1GQIA 4ZBCA 3PG8A 2PZNA 1ZY9A 2A3EA 2WBKA 3RCMA 4BR1A 2O7SA 4UFMA 4GI6A 4QDWA 2DZSA 1W9BM 1E3ZA 1F8MA 3GG0A 1UHVA 2Y7EA 2PAJA 2GDUA 4CKQA 1GVYA 2YX0A 3T07A 3WLMA 4ML4A 1S0NA 3GHSA 3S83A 4AQLA 3G3MA 3S0CA 4AVOA 4FSAA 3R12A 2ZICA 4C5YA 1K02A 4DL3A 1IF2A 4BWLA 4DBEA 4UNKA 3NDZA 4MOZA 3AYRA 1R3VA 2P10A 3PUDA 2WMJA 2PD5A 4QXIA 3UWEA 3TMQA 3GC4A 2LLEA 2J7GA 2GGJA 1J2WA 3DX5A 3LHZA 4YN5A 4LF1A 4E6MA 2Q8LA 2YYUA 2IW0A 1FWRA 4PODA 4Q4SA 4YR3A 3VIIA 1LG1A 1W1ZA 3SBFA 3ALFA 3LCFA 3NAVA 1GYMA 4O17A 1DE5A 3SECA 5C2CA 2XZ7A 4X60A 4JTIA 3ANYA 2WJDA 3KUMA 2A6LA 2PDPA 3R8GA 3HU7A 3H6OA 5DQIA 3G0UA 1ECEA 1XIGA 4WJXA 4YTRA 1RA0A 3SCTA 4ZZ9A 4CD6A 1CXKA 4D6EA 4ZB5A 1UBSA 2JFEX 4V28A 2FTPA 1XRVA 1G67A 1L6GA 4LF2A 1HO4A 4DVOA 3VI2A 4INFA 4BY3A 4LALA 1TJ0A 3KHDA 5T9CE 2ON3A 4C6PA 2JEFA 1XYAA 1G1YA 3LPOA 4L4OA 5M17A 4RUAA 3I6RA 4DAFA 1QNPA 3WD0A 3SSJA 3HFYA 2X7VA 1VB9A 3E0WA 3H4WA 3B0UX 2WW5A 3E0IA 3KZPA 3M16A 2I5QA 3A6OA 3CTLA 3RIKA 4XAGA 1LRQA 3KHGA 1Q65A 4ED2A 4M80A 5AC5A 4J9MA 2C19A 3HGRA 1LL7A 2E7FA 4HMEA 3W7NA 3NG3A 1H50A 1BYAA 1RUSA 1A5UA 5EA9A 1BTCA 3UY8A 1MDLA 4N9BA 4PUKA 4WX2A 2E28A 1OGGA 4UQ9A 1EP1A 2REQA 2QNEA 4WJ8A 3QY7A 3M5ZA 2Q02A 2VFDA 3VNIA 2VR5A 2OQLA 3U57A 3F1QA 4R7OA 2A3BA 1UWTA 2VEIA 2IKGA 3PTDA 1K9FA 3TA6A 4LNYA 4R9XA 3KX6A 2JBMA 4FNTA 3KBMA 3BJFA 1XLGA 3PR2A 1BF6A 4D1IA 3UPWA 4C6KA 2BHYA 2DZAA 3C5QA 4AHQA 2ISSA 1IGSA 4K3ZA 1GQKA 1ZRQA 1M65A 2QCDA 3CV6A 3E6EA 4S38A 1DIOA 1QPRA 5KT6A 4LB4A 4IUGA 4MZ8A 1PIFA 2QUNA 3BSMA 1L2QA 1FRBA 3R58A 3HO8A 1XLCA 4JKKA 2GSEA 2UVWA 3H2OA 1C3FA 3PJWA 3VIPA 1N8WA 4HNVA 2QAFA 5C9XA 4C6EA 3GUGA 3L68A 1VEPA 3R1ZA 2OFJA 3ATZA 4UFHA 4KWWA 3BQ6A 3R43A 2QVHA 1P5BA 4ZODA 4TVCA 3TZNA 1XPYA 2ESCA 3P6LA 3WEZA 4TR9A 3GNRA 3NGFA 2CLMA 1S10A 1O7AA 2ZX9A 1XUUA 3GXTA 2HISA 4L61A 4IRKA 2VRQA 3DG7A 3JZEA 2E6FA 3G1SA 3PPCA 1OHLA 2E9MA 1J9YA 3LHWA 5AVHA 4NZ5A 4AZGA 4ZL1A 2R8KA 3QKEA 4JIIX 1VFFA 1E3XA 1EYEA 3MO7A 1OK4A 1M7OA 3GU1A 1IGWA 1RVGA 3MUY1 3MP5A 3A12A 1O12A 4GHRA 4Z2LA 9XIAA 3U2CA 4KQNA 4DEFA 1J2BA 5LIWX 3UJSA 4A4AA 1XLKA 5F2IA 2YZRA 4KEZA 3PW5A 1WCGA 4TMBA 2B7QA 1ZBVA 1A5MC 1Q6RA 4EACA 3B03A 4GACA 4WDUA 2YCLB 2OYMA 1G94A 3MMUA 1S39A 4LYPA 1GOWA 3D6NA 3ITXA 1DJGA 3JW7A 4LUIA 1XISA 3BZGA 3CHEA 4F3HA 3GNOA 3ARPA 4LWWA 4XKYA 2C7FA 4JY9A 3ITLA 1PSCA 5HDRA 4ED3A 3DXIA 3BV7A 1ME9A 1F73A 2OEMA 2BWGA 4FS2A 3TQ0A 5CC7A 5CLWA 1QT1A 3VNYA 3EPMA 1LBFA 3LZ3A 3N17A 1AH0A 1A3XA 2BXZA 3A23A 3TK7A 3W2LA 3ISIX 4B5TA 1WX0A 4M29A 4WGXA 3NO1A 4RV3A 1OSEA 4S23A 1W9PA 4WXZA 3O0FA 4DBDA 3QY6A 4QROA 2R1NA 3N29A 2WBGA 3CV2A 4XSMA 4IMCA 1GTEA 3H7VA 5FF0A 3EA2A 1W8GA 3LGGA 1YMYA 2TMDA 4DO4A 1K8CA 3L2MA 4M19A 2QUTA 3C56A 2DY3A 3BCFA 2TSYA 3QHNA 4U28A 3AICA 2J6VA 2Z29A 4CCZA 4ZENA 3U3HA 1P7TA 1JULA 1ITCA 2HQAA 2RDUA 5GQBA 4IP7A 5EFDA 1NAL1 4S3AA 3U9IA 1S5NA 4X3ZA 4URIA 5EU9A 4EAMA 5XIMA 2A5HA 4GQRA 5G1MA 1LBLA 4HOZA 3FGCB 1WKFA 3LLFA 4Q7IA 2X1RA 3W26A 2V6AA 1UR0A 2Q3OA 3C2RA 2AKZA 2Q6ZA 4NNCA 4DJED 3SJNA 2GJXA 3QR0A 3DBNA 2VC9A 2PRLA 4BKNA 3K4AA 1SPQA 2E5CA 1G4TA 3IGXA 3PBWA 4GC7A 3I6TA 2CZDA 1O60A 3UZXA 3WIJA 4XUYA 4UTWC 1DJQA 1F61A 5DT7A 4I9TA 4YCOA 4E2VA 2BVDA 3G24A 1MMFA 2Z7GA 3G2GA 2ASHA 4IF2A 1K3UA 2XN1A 5FA5A 3ZVHA 3VIJA 3PJUA 3TJLA 1PZ3A 3T9PA 2YCJA 4Q45A 2QLYA 1TREA 1MDRA 3RLGA 3IARA 1W9XA 1BWKA 5A2AA 1ZLPA 3ABOA 1G69A 1F5ZA 4XD5A 3TYUA 1WQ5A 4FOKA 1RY0A 1UA3A 5HMSA 1ME7A 3A21A 5BMXA 3NQ2A 2TYSA 1VBJA 2IKHA 5F2GA 3L0NA 1SUXA 1S5VA 1FUYA 3EDDA 3AZSA 4IZGA 5BNKA 2POTA 2PODA 4O12A 5JIPA 1EIXA 3V1HA 1H7NA 2ACUA 2CBJA 1MZHA 3QYSA 2YCKX 4F66A 3HURA 4IQJA 3GXMA 1WB0A 4FLQA 1GKQA 4ZQOA 1P0DA 1TRDA 1H7PA 4Z2KA 3AFBA 4AD3A 1E5JA 2GVJA 1VFMA 4ECZA 4YTSA 4DJEA 2OGJA 5CBIA 3QLLA 4KWVA 1UR9A 3M47A 5CG7A 3E96A 2IQ0A 4J3TA 2E6DA 4L7ZA 3W6YA 4QWDA 1JCJA 3L0GA 1UD6A 4O4VA 5D9MA 1IZKA 1S5MA 4JTLA 1JRBA 1K8XA 3W1PA 4DYJA 4XSLA 2OPJA 1BG9A 4HU8A 3ITOA 3W2NA 1OT2A 3Q37A 3C2VA 2POZA 1MVYA 1VBGA 2YR1A 2ACSA 3MANA 4QWEA 2R8IA 2PE4A 1H7XA 3TMLA 1HKKA 1ALDA 2YB4A 3ARTA 4N02A 3WUEA 4EF9A 4JQAA 4JTTA 2YPIA 2DSKA 3WDJA 3UZWA 2DDXA 5FI8A 2ZQ0A 4EPKA 4MY1A 2DUAA 5HQLA 2P0IA 3VIHA 3MW7A 2HCVA 3MSGA 3ZO9A 5MF5A 3N2CA 4QNEA 4GY0A 3XINA 3UNDA 1I2RA 1XF0A 4EPEC 1MEIA 4RUBA 3PNUA 1DJZA 4QWBA 3B9AA 4HMDA 4LUSA 2NQJA 2Z4GA 4GKTA 3BLKA 2IXUA 3KRSA 4KCUA 4H1ZA 1THFD 3AS2A 1K70A 2AQOA 1UD3A 2QPXA 3CUFA 5JBDA 1YQ2A 4DL4A 6REQA 4ACZA 1JVNA 2E77A 1CDGA 3PJXA 5EMLA 2F2HA 2XSBA 4IGHA 3TSBA 3EEZA 3AHYA 3W7CA 4RKAA 2BV9A 3GYCA 3TJIA 3ARSA 4FMVA 4F9JA 4BEUA 3PZQA 3MHGA 3SI8A 4U31A 2PF0A 2P0OA 4JTUA 4Q8WA 1K1SA 1WAUA 4UQAA 2ZVIA 5DN1A 1XS2A 4A8RA 4HA0A 3W3OA 2C22A 1K77A 1MO0A 4DELA 3AIBA 1X97A 3WYZA 1OYCA 1JZ7A 4PMYA 4UTFA 5D33A 1CBGA 3D3FA 1YDVA 3AIVA 3SRFA 3SUVA 2I17A 4C6MA 4J9OA 1SO4A 2Z00A 3A4XA 2YGYA 3F4DA 5ABEA 2OZ0A 1VRXA 1ZQ5A 3TOYA 1H60A 2UWFA 4IIDA 3R7MA 5BCAA 4MB1A 2P9BA 4MAZA 4AHPA 1WDSA 2VCAA 2HEJA 4QS6A 4UUIA 1XC4A 1M04A 2Q3RA 3RNDA 3ARWA 3W71A 4EE9A 3URQA 2D2HA 1EP3A 4TX9A 5EMKA 2CITA 4O15A 3RK8A 1T96A 1QAPA 3UZJA 1X1ZA 4NZ1A 4DO7A 5GJPA 3W1AA 4F0MA 3KHRA 2INEA 2PMQA 1FHDA 1NDZA 3N4FA 3TW9A 1NWUA 2PLCA 3KCJA 4PTMA 2BQUA 2J88A 3E2RA 3FDSA 4L9XA 3K1DA 2GVGA 5F9LA 3VC6A 3TYZA 3O07A 2J7FA 5J5RA 4GVHA 4JTJA 5DBUA 4NNBA 1QO2A 4U5KA 3APGA 9CGTA 1VS1A 1B3WA 3DHUA 3GV7B 4G2DA 3UVAA 3W1MA 4M6UA 1FCBA 5D38A 1HNYA 4QSHA 4B3LA 4E4UA 2A7NA 5KFNA 5DLFA 3TC7A 3TX9A 3CWHA 3PTQA 4CEUC 4YXGA 3UZ5A 1GOXA 3B40A 4A3UA 4J9LA 4J9NA 1YTKA 4P5UA 4EBDA 1W5NA 2YL5A 4U4MA 3E74A 2X1IA 1HJSA 3TA9A 2AGQA 1XH2A 3UYIA 4JNYA 4JFWA 2EG6A 1EDGA 2QUUA 5C9RA 4Z2IA 1C8VA 2J66A 5CPNA 5E0CA 3ZOAA 5L9XA 1XKJA 3KM8A 2IPGA 4LBRA 1EHNA 1T40A 3K1GA 2UY5A 4GFSA 5IFPA 4P7NA 3CAQA 3IJDA 4CNPA 2IQTA 1E0WA 3M44A 3EPIA 4AD0A 1QTWA 4L56A 1POKA 1TR1A 3R4IA 1CLXA 3FIGA 4F9DA 4PULA 1MXDA 3KWXA 5CEWA 1OGBA 3UESA 3EDEA 1F6YA 2V81A 5GNYA 5M2FX 3U2OA 4GC4A 3NJ3A 1YNPA 1TPWA 2WC7A 2WM0A 3COTA 2X40A 3TEVA 5MKGB 1CPUA 4YWSA 1VYRA 5A6BD 1DJWA 4YU1A 1JDAA 1ZHAA 2BGNE 2PDKA 1JJKA 3PZOA 5B80A 3LTYA 1OVDA 4XO7A 5FJRA 1X8FA 5FAJA 2V69A 4JZ5A 2VHLA 2QJJA 2WVVA 1L0PA 4D8ZA 1EXPA 3W2UA 4X2PA 4JFVA 1ZCCA 2PI6A 4OGZA 4GINA 1GEQA 5DGAA 2FPYA 2XTKA 1JZ2A 1CXHA 1T8XA 4Q44A 3PR5B 1H5VA 3S5SA 3TV8A 2FYMA 2V5CA 3LTSA 3GVVA 4EXBA 3KTSA 3WJYA 3BQ0A 2Z1WA 4Y9AA 2D1ZA 3AIRA 4DZHA 1QUMA 1HJQA 4C1NA 4DBWA 1V0NA 3CZLA 4GJIA 2YA0A 2OOFA 3U4FA 4RUCA 2Z2AA 3FLUA 3KXQA 1SO6A 1ISZA 1YDYA 1K9TA 3AU2A 4TX8A 4YHGA 1NFPA 4J3SA 1UIOA 2CLKA 3QXBA 4PMDA 4GQ0A 3GZAA 4WQ6A 4Q22A 3BSHA 3WDIA 4RCXA 3JR2A 1H49A 4AZCB 3P14A 3OVPA 2EGZA 1A0CA 3P80A 3W7JA 5LHFA 1E1FA 2OT0A 1SR0A 4Z17A 1XIHA 5EWEA 4JIHA 5KT7A 1PWLA 3XISA 1J0YA 4NF7A 3UD6A 3HPSA 4H7VA 3BDKA 1RVKA 1SZRA 2GJNA 4J4KA 1E1CB 3KOFA 4JPGA 3BE7A 5A6BA 4ERGA 5D05A 3VGFA 3S1GA 4F0SA 3OVGA 2E4TA 2NX1A 4NASA 4WKHA 4GI8A 1DBTA 3NIYA 4TVUA 1Y8BA 1UIPA 5DG8A 2VQUA 4GABA 1GEHA 1DJYA 1KFLA 2HBXA 3LM7A 3IS4A 4B91A 1OF6A 2V9WA 1HG3A 2YXOA 3MKKA 3RUBL 5E93A 2BX7A 4KERA 3PWAA 3WF4A 4M3PA 4PCTA 1VRDA 1DE6A 4IX0A 2RJGA 5CGMA 3W1XA 5ABFA 3CUXA 2VVNA 1RJRA 2AGKA 1K8ZA 3GSMA 4K38A 4J3WA 2BY0A 4YS1A 1IR2A 1IYXA 4C1LA 1UROA 3LXBA 4ERIA 3W4RA 1NIUA 4UTTA 1QCWA 2C1HA 3W2MA 4HNOA 2Z1SA 2NVCA 1KCXA 4O8RA 3H4DA 2ZZ6A 3AJXA 1W3TA 4H9VA 3W1LA 2ZX5A 5DQGA 3AS3A 4ZR8A 1IXPA 1KXQA 3QY8A 2JQXA 2FZ9A 3H7RA 1EBGA 3VNDA 4DPQA 3CYVA 2EJAA 1DL3A 3LYEA 3SFKA 2H90A 5EWFA 3LHVA 5U4NA 3NQDA 4MADA 1DQUA 3IJ8A 7REQB 1WAWA 4XV0A 3ITCA 3RX4A 1R38A 1S46A 2XVPA 2XH4A 4OUEA 1AD1A 1KA9F 3GHRA 3I3BA 3D5HA 4JYDA 1XIEA 3GE7A 2MUCA 3VGBA 1A5SA 5C2GA 4O10A 4DJFD 3OU8A 4KCTA 3EWCA 3FDKA 2BB0A 2D3LA 3LRKA 1DJXA 3BO9A 2WHJA 2WM1A 4W85A 4ZQPA 2AKMA 1JPIA 1D2KA 1Q5MA 2GOUA 1JZ8A 2PLMA 1A5LC 1DIKA 3EPNA 4UOQA 3E0FA 3CV7A 4TMCA 3TJ4A 3FFSA 3OOQA 4L6HA 1HKIA 3EWXA 4O14A 1VBRA 2E25A 4R88A 3KLKA 1QATA 3OBEA 3QW4B 4DF0A 3CPRA 2XIBA 1FA2A 5BOEA 4A3QA 2P53A 5HNUA 1JYXA 3OP2A 4PTDA 2W7OA 3L12A 5DRCA 3TDFA 1LUCA 4JXCA 4HBKA 3VE7A 1DTUA 2VL4A 4WK9A 2PUZA 3CH9A 3K30A 3OLGA 4UNLA 2ZWYA 4EBCA 2FLNA 4GNVA 3MS8A 8CGTA 8XIMA 1FWAC 1JYWA 1EZ2A 3BMWA 3UPBA 2XVLA 1IWAA 3GTHA 1TWZA 1PHWA 1KCKA 2X1UA 2XPKA 5KFQA 2HXUA 2FB2A 3TFCA 3HTWA 4O1EA 2XISA 1VFTA 2UVUA 1FWJC 2YW3A 4H83A 3QV6A 3QRHA 1HZYA 3VOIA 3PM6A 1VLWA 4YWIA 2YLLA 2AGOA 2VVSA 3HV9A 3O1NA 1J0KA 2O9RA 4K8EA 3WUGA 2BGSA 5C55A 3EOSA 3V5FA 3STGA 3WJXA 4IMAA 4QJ5B 2ZADA 4GYFA 2P3EA 3TXVA 4KEMA 4HU3A 4O0QA 3HQNA 4NKCA 1B3XA 1Y7VA 4PMQA 3B4YA 3SRKA 1KKRA 4I5UA 3LENA 4R8UA 2XCAA 1TA3B 5H2ZA 5B7YA 1GTHA 3WLHA 4JTCA 4BHYA 2G5WA 2WKLA 1GNXA 4LAKA 2BODX 1C8XA 3WBYA 1UP3A 4D6GA 5DXXA 4KW2A 1QDSA 1QBAA 3RO8A 1R6WA 4WR3A 1PS9A 5DBTA 3UW6A 1LCOA 1R9XA 1P48A 4GZJA 3W7IA 1NEYA 4OWGA 3F2CA 1V5XA 3VTRA 2FHCA 5A94A 2PDBA 3TYAA 3W1RA 4I3GA 3EXTA 2V4QA 3MJMA 2CBVA 3R8RA 3M1ZA 1ITUA 1AQ0A 4Q32A 1ZFJA 2GPTA 2B81A 5A3HA 3QZ8A 3G77A 1FHUA 3ARZA 1YKWA 2JEIA 3QTPA 1M3UA 3B8VA 3V5CA 3BW3A 1U5VA 3VKCA 3U0HA 2Z6JA 4IPIA 1RK5A 4R7WA 5AN7A 3TWAA 2QCMA 5CZSA 1V8EA 3W01A 1Z32X 1BYDA 1W1IE 2BVWA 3HMCA 2EJ1A 4B3KA 4NYYA 4PUJA 1CW2A 3SUWA 2PDNA 4QR6A 2HS8A 4NXKA 1ONEA 2OODA 4JFSA 1DEDA 3STCA 4Q6XA 1JDDA 3AOFA 3UWYA 1DXFA 2V5KA 3WKZA 1W5QA 3SEPA 3WNPA 4UB9A 2NX9A 4IFOA 3OVQA 2Q8ZA 4J40A 3NNTA 1ELSA 3PR4A 4IXXA 3LI1A 3P60A 2WSKA 3GDBA 1HO1A 3TSDA 4I6VA 2A3HA 1DWAM 3DC0A 5TAOA 3DYMA 2CLPA 4WRHA 1DHPA 3NXLA 2QJMA 1R87A 3SUUA 4FNQA 3L4VA 1F05A 3LUTA 2V3FA 1A0DA 1UH4A 3ARYA 4CD8A 3I65A 2AQ4A 3C2YA 4QJ3B 1BKSA 1IM4A 4GVIA 4S3EA 2QZRA 3KHLA 1WKEA 2O0TA 2FHFA 3S2NA 5L1KA 1CWYA 4HPJA 3BOXA 3NYZA 3LSCA 2QAPA 2XGQA 5AYXA 4ZTYA 4BQ3A 1VKFA 2NWRA 2WVTA 4FAMA 4RNFA 1SJCA 2RDWA 4MNJA 1A5BA 3VGGA 7CGTA 1VFHA 3MCNA 1RAKA 4RE2A 1E1EA 3VZZA 1IIHA 1OD0A 2GLKA 3CL7A 2D20A 3DHDA 3W6LA 1KRMA 1EGZA 1RPKA 3MP3A 1OZQA 2UBPC 5L1JA 3R10A 4QITA 3MT1A 1E6ZA 3N9KA 3M9MB 4QJ1A 3WH9A 5KFHA 5A69A 3W75A 3QZ7A 3FCPA 3LOTA 2WTFA 1T99A 1QO5A 1TIMA 2ZTKA 2OWWA 5I5RA 3FYYA 3ANVA 3VMPA 3SW6A 1P43A 2Z27A 1M41A 3ZR4A 3A5FA 1AK5A 2ZBTA 1GW1A 3CLWA 4K36A 3UG4A 4RW3A 4I8YA 3N25A 4LNCA 1MXSA 4H00A 4HKPA 4PMRA 1LQ0A 3S1XA 1ECQA 1GVEA 1DIDA 4CVWA 1JPHA 5FSEC 4ED8A 1V79A 3TTYA 1BRLA 5KFWA 1UPMB 4GIAA 3WLJA 1GJPA 5I0DA 2PRHA 2VENA 2WKGA 1XYLA 3ABXA 3GD6A 4YJ5A 1X1OA 2RH9A 1K1QA 1NWSA 1XX1A 5FF3A 1SQ7A 3E2QA 1YTEA 4FO4A 1E4MM 5KFDA 2KAUC 3G1YA 7ODCA 4KIRA 4LS2A 1OFAA 4JYEA 4P7RA 3GIPA 1E72M 2QCCA 4IIEA 1ISWA 1P6CA 3LTPA 2QDGA 3WNKA 1I75A 2X16A 3AYSA 3MWAA 3MC5A 2Q09A 4IQEA 3H21A 1TPFA 2WHMA 4AX6A 2PDJA 5KG5A 2BG5A 2VM8A 4S3DA 3W24A 1A0EA 3UP8A 1XCFA 1CXEA 3RBEA 3N6QA 4EOUA 3H2EA 1JXLA 3STFA 3TTOA 1TKKA 3LM3A 1XYCA 4CVUA 1KXVA 5LIYX 3KAOA 5LXXA 2ZC8A 1KBJA 5KG6A 5KT4A 5REQB 5DMNA 5I3GA 3OTRA 3F4NA 1K1DA 2ZZ3A 5IBXA 4C7DA 1GHRA 2Q01A 3A5VA 4FNSA 3S5NA 3SCWA 3THQA 1EEPA 1IEVA 4NZ4A 4RDZA 3MQTA 4IXHA 3WQFA 1VAHA 4J28A 2V63A 5H1WA 3AXHA 1OADA 4CCCA 4L1XA 2FLLA 3V18A 1BHGA 2NQZA 3E2VA 1MNZA 1I6NA 4Z0SA 4JDBA 4IGSA 4G7EB 1ESWA 2IXVA 2VD8A 1DWHM 1E0XA 2DORA 2BHZA 1EUAA 3NOEA 2XGPA 4JOMA 4U6PA 4MFDA 1O4UA 2J7DA 2C0HA 2NXHA 3QPZA 7XIMA 1XH0A 1FWTA 3TNOA 1ODZA 4N4PA 4MFEA 4JTAA 5CPLA 2B4GA 4FP1A 4HJFA 2CEQA 3ZLGA 4DWSB 2W3ZA 4H9TA 1CGVA 1OINA 1EGMA 3KP0A 3DI1A 3W22A 1ADDA 1H4PA 1IEXA 4O3OA 3SUSA 3WUBA 1MSSA 5AECA 1RPXA 5D37A 4M5PA 3OG3A 3WDHA 3QZAA 3PW2A 4GNKB 1Y0EA 3PVFA 1XCXA 1YX1A 4HVXA 1X7IA 4R34A 2YXXA 5AC6A 4JDYA 3N2MA 3NQBA 3RILA 6CGTA 2YJQA 4UR9A 3NO5A 5F2LA 4V33A 5KG0A 4V1YA 4C6NA 1T7LA 2QHAA 3BZJA 3C3UA 3I10A 3K2GA 3F4VA 4AISA 1LOLA 4U5IA 3GIMA 1KM0A 1UYQA 2CXEA 5LXEA 1K6AA 2DH2A 3ZWSA 3IACA 3WD4A 1EPXA 1Z41A 4AF0A 2IKJA 2L5HA 5D8ZA 4IIFA 3WK3A 4ZA0A 4QE4A 3CMFA 4MNKA 3W29A 1HW6A 3FX4A 3W2KA 4OBTA 1U1HA 4O1DA 2HWGA 4ZOBA 3OZOA 1FXQA 2YCLA 1OX6A 1S3HA 1XIFA 4AVFA 1BKHA 4ALDA 4B9ZA 2DT0A 1ZAIA 2G4FA 4ECYA 1AFSA 3GWQA 3VD4A 4I7UA 1QR7A 4R33A 1TV7A 1J6PA 5DGBA 4NYUA 3EOEA 3FEMA 5LA2A 1FWSA 2V2DA 3QN3A 1KTCA 4RNNA 5XIAA 2PFHA 3CEUA 1OJXA 1KKOA 2E9LA 1E0VA 3WLTA 2PWGA 2DW7A 4LB3A 4DNHA 3UJRA 3MSRA 3UT0A 1TUXA 2QCHA 3SJ3A 5JUMA 2J4GA 3WDQA 3SCVA 3G18A 4DF2A 3L2LA 3EOUA 4KCWA 1XLMA 1ZS2A 2J77A 2BQ3A 3TW7A 2GVLA 3T81A 4V2XA 1PE1A 3PUOA 4C6FA 5C6MA 3LLDA 3W53A 4HPHA 2NSOA 1C92A 5I06A 1JQXA 3T5JA 2H8ZA 1M68A 1Q4WA 4N7QA 1IR1A 1X6UA 4CNNA 2JIWA 1BVNP 3PWGA 2VUYA 2CZEA 3SQLA 1S3TC 5FD0A 4FXJA 1REQA 5LNUA 1A5NC 3NM1A 1GJUA 3CWOX 4XVEA 4TTGA 1FWDC 3WY1A 5AHLA 3DERA 2CLFA 3BANA 5CPTA 4ED1A 3TLLA 1TRIA 3PJTA 4BF5A 4IUOA 1EJ7L 4EXAA 4DUWA 1ZTVA 5A2CA 2AGTA 4LBUA 1LQ2A 1E9LA 1XC6A 1OF8A 4DWSD 3AMLA 3ZR6A 3DN5A 4QE1A 3KL5A 3T09A 3REQB 4DJDA 1NOWA 2BQRA 2WMGA 4RLIA 1UD5A 4XZ9A 1O5RA 4HTYA 2W79A 1H5YA 1OCJA 2NT1A 2Y88A 4MJ4A 4P2VA 3N2BA 4MZYA 1SZFA 4GUIA 5E9XA 3IJLA 5KFKA 3RPMA 1X98A 4MDOA 2YSWA 3Q58A 2FH8A 3TR2A 2E1WA 5LA0A 3AHXA 3VD3A 1RH9A 3T42A 1KLZA 3CHFA 2IQDA 2ZOXA 5CJ5A 5I03A 2XM1A 1ZP3A 3AZTA 4NI8A 3TVAA 4QAIA 1B5TA 3QF0A 1JUEA 4LH8A 1MYRA 2J7CA 3WK1A 3WLNA 4D6FA 1W1YA 2QJHA 3W7KA 2FZBA 3AIQA 1QPNA 5KFZA 4FNUA 4PUDA 4HZ6A 2ABBA 2AL2A 9RUBA 3KVLA 4PZVA 2GGIA 4W93A 4B4HA 5LIKX 2WCGA 3P61A 5BRQA 1US2A 1C29A 2P5NA 3TWBA 1Q6CA 5KZ6A 4N9CA 2WZTA 5JMUA 2UY4A 3HGJA 1YLVA 3V0SA 5KFUA 4KWUA 2PF8A 3T0TA 8A3HA 5H8PA 4W89A 4BF9A 3W23A 3QGAC 2QCFA 2E6YA 1U83A 1TE6A 4L64A 5FJTA 4Q7NA 1A80A 3VXGA 1CNVA 5AB3A 4BQ2A 5E0KA 4AMCA 4LUYA 2OLHA 1C8YA 1UH2A 1MW3A 4CN4A 1X38A 3TW6A 3G1DA 2EF9A 2F84A 1KRCC 5H91A 2W9BA 2QMJA 3B06A 4GG9A 4K2SA 4Q8FA 3DG6A 1PHQA 3VGEA 1S2TA 1Z48A 3U4AA 3RAQA 5KG4A 2AU0A 3BLEA 4YYCA 2CWXA 2WB5A 5AHNA 3LX9A 3T2PA 4YYFA 1XSIA 3PZUA 1LORA 4FOUA 4GZEA 1PCWA 3KS6A 4IGNA 3CPUA 2FMOA 2H9AA 4DYKA 2GQ9A 5A1AA 4YP3A 1PXGA 4GUGA 1V3LA 5FL0A 2ALDA 2D0FA 4ECVA 4JIRA 4DO5A 3DHFA 4NJIA 1UOKA 3P84A 3NA8A 1VCVA 3KOWA 3K4WA 3O3RA 2PC8A 4ZSUA 3QQ1A 4AWUA 4QFUA 4ILSA 4TQRA 4O28A 4U10A 1GPWA 4JTDA 4LJ3A 4PRTA 3H2NA 1LLOA 3AC0A 2ALZA 4ZFCA 2XCPA 2BOEX 3TTEA 6PTDA 3MA8A 1G4EA 3WK0A 4HCDA 5KFJA 5F9NA 3RYSA 4MB4A 5IM51 2YKKA 3NO3A 1PX8A 1FFRA 1JDEA 1EF2A 4IJRA 1XDLA 3MVTA 3ARUA 3SY8A 2XN0A 1E56A 3PN8A 2HNEA 1GG1A 4ZE4A 3MYPA 4JN8A 2G96A 6A3HA 4E3VA 5KT3A 3DC8A 3P3BA 3B8IA 3UZZA 2CHOA 2BMBA 4PMOA 1YE4A 3MMTA 2UY2A 4NAFA 2JEPA 3EKZA 4RJEA 1BD0A 3P8IA 3PAOA 3SAZA 3PUEA 3LY0A 1EWEA 3H55A 1FDYA 1K4GA 3P67A 4H9MA 3NSXA 1GOOA 3BXWA 3N73A 4IHCA 2PGWA 4LV9A 3LXAA 4BS0A 1W3LA 3A9BA 1I0DA 2A1YA 4J2MA 5C5JA 5C5YA 1JGMA 3GH7A 1IE7C 2UZ9A 3UERA 1TWWA 5M1TA 7PTDA 3URNA 4MJMA 2G3NA 2V2CA 4MAVA 4UR7A 3P74A 4Y8EA 1JQVA 4QDMA 1V3MA 1HT6A 3ARVA 1LL6A 1QPOA 1SMAA 2VQTA 2KZHA 2XZ9A 4DL6A 3PHAA 1E40A 3K4DA 3MR5A 1S2VA 5D2XA 3BAJA 3CQ0A 1ONRA 1Q6OA 2E5BA 1YDOA 3MDUA 1XWYA 3BVJA 4ZQRA 4AIBA 3W1NA 4A2RA 4V27A 4DI9A 2OX4A 1RA5A 2FQIA 1R46A 5HMFA 3UCCA 2QKFA 4W86A 4ORIA 3CHCA 4JEJA 3CLMA 3HJZA 3GTXA 5G5IA 2XH2A 3O06A 1B3YA 1VBHA 4OHQA 5KFCA 5HUPA 1X96A 1SZEA 1TJ1A 4AUBA 2WOQA 1RY8A 5D03A 3GNNA 4WXYA 2CW6A 4OTKA 2R94A 2WZMA 5HAOA 1PO9A 4W87A 2PZ0A 2ZXDA 3VNLA 4DJFC 3RLUA 4UFLA 3UG3A 2Y70A 1HQTA 2J9YA 5JXQA 1AQMA 2VD9A 5T14A 4XTIA 3TTSA 1BTMA 2D23A 3B97A 2ZKMX 1BXBA 2Y8VA 2RDJA 4HK6A 2I9UA 2GVEA 4JX5A 5BRBA 4AU0A 1W9VA 3CUGA 4LVBA 4JBRA 4AZHA 1VJZA 3FXYA 4GWEA 1JD9A 1KFJA 4J3ZA 4EPBC 3LHYA 3HN3A 1QHZA 2C91A 1GKPA 5C7HA 1NDVA 1U30A 5HNTA 3VMOA 4GVGA 3T2QA 2A21A 2QJNA 4G9PA 1SVDA 1KBIA 3O6AA 4KF1A 3ITTA 1EA0A 2ZUMA 5CKSA 5D09A 3T5KA 4G8TA 4MYXA 1CXFA 2PTWA 4Q8MA 1TVNA 2JALA 2Y8UA 1E6NA 1FH7A 4Z2JA 2WWDA 3VYLA 1OK6A 3T08A 3F2DA 3B0PA 3WD2A 2C79A 3CUIA 1Q7MA 1W1TA 1UW9A 5I3HA 5G4HC 1WA3A 3L4WA 1SZNA 4G1KA 5FESA 1RV8A 4CD5A 3OQEA 2CESA 4PMUA 5FF4A 5A8NA 4RNJA 3ANUA 2VT0A 3G8RA 1AVAA 3ZJKA 2RUSA 3WNMA 3JVAA 1XICA 1Q6LA 1MWOA 3LCXA 4AH7A 3MMWA 2GDQA 3L0KA 2W9CB 4X22A 3GNPA 2YXGA 3LCWA 3LBOA 5IHRA 3LD5A 4HJWA 3SQMA 3BUVA 1LF1A 3VD9A 5TQLA 1W0MA 2WNWA 1CLKA 3USBA 2OR2A 1JUKA 3KEHA 4TOQA 3BV4A 3M0LA 3NEVA 4WY0F 1LG2A 1FWFC 1BWVA 3R5EA 4JY8A 2QV5A 3GHUA 2EPLX 4E8DA 4IR9A 1D9EA 5FAGA 1H11A 3LEPA 2PDYA 2O55A 4REQB 1MI3A 3ECQA 4GXWA 2F61A 3NL2A 3ELFA 4CQBA 3TKFA 4NX0A 2CETA 5HMEA 4Y6GA 1ENUA 2CPUA 4AX7A 3JRKA 3ONCA 5SWUA 2C0AA 3PBGA 4UTHA 1DV7A 1WNOA 2VP8A 4GIEA 4FA3A 3ES8A 1ZNNA 4UTKA 3G3DA 3R11A 1C7SA 2EHHA 2R6OA 5AZ1A 2FGLA 4PBFA 1W1VA 3SDOA 3AHVA 5KTLA 3OBKA 4N6EA 4G3IA 1EDTA 2HNHA 1E55A 3VM5A 4US5A 3RAOA 2O4MA 3G1HA 3PUGA 2NV1A 2YA1A 3CB3A 1XH1A 3SCPA 2V8ZA 3WF3A 1CX9A 2DPJA 2JK2A 1W3KA 1ZBWA 1V6YA 5AHIA 4QBXA 1OX4A 3FEQA 3MV01 1N2VA 3DI0A 1P0BA 3CGTA 4LXFA 3KL0A 3OZPA 1GZGA 4P8WA 4GYPA 2GSHA 3DIPA 3EWWA 4GPNA 3UBPC 1OG0A 1XP3A 1VGAA 3IJ7A 4ECWA 3OYZA 4UQBA 3FNDA 1NDYA 3DHPA 1IXQA 1UMYA 4XD4A 3LGDA 1A53A 1M7XA 2FIQA 3Q8RB 4RZ5A 4NI3A 2HROA 2FDMA 3V75A 1C90A 3S5ZA 5CC5A 2Y2WA 3MFIA 5HWMA 3N1AA 1DJNA 2CWNA 1FP9A 4GUFA 1SM9A 5K3VA 4IRCA 1I45A 1HGYA 2WPGA 3WQEA 3EA3A 3GIQA 1P0KA 3BAKA 2WSQA 3MCMA 4OZOA 2DGAA 2PDIA 3V0TA 1JFXA 2WQDA 3R94A 4H9YA 1L8NA 3SI9A 1J5TA 3OZYA 1N7KA 3Q8SB 2VC5A 4D9PA 2PRMA 1VD6A 4CN6A 1S2AA 3LPGA 4AD5A 2NXIA 1IZJA 2GQ3A 4PL2A 4M0XA 4E8GA 3MZ2A 4WDXA 2Z1BA 4ORMA 1IT0A 1XYZA 4GH3A 3V1PA 1JZ5A 3GFYA 1HGWA 4YHEA 4BEQA 1J0IA 3GAKA 4I90A 2DT1A 3QVQA 1OC6A 4MWAD 4GYJA 3K8MA 3M0JA 4OFCA 3DFOA 3E49A 1QFEA 3B0YA 3V7PA 2WLYA 2CLLA 4LV4A 5KMYA 3UR2A 1UJPA 2D2GA 1SO5A 2JKPA 3L4TA 2C14A 3RB6A 4FR1A 2OYKA 1RBAA 5EY5A 3EB4A 3B9OA 4MUZA 3WMSA 5I00A 1PV8A 1ONXA 1EBHA 4FXSA 2VC7A 1Q7QA 1GW9A 2MNRA 3MDWA 1EEXA 1WDQA 3AWNA 5I07A 2J8GA 3FKKA 5CZTA 5I09A 3LK6A 2WVUA 2IMRA 3LQLA 4EAYA 3W7PA 2J6SA 5M03A 4OECA 3W7EA 4Q4KA 4X9SA 3W9ZA 1GUVA 2A7RA 3D47A 2OGYA 1FVPA 3AI0A 7TAAA 3HA1A 4V1XA 1CTNA 2BDQA 3LG3A 3WEMA 3RJXA 3BTNA 5MHBA 5K9DA 4PC8A 2QW5A 1J5SA 4XAZA 4XX6A 4KEVA 2ZX7A 3HGSA 3WLSA 5LNVA 1UG6A 1MQQA 4WF7A 2RGLA 2REQB 1TV4A 5L1LA 1O66A 5BWFA 4LYRA 1WKDA 1XLDA 1UZ1A 5HWJA 1A49A 3FVMA 3ZQ9A 3OHBA 4PB3A 4LGXA 2E8ZA 4RK8A 4HSOA 5CC3A 5T9BG 4AZ5A 1K7FA 4MPKA 1Q63A 4M6VA 1ML1A 3GBEA 4O1CA 2CERA 2TRSA 4AHOA 1VIWA 3WNNA 1N82A 2EG8A 1PWMA 3EB3A 4JTFA 1XD0A 3RX2A 1XV8A 3RPDA 2PWDA 4LYKA 1R30A 4H2HA 1QOXA 3MBDA 2DZTA 4JQ4A 3NEHA 2E09A 4GCXA 3OLEA 3EXSA 1XIMA 4LUJA 1CGWA 1XYMA 1V7AA 3HFTA 1JDCA 1E5NA 2O9PA 1GWJA 5CZ0A 2X30A 1Q3NA 1PCKA 5E09A 3H4BA 4HTBA 2D24A 3OYXA 1BG4A 3WELA 1O1HA 5J5DA 3T5HA 1W56A 1CGYA 1RQBA 4O8AA 3VOHA 1ZALA 3SGGA 2Y5SA 1KM4A 2O92A 4CLMA 3QPEA 3EDKA 1AL8A 3VABA 3MWCA 1KRAC 3EX4A 4YR0A 4G7FA 3HF3A 4HSHA 1UCWA 5IXEA 4IWWA 2QULA 1CB7B 2FVLA 1XBZA 3G0XA 3FA3A 3P82A 5AVNA 2FDSA 3DECA 1V03A 2Z1KA 2ZUSA 1R47A 3LB0A 2NUWA 3RLVA 1NFBA 1WUEA 5CZKA 3P62A 4LANA 4FALA 3UXLA 3O6CA 1UZDA 3TCEA 4DL2A 3IV3A 2XN2A 2PCQA 1MNSA 1F6PA 1WOBA 1CIUA 4W7WA 2C2DA 4KMQA 3EDJA 4B5UA 4PTXA 5E6YA 2V82A 3PSWA 4JTKA 3UEQA 4HZ8A 2YW4A 3G1VA 1J10A 2H3BA 5AHMA 3C0SA 3ES7A 3CJPA 3S1WA 5LNWA 4ECSA 1VF8A 3ZS4A 1ISVA 1DXIA 4DRSA 1DWGM 4XKYB 3QQWA 3TZFA 1Z44A 1PUDA 5M3WA 5GNZA 2PTDA 1YPFA 1EB3A 5ABTA 2QVNA 1TV8A 6TAAA 3GG8A 2VA3A 3A47A 2WMKA 1U5JA 3N2OA 1EWDA 4ZFMA 3CT7A 2NXGA 3E38A 3LGEA 3Q45A 1KM5A 3VDGA 5HA7A 2HTMA 2VDIA 4AWEA 4ZOCA 1TZ9A 4CQCA 1KO0A 1I60A 5K9CA 4JICA 4D8LA 1XUZA 4DXVA 3FJNA 1UUQA 4FLSA 5EMUA 4NZCA 4J1OA 4ONVA 4WSJA 1E9YB 1P7TB 3CH0A 3PY2A 3VKKA 4QLLA 4K1GA 3APTA 1YADA 2F8QA 4JNZA 3BSGA 3NSMA 1WDRA 1FHLA 4GBDA 3IVUA 3KRUA 2W9MA 3P2VA 1LRTA 2JIEA 3M0IA 3W70A 3RB0A 2OG9A 1W3JA 2JE8A 4F2TA 4JAWA 3SN4A 3A24A 3L65A 4I9AA 1XINA 1BQCA 3O16A 1XLAA 2XFFA 5KG7A 2GJXB 2QDDA 1OWQA 1Z3NA 3VC5A 4NAEA 3NQ7A 4MMWA 1A4MA 2RDIA 5DMMA 2VMFA 3W86A 1LDCA 1VYSX 1VLIA 5C71A 4F79A 3BLFA 2XSAA 2AQVA 1J12A 3NFUA 2E9BA 3CPGA 4PUMA 3WUFA 4GC3A 1KXTA 3UETA 3ZVHB 3SCOA 1V3IA 1ISXA 3IIZA 3LN3A 2TPSA 2VEPA 3NDYA 1UR1A 1V3KA 2F6XA 5G1YA 4ED0A 2Z7KA 4H6QA 4IICA 4LU0A 3WJWA 2ZRXA 1PTGA 2X1SA 4DWSC 4HYVA 3LNPA 2XVNA 4RXFA 1SJDA 4C5ZA 3AUOA 1VP5A 3RM8A 1JRCA 3LCHA 3AU6A 1D3CA 1B9BA 1FFQA 4D1JA 4PMZA 1RR2A 4CQ9A 4Q8EA 3NQGA 4DWDA 3MFHA 2ZTJA 1W2VA 1ZPTA 4BQ5A 5L6UA 1ZUAX 3B8SA 3PZ9A 1OFBA 5FIPA 3VGHA 3WCZA 3O7UA 2J8FA 3NQ8A 4HA4A 4NHVA 1ZZMA 4M81A 1W17A 2A3AA 3VU2A 5KSWA 2QQ6A 3N2XA 2CKRA 1GVOA 2V67A 3A13A 4ECXA 1EHAA 1KFKA 1FH9A 1AW2A 4O52A 1WPCA 2GK1A 3PTMA 3BARA 3W27A 2EXOA 1ITXA 4LCRA 3IANA 4GMEA 1GPFA 3VFCA 3W7HA 1NWTA 2Y1HA 1ZJBA 3K8KA 4I5RA 3I68A 2PDUA 3GXNA 1W5MA 3CQHA 4IFKA 3S2LA 5IDIA 4LFYA 2FJKA 3PK7A 2ZXAA 2ADAA 3OW1A 5A2BA 2NT0A 4QHRA 3R13A 1KGWA 3M41A 4Z1CA 4DX3A 3IJQA 2Q71A 2Y85A 1P0NA 1LJYA 2I7GA 4JV0A 1UD8A 2ISDA 5KG2A 3DDMA 1ZJAA 5BYWA 3UWZA 3FDGA 3ARRA 3IEBA 2VZSA 1JGIA 4DL5A 1DQXA 5LKYA 1Q8AA 2ZZ4A 2ALRA 3BPWA 5HULA 2BY3A 1JFHA 5EL1A 2HE8A 2GGGA 4O50A 4MVAA 6ALDA 5A6AA 1QRQA 2XFYA 3S9IA 4LUSB 1PKNA 2DJXA 3MZNA 4UR8A 3CWNA 4HNLA 1J0HA 1W9DM 2PURA 4C6QA 1VCFA 3LCLA 5K7JA 3VNJA 3BMXA 3AAMA 3CU2A 4R3UA 4JTRA 5DQHA 3R6IA 4KIEA 4PUEA 3U2ZA 4IISA 1BAGA 6REQB 4ACZB 2VZTA 1JF6A 4XD3A 1TG7A 1SO3A 3BG3A 1JCXA 3SZ8A 1HL9A 1FP8A 3EXRA 3DKLA 3GS6A 5CPQA 5HJYA 4PMJA 3U7BA 2CHNA 2ATSA 5HUOA 3B8DA 4ECUA 3BAYA 3KRZA 3EMCA 1VIZA 1R85A 4XZNX 4HNCA 2J13A 1XG4A 1I2PA 5BU9A 1H61A 1V77A 3MB9A 3GDMA 4KKXA 1OQFA 4GLEA 3TYEA 1KFEA 2QPSA 2E68A 4X9YA 3P5YA 3EMQA 2Y61A 3PTKA 1EQCA 2IPWA 2G3JA 4Z2GA 4LYQA 2J7BA 1LP6A 2VRKA 3QKZA 1OC5A 3O63A 3IK2A 1H3GA 2Z26A 2PS2A 3BQ1A 1B3ZA 1L6YA 4IPPA 4ECRA 5FEZA 4RNIA 3LZ5A 3W7LA 1C91A 1W1PA 1KWGA 3AMKA 2X2YA 4XZBA 4AWSA 5EWGA 3URAA 1PBGA 1TQXA 1PZ0A 6XIAA 2VGIA 1MFUA 2YYTA 4ZVJA 4ZXLA 9XIMA 2GQ8A 1NARA 3H70A 5GPRA 4ZO7A 5AYBA 1S2UA 3MUIA 1JCTA 3I3EA 4IRDA 1H1ZA 1YPIA 3V6HA 1YXCA 1G7VA 3AMGA 2I1OA 4AZIA 2PTYA 5I3DA 3QSRA 4PRWA 3KRBA 4GXPA 3NPVA 2CXGA 3G0SA 4JQ1A 3T7VA 3P0WA 5DCEA 3WJSA 3ICJA 2FJUB 3LS9A 3L21A 2CLIA 1EZWA 5D2WA 1EJRC 1FXPA 3EX3A 2PD9A 4U3AA 3RU6A 1DWJM 1WBHA 1NWRA 1UR8A 5DX7A 3UZYA 2BHUA 2E6AA 4QE5A 1QK2A 4IQLA 3MCOA 1JIBA 3REQA 1B30A 2Z28A 2J75A 3STPA 2ZZ7A 4JUZA 1C93A 4QEHA 4QWCA 3WMCA 4EYHB 1KGUA 5IDZA 2I16A 1ZJHA 2G97A 4ATDA 2OEJA 2J6XA 2D2OA 4C65A 4KS0A 4KRUA 5HR7A 3SR7A 1ZSXA 4LEQA 2W27A 2BNJA 1BLIA 3UGRA 4LVAA 4XZHA 4ADTA 4PGLA 3B8UA 3VKDA 2GUUA 3W7OA 1QI3A 1RD6A 4LVDA 3BQ5A 3NL6A 1X6LA 4FF5A 4ZGYA 4FBUA 4HQVA 1JIHA 4JNMA 5CC6A 1YNYA 4JFUA 1EOMA 5E1QA 3DEQA 1EJTC 1F2JA 4IMEA 3ZLHA 3PZIA 1MW2A 1E0TA 4Q6JA 1H63A 1S1RA 5DRIA 4UTWA 4Q4PA 3BLLA 4JTEA 4B2DD 4ECTA 4LTSA 2FTWA 1US3A 3MI6A 3TCSA 2GGHA 4WSKA 1C7TA 2A2IA 1J4EA 2INZA 3EWUA 4Z2HA 4MYAA 5BU6A 4K7YA 2FFCA 4AAJA 1H1YA 5AHFA 1DTNA 3AMCA 4Z1AA 3HBLA 4HPGA 2CLHA 5A8OA 1A5KC 1TJ2A 2E5DA 1WKYA 4GOAA 1UMLA 4PL1A 1XBYA 1S5WA 4GZ7A 4QX4A 1BPLB 3VZXA 3W0KA 1BYBA 2O7QA 2WVVB 5A6MA 3DYPA 3GDLA 1E70M 4NJJA 3BOLA 1F3EA 3AXXA 2YFOA 1UKOA 4M6QA 1HL2A 1EA9C 4HD5A 1EX1A 3OO2A 4CNTA 4PMNA 3TE9A 3YPIA 2C71A 4XTDA 1CXIA 5BXPA 1MEHA 4S3KA 2J62A 5D30A 3ZFHA 1QNVA 3FXGA 4RE0A 2D69A 4KCVA 3PVXA 1JG9A 1R3WA 4C1NB 3QOKA 4MSSA 1PZ1A 4P8UA 4J9RA 1JNEA 4GQGA 2W92A 2VX7A 5HWNA 4UBPC 4NSBA 3F4CA 1TMQA 4B2DA 3A4WA 3BJTA 1DXEA 4WCJA 2Y5JA 2G0WA 1D3GA 1J8VA 2DSZA 4Z1DA 1M53A 3U8GA 1H09A 2IPJA 3FK4A 1N8IA 2PU1A 1VQTA 3RF9A 3UG8A 3HM7A 2WC3A 4LUTA 3SUTA 4HA1A 4EX4A 5DANA 2Z0IA 2ZC1A 4QGCA 1EH9A 4K1WA 2GDVA 3CT2A 2DP3A 3MVIA 2NQHA 3WLOA 4QCEA 2VNCA 2WMHA 2OKTA 5EMMA 1JR1A 3UWUA 4B5XA 1MQPA 5D8WA 4ATLA 4O13A 3W88A 3EPGA 4MJZA 3UXAA 5CGQA 1G0CA 4QW8A 3RR1A 3M07A 3ZMRA 3BL3A 1Q13A 1CENA 3JS3A 2OLAA 1RYRA 2YB1A 4WUIA 5ABFB 4Q43A 1GGOA 3RMEA 4Q33A 2ICSA 3E0LA 3WQ8A 1XBVA 4FS9A 3TXZA 3CZEA 3R79A 4C6IA 4J9KA 4DXKA 3I3DA 1OFRA 1YYAA 4E38A 3ZXWA 5KFRA 2CZVA 4F40A 1GKRA 1SW0A 3VM7A 4QQ3A 1OD8A 3GQYA 3GIKA 2YZ5A 2NQLA 2RDTA 2XIMA 3VIOA 1D7KA 4G6CA 1LTDA 1TMLA 3N4EA 2C2EA 4EVZA 1XHGA 1XD1A 1G7UA 3FA5A 4MM1A 2R8HA 2J7HA 4CCEA 2BBFA 1XQLA 4A8LA 3KHHA 3R89A 2WMIB 4B5NA 4L1WA 4PFMA 4M7SA 4HYWA 2X0SA 3UWQA 1VENA 1LRNA 2H3DA 1DIEA 1YTDA 2V4RA 3IIPA 5BOFA 1XSJA 3NPUA 1IT8A 3G6XA 5FF7A 3WQ6A 1FBAA 3VDHA 3OVRA 3S6DA 1HP4A 4GYKA 2HPMA 1V6VA 1BXNA 4KPLA 5CJNA 3N14A 5KG1A 2R1KA 3THAA 3GKFA 3S6TA 2H8XA 4IM4A 1SW3A 2ZRUA 1OEPA 1DWIM 3H4XA 3OB8A 4DLFA 4KBXA 1XJBA 2XVGA 1OGSA 4IPLA 3S6OA 3S5YA 4JTQA 3CUJA 2UY3A 2OQHA 3VOCA 4MB3A 4H4IA 3CAWA 3OGSA 3HPAA 7A3HA 3W87A 2F6UA 2NV2A 4H8VA 3WQGA 2XG9A 3M9YA 3THUA 3VFLA 3DFNA 3LDVA 3WBWA 3KCLA 3L4XA 4NU7A 3AXMA 4D6HA 3PPFA 3DZ1A 1M9HA 2EBNA 3QPYA 1R3TA 1IV8A 4DM2A 3PZMA 3GR7A 3EWZA 3QYQA 3H53A 1MZRA 3WH5A 3BOFA 3N6HA 3FA4A 4L6DA 3N6JA 3KBSA 1LUCB 1PJ9A 4XZMX 2DU2A 4F0RA 3LRMA 4N4QA 4O1BA 4NZFA 1TZ7A 4DEZA 3KL3A 1TJRA 1TO3A 1S38A 4KRZA 5FKYA 3AXIA 4H2CA 5DO8A 4MWAC 1QW7A 4TVDA 1PTDA 1L9WA 3QZEA 4L65A 3T2OA 4FZIA 4LS0A 2QDEA 3DYOA 3UFYA 1H0GA 2Y89A 4RZ4A 1BFNA 4QIUA 2OWCA 4YNGA 2G50A 4C91A 3GY1A 4QAWA 3GC2A 1QOQA 4DPPA 1A5AA 3TU9A 2DSWA 4BFAA 1IQ8A 3HG2A 3IIXA 2Y0FA 1BQGA 2PGRA 3SM0A 4WD0A 3N9SA 2BFGA 8RUCA 1OFQA 4D72A 2ACQA 1C9WA 2JF7A 4JIPA 1OM0A 4IMFA 1HJVA 8XIAA 2FZMA 4HHPA 3FVDA 4PEEA 4O0ZA 4NILA 3R0KA 4PBEA 4JV2A 4PMVA 4FS1A 2X09A 1YBQB 4JN7A 1E4NA 3MSYA 4EWJA 3M9NB 4WHBA 3GQCA 4JQ2A 3PZVA 3TN5A 3RHGA 3AMDA 4R8UB 2HPIA 4QDPA 2Z6IA 3U6WA 1QOPA 4QTGA 3BLPX 4U7CA 3EAUA 2OJPA 1GVIA 1CGXA 1PKMA 1XR2A 1XRSA 2Y4SA 3W85A 1I1XA 3B9NA 1WZKA 3CQKA 4WJEA 1CGUA 5D2VA 1CCWB 1H7RA 3NQEA 2VXNA 2V2HA 4G56A 1L2UA 2DPEA 2W91A 1TX0A 3THDA 3EDFA 1F9CA 5I3JA 2P3ZA 5EYWA 1N8FA 3U48A 1H7OA 1R2SA 1OBAA 1H1NA 3W1QA 5HPOA 4XZIA 1PAMA 1E0UA 2VEMA 3ZYZA 2H6RA 2C16A 1OIMA 1TFVA 1FCUA 2J47A 8TIMA 3UNTA 3QC3A 4YQWA 2R1PA 3QFEA 2WMFA 5CAKA 1GK8A 4F0HA 3W00A 1E6PA 1PL9A 3WD1A 4N2YA 3CL6A 4AEFA 2RFGA 1W91A 2GUYA 2HXTA 5DEZA 4CN1A 1HTIA 1E9IA 5LYRA 2NWSA 2ONEA 2VDHA 2JGQA 2IMWP 1UKQA 1T6MA 3W2JA 2V5BA 2I9EA 5T8GA 4NRSA 3C2FA 1XLBA 2E67A 1G4SA 2QXWA 1UQZA 1TWIA 5EPDA 5I7GA 4HMNA 3FAXA 1JYNA 2A3LA 2BVTA 1J6OA 4PMXA 2WNQA 3WFAA 1K9EA 4BWLC 4KWOA 3C8FA 1BEUA 3RG6A 4WY0A 2QCEA 2FVMA 3LPFA 2R82A 3ZR5A 4H8HA 1FHVA 5J04A 3BAXA 3NQVA 2DUZA 3W72A 1Z9AA 3URBA 5KFFA 2CC0A 3GR4A 3GU2A 4HNNA 4AXNA 4O3PA 1LL4A 3SFWA 1V3HA 2DH3A 3EZ4A 2OQYA 4F4ZA 3O0KA 3LHUA 3VOGA 2GJRA 5HINA 1Q45A 3VGDA 3VOJA 2QCLA 5F7UA 2Y5EA 3T8LA 3PFRA 3KE0A 4IR1A 2ASLA 1JPMA 1T8QA 2J74A 4XWUA 4CCDA 3M0ZA 1NSJA 3WL1A 3PFMA 4M51A 5TNVA 1XRTA 4N6FA 1UASA 2GJLA 1KR1A 3C2OA 3DGBA 4KWSA 3M46A 3ZWTA 3GU9A 4Y9OA 2VX6A 3QQ0A 1S0MA 3BGGA 4WOZA 3MUAA 4ZXOA 3E0VA 3INPA 3VA8A 1GYNA 3TYDA 4TIMA 1UR4A 4AIEA 2Z2UA 4HOXA 2ZRVA 4IG2A 5ABGA 1LWJA 1L6FA 5DCBA 3GKAA 4M8UA 4NJKA 2F7FA 2X8RA 1XFCA 1J96A 1M7PA 3NR0A 2OB3A 3EB2A 1YIXA 1LROA 3HQPA 2OMAA 3VIMA 1P1XA 4C60A 4WDTA 5EMYA 3MI3A 3TC3A 3ERPA 1C9DA 2J27A 2ANUA 1R9YA 4NVTA 2CNCA 1XDMA 4LBSA 3OODA 3EWDA 5BMWA 4L4PA 1Q6DA 3OGRA 4O54A 3KOZA 3SRHA 4XVDA 4R27A 5LNSA 2XWDA 1GZJA 3OSPA 1EC8A 4W84A 1PYFA 3R8HA 3PW4A 3W6MA 5F4SA 2Y7GA 3DFQA 2ZZ2A 4P7LA 3HPXA 3M5YA 4JD4A 2XFRA 3P7YA 2NSXA 5ENLA 1OC7A 1DORA 1IZCA 4KGJA 3RB3A 3V6KA 1DOSA 1ICPA 2DV0A 1BRLB 3RGTA 3L66A 5A8MA 1T0OA 4WLCA 1EIBA 4G5DA 1HKMA 1KR0A 3AIUA 2VUNA 3QW3A 1RQHA 3VE9A 4B9YA 5C9ZA 3TUUA 4PCPA 3IUHA 1B4EA 1CT5A 1R0MA 2F9RA 3GBDA 2B0MA 4PCNA 4HYRA 2A79A