1YMYA

Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
382
structure length
376
Chain Sequence
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-acetylglucosamine-6-phosphate deacetylase from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords N-acetylglucosamine-6-phosphate deacetylase
total genus 115
structure length 376
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.5.1.25: N-acetylglucosamine-6-phosphate deacetylase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1ymyA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ymyA02
4IGNA 1EJXC 2KAUC 4C6LA 3AUOA 4LH8A 2YZ5A 2PGFA 1ONWA 4F0SA 2ADAA 1XRFA 1O12A 4C6JA 3MSRA 4IGMA 4CNSA 2R1KA 4BY3A 1E9ZB 2Z28A 4WHBA 5CH9A 4HA0A 1YMYA 2QVNA 4B90A 3NQBA 4C6DA 3GG7A 2P53A 3MPGA 4DI9A 2PUZA 2VM8A 4YIWA 1WXYA 3IPWA 4DLFA 4ZSUA 1HZYA 4LCQA 2WJEA 1FWJC 3FEQA 2EG6A 3F2DA 4GX8A 1WXZA 3IRSA 3LS9A 3QY6A 4HK5A 3URAA 1I0BA 3NEHA 1EF2A 2Q01A 5FSDC 4XD3A 4C6MA 2D2JA 3A3WA 1YBQA 3S2NA 3GU2A 4D8LA 1A5LC 3IV8A 3B0XA 1R9ZA 1ZZMA 2Z7GA 1NDVA 4KF1A 3E0FA 2Z24A 1IE7C 4KEZA 1J6OA 3PBMA 3S2LA 4GXWA 4RDYA 4F0RA 2R1PA 3LGDA 3UF9A 1GKPA 3C86A 4C6EA 4C6PA 3SO7A 1P1MA 1R9XA 4XAYA 2Z2AA 2OGJA 1ADDA 3HM7A 3G77A 1V4YA 4INFA 4EPDC 2EG7A 1EJVC 4CQCA 4RE0A 1YIXA 4C6QA 4GY0A 1JGMA 3UR2A 3RYSA 3UR5A 3F4DA 2ZC1A 1K1DA 3GRIA 4LCRA 4ERAA 1FWIC 1NDYA 1NDZA 3TN6A 4PE8A 3GTFA 2WJDA 4LANA 2HPMA 4I6KA 1FWCC 2PAJA 4R7WA 3AU2A 2D2GA 2I9UA 2FFIA 1FKWA 1J6PA 1M68A 3UPMA 1FWHC 2FVKA 1EJSC 4ICMA 4LAOA 2G3FA 3ORWA 3PAOA 2EG8A 3AU6A 2DVXA 3F2BA 1POKA 4XD4A 1M65A 2OOFA 3FDKA 2P9BA 1J79A 4JOMA 1EZ2A 4B91A 1KCXA 2Z4GA 3MVIA 4J35A 4NG3A 5LXXA 3TN4A 2YB4A 3WYZA 1YBQB 3T81A 4V1YA 3K5XA 5E5CA 3IGHX 5FSEC 1K70A 3LGGA 5A6TC 3GGMA 3JZEA 1BF6A 2ANUA 4IQJA 2CZVA 3MDUA 4G2DA 1UIOA 2HQAA 1FWBC 3N2CA 3OODA 3SFWA 2FTWA 3RHGA 4KEVA 1KRBC 2VC5A 2VR2A 4CNTA 2Y1HA 2I5GA 4MUPA 2HBXA 3WZ0E 4GYFA 2FTYA 3OOQA 5G4HC 4QTGA 2VUNA 2YXOA 4L6DA 1V51A 4PCNA 4QROA 3B0YA 4OFCA 3TN3A 3LU2A 3IACA 2PGRA 2OODA 4CQBA 3PANA 4LAMA 4B92A 4C65A 4P5UA 3E74A 1RK6A 1V77A 4LALA 4IFRA 2HNHA 2DVUA 4KEUA 3A4JA 4H00A 4C6IA 2Z2BA 4PCPA 4RDVA 1UIPA 1I0DA 4C60A 3CJPA 1XWYA 4KERA 3ITCA 4XD6A 4XAZA 4IFKA 4M51A 4DNMA 3LY0A 4G7EA 2O4MA 3QGAC 2Z00A 1QW7A 3FDGA 3K2GA 3A3XA 1RJRA 1J5SA 2Q09A 4PBFA 4EPEC 3S4TA 4GZ7A 3T1GA 4LAKA 4TQTA 3HPAA 4IFKB 4H9XA 4GY7A 1KRAC 1A4MA 4H9VA 2D2HA 4H9UA 3UBPC 2HBVA 1NDWA 4C5YA 4GK8A 3LNPA 3E0LA 2Z26A 2F6KA 1PSCA 4QS6A 4XAFA 1S3TC 2W9MA 4BKNA 4H9YA 4ZSTA 4QS5A 3IARA 4IH3A 3WMLA 4WVXA 2RAGA 4DYKA 2Z25A 3URNA 1A5OC 4KQNA 4DZIA 1VFLA 3NURA 4C5ZA 1RJPA 1XGEA 4GOAA 4GC3A 4CQDA 4GX9A 1ONXA 1EJRC 4DI8A 4PBEA 4HK6A 3LSCA 3TNBA 4KESA 3HTWA 3E38A 4RDZA 4KIRA 1PB0A 4BJHA 4DLMA 5HMFA 3OQEA 3OU8A 3E3HA 3QY7A 4LCSA 1KRCC 1YRRA 1FKXA 3B40A 5HMDA 1FWDC 3PNUA 1A5NC 3ISIX 2HPIA 4KETA 4DZHA 1A5KC 3K4WA 2UZ9A 1PTAA 2FVMA 3GTXA 4WGXA 2QPXA 3GIPA 1ITUA 2XIOA 3DUGA 4H9ZA 1GKRA 1P6CA 3DC8A 4V1XA 2QT3A 3E2VA 4EPKA 2UBPC 3LSBA 4DIAA 3TN5A 4C6OA 1EJTC 2QS8A 3MVTA 4GBDA 3RCMA 2OB3A 4G7EB 3V7PA 2GWNA 4UBPC 4QRNA 4CEXC 4R88A 3CS2A 4H9MA 3BE7A 4ERGA 3GU1A 3URQA 2E25A 1K6WA 1RA5A 1FWFC 3GTHA 4LFYA 4F0LA 3GU9A 4LEFA 1EYWA 1UMLA 1GKQA 3CAKA 1V79A 1A4LA 2AMXA 4IFOA 1FWEC 4AQLA 1UBPC 3S2JA 1M7JA 4XD5A 4AC7C 4IF2A 4CEUC 1P6BA 3PNZA 3RN6A 4B3ZA 3GTIA 2R1NA 1FWAC 3GUWA 4IG2B 4J2MA 1A5MC 4NP7A 2P50A 1E9YB 4I6VA 2BB0A 2GOKA 4UB9A 4ERIA 2ICSA 4CNUA 2A3LA 4J5NA 4RDWA 3S2MA 3OVGA 3R0DA 4QSFA 3T8LA 3MKVA 3IJ6A 4H01A 2Z29A 4GY1A 4C6NA 2WM1A 2OQLA 3MDWA 3EWCA 4RZBA 4IG2A 2BGNE 3ICJA 2VHLA 2Z27A 2GZXA 2E1WA 1NFGA 1ITQA 4XAGA 3GIQA 1EJUC 5HMEA 3ID7A 1RAKA 4EPBC 3QY8A 4DO7A 1V7AA 3F4CA 3O0FA 1KRMA 4C6KA 1EJWC 3D6NA 1PO9A 1RA0A 4R85A 3O7UA 3DCPA 3MJMA 2DVTA 4EP8C 1POJA 3KM8A 3LA4A 4NI8A 4HK7A 1W1IE 1RJQA 1R9YA 1RK5A 4Z42C 2PLMA 2GWGA 2YB1A 2WJFA 5AKQA 2VC7A 4C6CA 3MTWA 1FWGC 2R1LA 4C6BA 2R1MA 4HJWA 1XRTA 4L9XA 2AQVA 3EGJA 2O4QA 1QXLA 3QGKC 1O5RA 4C6FA 3F2CA 4E3TA 2AQOA 1YNYA 3EWDA 4H9TA 3OJGA 2IMRA 2GSEA 3URBA 1DPMA
chains in the Genus database with same CATH superfamily
4A3HA 5LGZA 2V6AA 3UJSA 1H5YA 3KCJA 1JJKA 1T41A 3OB8A 3GXTA 3ZJ7A 4S3AA 2W66A 3GG1A 2PDXA 7XIMA 5KFLA 4NL1A 4YNGA 4A22A 2ZOXA 2ASJA 1XIMA 1E0TA 4ECTA 4MY9A 1FP8A 1WXYA 3ES8A 3MUIA 1O68A 1RCQA 4ATLA 4ZL1A 1YX1A 3LLDA 1JQXA 2QGYA 2ZZ6A 2WJEA 2ISFA 3P62A 2FGLA 1HX0A 2YL6A 3VINA 3NL6A 1SMAA 3EPOA 3HMJG 2OSWA 3WJZA 3W7KA 5CQ1A 3CK5A 4LC8A 1EF2A 1P0NA 3C0QA 3ZLFA 3LM3A 3QHMA 3K30A 1Z48A 2G95A 1KKRA 3IV8A 3QC3A 4G56A 3RM4A 4HOXA 4LJ3A 5IOBA 1J6OA 5U4NA 5A6KA 3UF9A 2QQ6A 3GDKA 1GG0A 4Q4OA 1R9XA 4IIBA 3R10A 1N8FA 2P5NA 3LPFA 2OEMA 4J9RA 1RCXB 3AC0A 4NZFA 5I2UA 2C2DA 3LRLA 2QUMA 4QGCA 3WBWA 3CZ8A 3LHWA 1GVEA 4Q4MA 4RZ6A 3A23A 3ELFA 4LUJA 3AYTA 4HNLA 2V69A 1MNZA 3P2VA 2ISSA 1TB3A 1TPUA 3EKLA 2V5KA 3ZR5A 2I9UA 4O1CA 1DXIA 3N18A 3SCQA 5CZKA 1KLZA 4XD4A 3ZXWA 2OOFA 1DTNA 3L4YA 3DX5A 4NZ3A 4PMZA 4J35A 2WOQA 3WYZA 2WMGA 4V1YA 1CGVA 2ABBA 4CCEA 2X1UA 2XIQA 4LVAA 1QBBA 4CN1A 1P6WA 3LGGA 3LZ5A 3NM3A 1SFTA 4MIMA 3THQA 4HIBA 4QP0A 5DELA 3VIOA 3TQPA 4OBTA 4MJZA 4QW8A 3A64A 4Z1DA 2PTYA 2Y85A 4P7OA 3G18A 3LHYA 1DBTA 2HCVA 1WAWA 2XHYA 2PLKA 2ZA3A 1X97A 4CQBA 4QE5A 3UWWA 1Q8AA 1TMHA 1XQLA 4Q4RA 7A3HA 4LALA 3GV5B 1F3WA 1OBAA 2NX3A 3EXRA 4LVDA 4HVXA 5D2VA 2ZZ5A 4FA3A 4C60A 1TJPA 2VZSA 2V8ZA 4Y6GA 5I23A 4AVOA 5BCAA 1MUMA 3LI1A 3PBVA 3PPCA 2Z00A 1Q7ZA 4W84A 2AQ4A 1BKHA 3UU0A 1ME8A 1M04A 2RDTA 3TYBA 2HZGA 1QHPA 3NJ3A 3ZQ9A 2F6UA 2HISA 1V3IA 4RNNA 5LNVA 4K1GA 5KT4A 2QMKA 2VFDA 2D69A 4CNOA 3T07A 4B9YA 4H2HA 2YBTA 3WLMA 2CPUA 4QHRA 4PUMA 3HPFA 3SCVA 1NDWA 4FNPA 3T0DA 3C2RA 1G69A 2A7RA 4MMWA 1XKJA 2RGMA 1E3XA 2VL4A 1GEHA 3RB0A 4WJ8A 2I5IA 3OQ8A 1M6JA 4JS3A 3KBVA 3UG4A 4ATDA 3V75A 5AYBA 4AZ7A 1UC4A 1OFEA 1BYBA 3CAVA 4GI6A 4KBXA 2ACSA 3QJAA 4Z2GA 3OQEA 2UVUA 2RDUA 4GH1A 4QQUA 5HR6A 3BQ5A 5IBXA 3Q37A 3VMOA 2XGZA 5KZMA 1NWTA 5JVLA 2A7PA 2FIQA 3CC1A 2ZZ7A 3I7RA 3NQEA 2XGIA 2ZA1A 3OP2A 4K7YA 1CCWB 1Z42A 1XBVA 4HYKA 4ECLA 4OHQA 1L0PA 1UWAA 2WVUA 3KTXA 1ZBVA 3ZSSA 2BG5A 5K3VA 3WH8A 1XDMA 4ZOCA 1OT2A 4X9YA 1AQ0A 2TRSA 4U4MA 1IIGA 4W86A 3VZYA 5AFDA 3CT2A 3HGRA 1NOWA 2Q3OA 4J9OA 1SJDA 2WC4A 5H8PA 4UTTC 3HZ3A 4C1KA 4LEFA 1EYWA 4EWJA 5CG0A 2P88A 5A95A 3CUHA 4RXGA 4DJFD 1K7FA 3PWGA 1X1NA 4G5DA 4A21A 1ZY9A 1VB9A 4MZYA 2JKAA 2MUCA 1XH1A 2H3DA 4NASA 3EX4A 1E4LA 3AJ7A 4WY0F 1JNDA 4HMEA 4AVFA 2ZXBA 1PCKA 1OEPA 1LLOA 3PHAA 1HTIA 4RDWA 1D7KA 3EWZA 4YP3A 1KBIA 4QCEA 4OBRA 3EPNA 2DZVA 1W8GA 2YJQA 5LNRA 2ZDRA 4IIHA 2FB2A 1R86A 4KRUA 4ZXOA 2WM1A 2QUUA 2KZHA 4IPIA 4PMDA 2OPJA 5EMJA 3UWUA 3V1PA 4Q8FA 4WOQA 2ZX5A 2E1WA 4XAGA 4Z2IA 3SQMA 1KM2A 1DWFM 3A9BA 3HOJA 5KFMA 2YDQA 4LNYA 2WPGA 1RAKA 4M6PA 5EMUA 4OBSA 2O9TA 2B7PA 3TA9A 4J9QA 2DVTA 4EP8C 3P0WA 4ZMGA 1GOOA 4GI9A 1JX4A 3UY8A 1XSKA 3E0VA 1Q2SA 6TAAA 3B8SA 1QK2A 2BNJA 3W87A 1AMKA 3E2QA 3LMZA 4LUTA 4G8TA 5REQA 1VJIA 1KFWA 4R34A 1VYRA 9XIMA 4ECSA 4DPPA 2AQVA 4I5XA 3VD7A 5KZDA 3CUIA 3U8GA 3E2RA 3MMWA 3WDPP 1U5JA 3TZFA 1NF0A 4BF9A 1EWDA 1X98A 4IGNA 2QXWA 5KFJA 3CM4A 1AD4A 2YZ5A 1R3TA 1ONRA 3P8JA 5C6MA 2EO7A 5G4EA 2PGEA 3AWNA 3QSTA 1H61A 1XCXA 1IF2A 3WEZA 3HMCA 4DO5A 3GIKA 4XB3A 1IWPA 4ZSUA 1ISYA 1VFFA 2WMJA 2Q8XA 3AMKA 1DE5A 1GVQA 4L56A 1QHZA 3VDHA 2C22A 2WM0A 2QUVA 4YTUA 1MEIA 3HQ1A 3M0VA 3HO8A 4FXRA 1A5LC 3B0XA 2WQPA 3R43A 2YA2A 1I9CB 4GXWA 1B3XA 2JEGA 3S1WA 2HV5A 1X8CA 4L6HA 2EG7A 5D4YA 3NSNA 4DYEA 3VGEA 5KFWA 4WKHA 3FN9A 4MJ4A 4ED2A 2J6SA 1MDRA 4FXFA 4M6UA 4UCFA 3RYSA 3NVTA 2NWSA 2FJUB 3DFOA 3Q8SB 1Q63A 4ZQMA 1N56A 4FI4A 1FHDA 5E0CA 4WDXA 4HPHA 5F4SA 1Q45A 4S1FA 1CBGA 4FXJA 3BOLA 5T26A 2QCDB 5ABFA 2Z1SA 1XGZA 3S9IA 1PE1A 4L7ZA 3G1SA 3NDOA 4Q43A 4F4WA 3CQJA 3EMQA 2OFJA 2Y8UA 2CC0A 3EX2A 4URIA 4DNHA 4JV2A 3ITGA 3GD6A 1S0OA 4FOKA 1R0MA 3WO8A 6ALDA 2VC6A 4X61A 5LIUX 5HA7A 1VFTA 4O16A 1GVFA 3VNIA 3I7SA 3KHLA 4WY0A 3MKCA 2DORA 2VVSA 4O53A 3TQ1A 3CB3A 3OODA 5I3FA 3WJWA 5XIMA 3WK3A 2QPSA 1KV5A 1NVMA 3CB8A 1H7PA 4MTVA 4BF7A 2PBOA 3B0YA 5DRIA 1EOMA 1GYNA 3LK6A 3WQWA 1YTEA 1XSJA 4IM4A 2J7CA 3PANA 4B92A 3A4XA 3C0JA 3VIHA 3PK7A 4O13A 1L2QA 3DG3A 1KLYA 4JTFA 4F0KA 4MOZA 3GIIA 3JW7A 4FLSA 1HKIA 1VFUA 1X39A 3CJPA 2EPLX 5IDIA 2C14A 2CXEA 2FVLA 2VEFA 3PUDA 1EX5A 3DYMA 2J7DA 3EA1A 4L1GA 1XYZA 1PKMA 4PBFA 3NGDA 4Z17A 1MZHA 3A13A 1EP1A 1HJSA 2V2HA 3H2OA 3T0TA 4C5YA 1GQJA 2ZE3A 3CIVA 4S3JA 1XXXA 4DWSB 1FTXA 2QCCA 3NA8A 2CCRA 2D3NA 2Z25A 4GFSA 4KQNA 1JCNA 4M7SA 2YL5A 1RXOB 1GHSA 1BKSA 4DI8A 3EDKA 4R53A 2DQWA 3DHUA 3HTWA 3GILA 4KIRA 1IEQA 3AROA 5T9CE 1PB0A 3T0BA 3WQVA 3K8LA 3H21A 3VOFA 4DUXA 3TLQA 3WF0A 3CPRA 4IUOA 3S5OA 3B40A 4JEQA 4HN8A 4E2BA 1FWDC 1MXDA 1R2TA 5B7YA 4GRSA 1GQNA 4WUIA 4O1DA 3TP4A 3D0CA 2V0TA 3AIUA 4DBWA 3AXMA 4S3EA 2XIIA 3AHVA 5BU9A 2PDJA 2XIOA 4MWAA 2JIEA 4ENLA 2P3EA 1IXQA 3VMNA 9CGTA 4ATWA 3ITTA 4WDWA 1ICQA 2XZ7A 2Z1BA 3HPSA 3M5YA 2FTPA 2D20A 1RALA 5E6YA 3BSHA 3HG5A 2HWGA 4Q8VA 1XHGA 1DE6A 1BGAA 2J47A 2DY3A 1XH0A 1YPXA 3MVTA 2DZXA 3W3OA 1VZWA 4DXXA 6PTDA 3UGRA 2J24A 2NV9A 3AIBA 5I3JA 4DF1A 4F50A 4UWMA 4DBSA 1J8VA 1K6WA 1MNSA 2HS6A 5MKGA 2DJLA 4UNIA 1S5VA 5B7ZA 4RXFA 4XAPA 4DL4A 1S1PA 3L65A 1A4LA 3W1AA 4AQLA 5F2LA 3PBUA 3G5EA 4ZZ9A 4XD5A 3DAQA 4YHEA 1FWAC 1Y5XA 3IUHA 4UOJA 3QV7A 2ISDA 3WFZA 3I4KA 1R47A 3WIJA 1G6CA 1WDQA 5D05A 4DPQA 1OFRA 5CAHA 3BJFA 3I3DA 4NAEB 3G24A 3DH7A 2YA1A 4N7QA 4B4HA 3SSZA 4MB4A 1QI2A 1I2OA 3UPWA 2VA3A 5CJMA 3QSRA 3EWCA 1KBKA 2HRWA 3WENA 4R8UA 1GJWA 3IJDA 3G0XA 2YCLB 4Z08A 2O9PA 4Y9MA 1YPIA 2AL1A 3G22A 2IKJA 3LTSA 3VGDA 1M5WA 4NJHA 3OIXA 4L4LA 3STGA 3LA4A 1OK6A 1KA9F 1FH7A 1FWSA 3RLHA 4DJEC 2ODOA 4FS2A 3KWSA 3V35A 3GAKA 4Q33A 1G7VA 1SFSA 3UVIA 5A6MA 3W74A 2OLHA 3JVAA 1JCTA 3GZ3A 3ZZ1A 2VGFA 3H7RA 1C90A 4B5UA 2DJXA 2HEJA 4IQDA 1KD0A 2WMIA 1PVNA 5DQPA 4A8NA 1V0LA 2FZ9A 1DPMA 2KAUC 2QJHA 2H9AA 1JIBA 5KG2A 2DT1A 4CNSA 1VBHA 1DHPA 3UEQA 3QBUA 4X9SA 1U1JA 1LOSA 1ZL1A 1XC6A 4Y9AA 1ZJAA 1Q6OA 1E73M 1LT7A 1NM9A 1TRIA 1B5TA 4EF8A 4MG4A 5JH2A 5HBFA 2PDKA 4IP4A 1S2TA 2PF0A 1Q7MA 1GPFA 1OINA 3KW3A 1E9LA 1XF0A 2V3DA 3S42A 3WH6A 4QWEA 1YBQA 2ZZ3A 4F66A 1KO0A 4RZ5A 1CEOA 3W7MA 3CO4A 2P0IA 4ZFCA 3WLIA 1CLVA 1SZNA 4UTWA 1K1SA 4EYIB 4F48A 1QTWA 4BEQA 2RDXA 4HU8A 1J01A 5KFHA 2Z6IA 3TE9A 1GQKA 4BEUA 5A1AA 3SI9A 3U48A 1EBHA 4GMEA 4RE0A 3LV6A 3RAOA 3WDRA 1J18A 4S2CA 3W7EA 1K1DA 1BYDA 3OPSA 4GQRA 1FWIC 1NDYA 3PB2A 3MCOA 1YNPA 1TTPA 2D2OA 2QZRA 3AXHA 4H4IA 4GZJA 3RPDA 3IK4A 1GWJA 1EC7A 2FVKA 4L1XA 5CPMA 4ICMA 4LB4A 4AIUA 3AU6A 3RXZA 3ARYA 4XVEA 1W3NA 1E9IA 4D9PA 1ICSA 2IXUA 4JOMA 5I07A 3WG6A 4HSNA 1V03A 2JK2A 1OG0A 3VA8A 2FDMA 2G50A 4K7VA 1M41A 3V0SA 3J7HA 4NY2A 4ICNA 1NP2A 4OVXA 1UA7A 4UR9A 4GNVA 1UZ4A 3ECQA 1OCNA 3ABQA 1XLCA 2WWDA 4LBUA 1WV2A 3SFWA 3RHGA 1B3VA 3BAJA 2Y1HA 5C71A 2INEA 3EMZA 5I06A 4GQ0A 4J9KA 3NAVA 4DX3A 2BASA 2NVAA 3AIEA 3DENA 3FA3A 4F4ZA 1RUSA 1ESWA 3HA1A 4BQ2A 5FACA 3KRSA 4M80A 4IFRA 1MW1A 1UR4A 1R8LA 4HBKA 3B4YA 3UNDA 3IGUA 3SN1A 1MO0A 4IR9A 2PTDA 4O3NA 5BNKA 3GC4A 4S3DA 3PSVA 4CCCA 1R30A 2O9RA 2JQXA 3LRKA 1XIJA 3UERA 5AHLA 3LGEA 2V9DA 1QW7A 3S5ZA 3S46A 3LX9A 4PTNA 4Y90A 3ONBA 1S97A 3WD3A 3BLIA 1FHUA 3MR2A 1IGSA 2VFGA 3DU0A 4Q8QA 3ARWA 3LLFA 4J9PA 4O17A 1LQAA 4TQTA 3EB4A 4R7OA 4C7FA 1Y0EA 1IEVA 2D2HA 5KT3A 2O55A 3F1QA 4QDWA 4WRHA 1EUNA 6TIMA 1BLIA 3W1PA 1PHQA 4EXBA 3DERA 1QUMA 2WZIA 3WMLA 1E51A 4LYPA 2WZHA 5CC3A 1W3HA 3WQPA 3LXCA 3MKKA 1BWVA 2X1RA 5C9WA 4WF7A 1XGDA 1C9DA 2ZX7A 5HMFA 2PC4A 1XLJA 3TYCA 1E55A 2FZBA 1D7FA 3TVAA 1XLGA 4ORMA 3K46A 1IT8A 3KOZA 4PSRA 4EBEA 4QLKA 1US2A 1BG4A 4H8NA 3C2OA 3FJNA 3MB9A 3IANA 3CT7A 4CD7A 1MWOA 2NWRA 3MZ2A 4K8EA 4A35A 4W88A 1QR7A 2CU0A 5HNNA 5KT5A 1EBGA 1XICA 1EB3A 3IIVA 1VAHA 1LRTA 3KBWA 1Q6QA 3VIGA 1W8SA 4RE2A 1RQBA 1QPQA 2IKGA 4KT2A 3S8HA 4ERGA 4PMVA 2H8XA 4IPJA 4TQRA 3WMSA 3GU1A 4IMAA 3HJZA 1V6VA 1FCUA 4LFYA 4ZE4A 1FWWA 2CNCA 1GKQA 4AD2A 3ITVA 4NNCA 1JZ2A 5I3KA 1V3JA 1X6LA 2V4RA 4DF2A 5A94A 3CNYA 1ECEA 3SGZA 2B7NA 1H5VA 1CTNA 1VHCA 1MEWA 3PNZA 1G0CA 3WEMA 2GVEA 1TO3A 2VD9A 3GUWA 1WDWA 1WXJA 1KXHA 1A5MC 1NOFA 3SUUA 4UUIA 1AW1A 3LHZA 5AOUA 2J7FA 1NARA 5DO8A 4HPNA 2Z29A 3REQB 4DEZA 4UQDA 3UXDA 4QJ4B 3TZNA 3M5XA 1F8IA 4IICA 1VCGA 3NSMA 2WW5A 1V7AA 2W8LA 2GGJA 3VABA 5JUVA 3D6NA 1RA0A 1W2PA 2VEPA 1TELA 4ZCWA 3ZT6A 5A6AA 1EFZA 3ABOA 4XIMA 1RJQA 3CMFA 3WJSA 1S2WA 1ZUAX 2ZE0A 5I78A 2WJFA 4BI6A 1FWGC 3TMLA 5BXSA 2CZEA 7REQB 4J9MA 1QXLA 4LNCA 1EL3A 1OQFA 3I3BA 4JYDA 4HNVA 5LIYX 5F9NA 3B06A 3SADA 5HINA 3UW6A 3B4UA 1XI3A 2QV5A 1QO5A 1G67A 6ENLA 3QOKA 1ONWA 2ADAA 2R8HA 4ML4A 2BQRA 4GUIA 1E9ZB 5T14A 3NQMA 2QDHA 3L4VA 3SCNA 1EUAA 3BCDA 3SCUA 2OZ3A 5E70A 1X7FA 3MPGA 4NZCA 3PM6A 4YIWA 3BPWA 4GYKA 2D73A 2EAWA 2XJ7A 4DLFA 4EE9A 4FX8A 1AJ2A 1M7OA 4DBDA 4YYFA 5C5JA 1R7AA 2QHAA 1FH9A 4ZQOA 4FIQA 2GDVA 3IRSA 3MCNA 1A47A 4HZ8A 2A3HA 3URAA 1I0BA 2WLYA 3AAMA 1UR8A 1ODUA 3IJ7A 3INPA 2X05A 1CDGA 2Z7GA 4RCXA 3E0FA 3B8WA 1GOKA 1RLCL 4I7UA 2KX9A 5DBTA 2I7GA 2PODA 1A3XA 4IT1A 2EGZA 3SO7A 1JNEA 4PL2A 3MV11 3HM7A 1DXFA 4HPJA 1LLWA 3BTNA 4CQCA 1B57A 3VCRA 4E4FA 4V27A 1P7TA 3NFUA 2DPJA 2FYMA 3WQEA 1PXGA 2Z7KA 1V08A 3QKZA 2JF7A 4PB3A 1H50A 5KFAA 2UY4A 4PE8A 3SJNA 2J27A 5AZ0A 3PR5B 5KFTA 1JDCA 3PY2A 3WNMA 3V0TA 2JKPA 3AZTA 2P8CA 4L1WA 1FWHC 3WBEA 5AECA 5EBAA 1Q4WA 4HA3A 4DAIA 1AW2A 1S1RA 2J66A 3BLLA 3T55A 3BARA 5LZLA 4MNLA 1Q2RA 3W7OA 1L8NA 4IWWA 3ANYA 1EEPA 5EY5A 3SFKA 2BLEA 1W31A 4XSMA 1P0EA 1XLDA 4JFVA 4HSOA 2E1DA 4D1JA 1VKFA 3EB2A 2YYUA 1JZ4A 3MQTA 4WGHA 2FB3A 1FCVA 2GGIA 3WMCA 1TE6A 2HBXA 1PBGA 4GYFA 4NNBA 3H2EA 1A5UA 4A3YA 2GQAA 3GR4A 1S2UA 1LQ0A 4Y8FA 2VMFA 4GKTA 3GVRA 3QKEA 3F4NA 3BL3A 4AZGA 3CYJA 2ZUWA 3KHHA 2C19A 3HGOA 4KEUA 2WTFA 4BF5A 4C1LA 2IQ0A 1FQ0A 3FY1A 1GCYA 4OKDA 2YDSA 3SRFA 2NZLA 3ZR6A 4PR4A 3WLSA 2FZ8A 3BC9A 1SFJA 5BWFA 3T5HA 3EX3A 3MI2A 3ALGA 1J5SA 3M1ZA 3NWRA 3TFCA 2VCCA 2VOMA 3H4WA 1CZ1A 1TIMA 5CZSA 4BQ5A 4LY8A 5KFBA 2WBKA 3R0KA 4LBSA 2UY2A 1R2SA 3RRXA 1TQXA 1PKNA 1A4MA 1F3TA 3UBPC 2ZXQA 4QG9A 1GW9A 5CGMA 5IBXC 3QZ7A 4QS6A 1S3TC 3TYEA 2TAAA 1TPVA 3VC5A 4PBGA 2ACUA 1P5BA 1WYIA 4PCSA 3HPZA 2Y4SA 1T99A 3IIPA 4M1BA 3W2MA 2BHYA 2YR1A 1S2CA 2Y7EA 7TIMA 4Y96A 4JHOA 4GC3A 4GA8A 1XCWA 2G97A 5L1IA 5FEXA 1LG1A 1XR2A 3W84A 2AU0A 2ZQ0A 3GR8A 3WUBA 1DJQA 3L5AA 2E6DA 1FKXA 2BXVA 3AI0A 4M81A 3ITXA 1TVNA 4J3UA 3ISIX 4ZODA 4MNJA 2UWFA 1VFOA 1VIZA 3GIPA 4LY4A 4X0VA 2VEKA 3R1ZA 4REQA 5KFQA 5CPOA 2RJGA 4LB3A 1FOBA 3WH9A 3Q94A 1W5NA 4RU9A 4BZYA 5LHFA 2GDUA 4IMGA 1GPWA 4LV4A 2BQ3A 4OIFA 1X6UA 1O4UA 3ZVHA 1H4PA 4KGLA 5HWMA 5FJJA 3PJXA 2E25A 3HFTA 2V30A 4JUZA 1UD4A 1H63A 1XIGA 3MFIA 3MUCA 1K03A 5KFPA 1UC5A 4AB4A 2AMXA 3E96A 4H7ZA 2OWWA 1FWEC 2ZDSA 3BQ6A 2XZ9A 3S5YA 4E2DA 5FESA 2GK1B 3EPMA 4HB7A 4LRTA 4J7RA 2JFEX 3GTIA 1F07A 3W85A 4YJ5A 4J2MA 1SO6A 1V8EA 3TFXA 2ASDA 2CZDA 3S2MA 1RLDA 2ZUTA 2Z1KA 1PTDA 1FDZA 1OFOA 4LTSA 1KM6A 3LHUA 1QNQA 2FZDA 1LCOA 3CHVA 3N34A 1V0NA 2IW0A 3NZPA 2VHLA 2ZX9A 3GO2A 4ECYA 3NQ8A 3OGSA 1QASA 2YYTA 3GH5A 3I3EA 3L2MA 2CHNA 3VDCA 4E6MA 5DLFA 1N48A 1YXDA 8TIMA 1A3WA 3C8FA 2XGQA 3WQOA 2C71A 1H0GA 4LAUA 2RJHA 1Q6GA 4DL7A 4NI8A 4QISA 4OOZA 2UVWA 4DJFC 1L8PA 1BVZA 2XUCA 4MJ2A 1UWIA 3ITYA 2P10A 1KGXA 3QGKC 2PLCA 1W5PA 3N19B 4F0HA 2OQYA 1VF8A 4E3TA 4FR1A 2Q3RA 1YNYA 3SRDA 3WLLA 1RZMA 2VJXA 4OECA 4Y9OA 1HJXA 2WVVA 4CN6A 4GVGA 2BDQA 1ZSXA 3AISA 4IJRA 4BI7A 4OV9A 4QNEA 3T78A 1TYGA 1C9WA 1XRFA 1UKSA 1JDAA 2W79A 1WX0A 4LX4A 3BZGA 4HPXA 2WZTA 2X0HA 1HN1A 2PLJA 1VBGA 4DM1A 2XFWA 4JIRA 3TNOA 5K9DA 3M64A 4MLRA 1KWGA 2X1IA 3W1NA 1P0BA 1O95A 4EXQA 4I9MA 3TC7A 3TCSA 3V5CA 3NEHA 2Q01A 4C6MA 2WMKA 1HP5A 4FNQA 1ZZMA 1UZDA 1FFQA 2AAAA 5XINA 4HMCA 2XTKA 3M6YA 2HDJA 5G2HA 1P1MA 1W91A 5E0KA 4TOQA 3PW0A 3NQ6A 1T7LA 4AF0B 3GVQA 1V4YA 1EJVC 4Q7BA 4PUEA 1GHRA 3N9SA 3F4DA 3C0LA 1CW2A 3TSDA 1PDZA 3T05A 1ELSA 2Y89A 2OKOA 3O6AA 1EF3A 2VWTA 2BY0A 2W91A 3LEPA 2QV4A 3AU2A 1OZMA 1Q6LA 3HQPA 1HJVA 2QNEA 3L67A 2E40A 3KL0A 4FLRA 4QIUA 2F38A 1M65A 5KG1A 2Y2WA 1CLKA 1TUFA 1OC6A 2NQ5A 3NEVA 1SZGA 3TOYA 2EQDA 2PZNA 3BG3A 4MDPA 4RPPA 3LD5A 4NLGA 1SVDA 5JBEA 3GGMA 1E71M 2J88A 3S6OA 3W1UA 1Z44A 1AZ2A 4I9JA 3MUAA 3HV9A 2VC5A 2XGBA 3LI0A 3WUGA 2ESCA 1EO7A 3CV7A 2F6XA 1EGZA 2IPGA 2XSAA 2DV0A 4GCAA 4UR8A 4M3PA 3KRZA 3W6YA 3KOFA 1PDYA 4JFTA 2PGRA 4D6FA 2J77A 4B5WA 3CZGA 3CHEA 5TBOA 5C7VA 1V6XA 2HNHA 4UFKA 2QW5A 4FXSA 3KRBA 5GJPA 4W9TA 2NUXA 3VNDA 2JEJA 5G5IA 3HQOA 3VVGA 1DOSA 4QQ3A 1GOWA 2ZRUA 1TKKA 3GXDA 4D6GA 4S39A 3NPXA 1VLWA 1F4HA 2CERA 4R33A 2CITA 1X8FA 2Q09A 4LBRA 3VZXA 4XVDA 2PDPA 3TWBA 2DQXA 2F9RA 1NAL1 4YTRA 3V36A 2X1SA 1C93A 2D1ZA 4GY7A 1QWGA 4ED3A 1HJUA 2VGIA 1TV5A 4P7NA 2VENA 1AD1A 2DPEA 1QJWA 4BFAA 3EOEA 3E0LA 4AMCA 2Z26A 4BWLC 4HCHA 2QMJA 3BDKA 4WKFA 2YCKX 1J0ZA 3I6EA 1T0OA 3SUSA 4WVXA 2FGBA 3HG3A 3EOOA 2D3LA 5FEZA 4JTDA 3OHBA 4PA8A 3RJYA 1US0A 3TXVA 2BHUA 1DJGA 1ENUA 1SR0A 2XWEA 1KR0A 1XPYA 3GE7A 2UY5A 2BVYA 3ARXA 2QLYA 3BUVA 4O0KA 1SO4A 4GHRA 1H49A 4DBEA 3H2MA 2JEQA 1TX0A 1F74A 2PRMA 3WNKA 3FEMA 2C28A 3TYAA 3GTXA 4PUDA 3VKJA 3FA5A 3N9RA 3E49A 4P7QA 2BGQA 5A8PA 3T5LA 2GQ9A 5G2WA 3GDMA 1NWUA 3GXNA 1F61A 2DZTA 2YFNA 3UGVA 3LPGA 2E9LA 3LRMA 1SSGA 4GPNA 3TQKA 2OO6A 3V4BA 2OWCA 3EOSA 2WHLA 4HNNA 2V2DA 4HZ7A 1W5OA 4U5IA 3EEGA 3UD6A 1CNVA 4JTJA 1T3NA 3V7PA 3RILA 2GQ8A 4I8YA 1Q7QA 2QPUA 4NYUA 1JL8A 4YTSA 4U33A 3SIZA 4EANA 5KG0A 2TSYA 2OZ8A 4F4XA 4O50A 5KFUA 5KG7A 5EWGA 1THFD 2ON3A 3VFCA 4AG0A 4UFMA 4JN6A 3VC6A 4GGBA 3W28A 3CAKA 1E72M 1V79A 3WK1A 1JPMA 4JN7A 4EOUA 2OWXA 4AC7C 3TAKA 4B3ZA 1WAUA 3HQNA 4IG2B 1J10A 2XSBA 1QPNA 4S3BA 3D46A 2A3LA 1MQRA 4ZO7A 1LBFA 3N6QA 3L0NA 5KG6A 1KBLA 1A53A 2ATSA 3HN3A 1QO2A 3KDNA 3CYVA 4CUCA 3I68A 3EXTA 1DJIA 2CLOA 1K4HA 4MY1A 7REQA 1ZALA 3UR7A 3KS5A 4YQWA 2DSZA 1MRAA 3UZYA 5JMUA 1C8VA 3MP4A 5HNRA 4O0QA 3KHRA 2CLMA 4IJBA 4IMDA 3VM7A 4W8AA 4UFJA 2VC9A 3ARVA 3FCPA 1CGXA 3BAKA 1TTIA 1A49A 2ZRYA 3WLKX 5I24A 4EKJA 3R25A 1JZ6A 3OVPA 2IPJA 4WJXA 4MLJA 1M03A 2R1LA 3UP8A 2HNEA 4ZQCA 3EGJA 5KG4A 2RUSA 2QKFA 2XC9A 3NQFA 1EXPA 3C6CA 1HW6A 2BXYA 4F40A 4LVFA 2INFA 2CESA 5CZJA 1QAPA 3KX6A 3AS2A 3VM5A 5PTDA 2YCEA 5D8WA 3MSRA 3IRDA 4M29A 2W61A 5K9XA 5CH9A 4HA0A 2EEXA 2IQTA 3D3FA 4LUIA 1HGYA 1YDYA 4PTDA 1BRLA 4J27A 5BROA 2WAGA 1OCJA 2Q8ZA 1E56A 1DJYA 1RPXA 3RO8A 3TW7A 2VEIA 2R8GA 3SBFA 3VPLA 4KWVA 4GG9A 4GX8A 3KS6A 1W1A1 3OHAA 3CL8A 5D9NA 1FHLA 1QOXA 1TZ9A 4W7VA 1DJZA 4HNTA 1IXNA 3PBGA 3N2BA 4PB5A 1WKEA 1UKTA 4CNPA 5DG8A 2SFPA 2JGQA 4KCUA 1KM3A 4XZ9A 1EP3A 4E4PA 1W9VA 3RF9A 1T5AA 2PP1A 5AHNA 3C86A 4NXSA 1OYAA 2PDCA 4IP7A 3MYPA 2Z1XA 4PGLA 3E5BA 5A3HA 4U3CA 3DEQA 3HV8A 4TX9A 1SMDA 4UQ9A 2L5HA 2HK1A 1YIXA 1H41A 3UZXA 3LG3A 1KXVA 3P61A 5CZ0A 1H51A 3SURA 2RGLA 1IIHA 2W0UA 2A1YA 5M1TA 4M24A 4ECRA 3M47A 4IIDA 5D9MA 4RZ4A 4WDUA 3WBYA 5D2WA 1OIMA 3ABXA 5FL0A 4C91A 5FF7A 1HO1A 3PTDA 3QYSA 1UQYA 1WZLA 1B1YA 3RB4A 2FZNA 1J79A 4O11A 1IT0A 4NG3A 3TN4A 1SJAA 5D9OA 2YB4A 1K6AA 2ACRA 2WVSA 1D9EA 3TV8A 1ZRQA 3AICA 1SJCA 5BWAA 4AEOA 3M6DA 5KTLA 1DWJM 5A6BD 3UWQA 1FVPA 2FPTA 1VJZA 2V5LA 2F8QA 3GV7B 2R82A 1B3OA 2XN1A 4GC6A 4YHGA 2X41A 2A6NA 1BF2A 4NJKA 1OIFA 1DIOA 1H09A 1KRBC 4ZB5A 2EPHA 4UQEA 4TTGA 2FKPA 4EBDA 3GHRA 1WUEA 1OK4A 3RMJA 1J0HA 1KGUA 3GV8B 1AQMA 2G4JA 3NGJA 4QBXA 1V3LA 4N4PA 3QZAA 4P5UA 1RK6A 2WHKA 4H6QA 1IZCA 3B0PA 3WEOA 5JU6A 2J7EA 3TKFA 2DVUA 1TJ1A 4WK9A 2YCIX 5KFGA 1XM3A 4GQQA 4J1OA 5F2MA 2VGBA 3RU6A 5KFOA 3SUTA 4IX2A 1WKYA 4AVNA 1BXCA 4BQ4A 3W7DA 2VCAA 5JUMA 4AZ6A 1UKPA 3VNLA 3FDGA 4AIEA 2A5HA 4NNAA 3LHTA 4H6KA 3PUEA 3H4XA 5M5DA 3S3GA 1LRNA 1XSIA 4K2SA 4PMOA 2WCGA 4ZO8A 4H9UA 5I03A 3FAXA 1OFDA 4D6DA 3W25A 1F7BA 5CLWA 3PW2A 2AMGA 3QQ1A 1PSCA 5HQMA 5L1KA 5IDZA 4E0CA 2VZOA 1H1ZA 3PULA 5FIPA 3C4UA 3OYXA 5L9FA 2VEGA 5KT2A 4HD5A 2I16A 4MJMA 3AZSA 1JG9A 4HT3A 1CXHA 1LOLA 4PBEA 5KETA 4MB3A 2E5DA 2AGOA 1Y8BA 1E40A 4C90A 1J12A 2E3ZA 4JIQA 2BOEX 1JUBA 3LQLA 2W9CB 5ECUA 2CBUA 5EMKA 1V6WA 2GJRA 3S83A 1HVXA 2WSKA 5EMMA 5C9XA 1ZLPA 3TH6A 2YKKA 3ZM8A 4JQAA 2VTFA 1ZGDA 3PR4A 1OCQA 2VA2A 4FAMA 1CXFA 4QWBA 2NT1A 2EPOA 3P5ZA 5LHEA 4JNZA 3TA6A 3WLHA 4QM1A 8CGTA 3MA8A 2DIEA 3QZEA 2OZ0A 3EBVA 4HKPA 4W5UA 4AUBA 2PSNA 3MBFA 4J3WA 3RBEA 1XIHA 4U5KA 3BE7A 1NH6A 1SQ7A 1S2AA 4MKNA 1RA5A 3GUGA 3N2MA 3R79A 3KDOA 4UTFA 1AA1B 4E2OA 5GVJA 4IFOA 1W3KA 1REQB 4B3KA 1M7JA 2QIWA 5C2XA 3TC6A 1QBAA 1EPVA 4JD4A 4DL5A 3RN6A 4DVOA 3VIFA 3BGJA 4U10A 4O4VA 4HA4A 1QNVA 1V02E 1GYMA 4TXEA 1JR1A 1K8CA 2XINA 3C2YA 3IAQA 5FCZA 4ADSA 4ERIA 2YPIA 4QSFA 1HVQA 1UD3A 5KZ6A 4C6NA 1MSSA 3AYVA 4MKSA 1EQPA 2VUYA 1Q13A 3BO9A 4O19A 2VFHA 5LXEA 3VGHA 4J3XA 4Q8MA 2XH2A 1G94A 2DGAA 3PVXA 3F4CA 4J2PA 1EOKA 5F2GA 1OD0A 1VEOA 1UWUA 3TJXA 3N4AA 1JYXA 5AC6A 3KM8A 3QTGA 5FJIA 4HHPA 4XKMA 3AHXA 1GZGA 2G3MA 4N42A 2YB1A 5AKQA 1TRDA 2GLKA 3FLUA 1S0NA 1F3EA 1QPRA 4AIOA 3QV6A 4FR6A 4N9EA 2YL9A 4YMZA 3FXYA 4HHHA 5BOFA 3OIHA 4FIRA 3TR2A 1HIZA 1IEXA 1WCGA 4BY3A 4IIFA 1BAGA 1G01A 4DUVA 2VKZG 1JZ5A 5H1WA 5HPCA 4ECWA 2QJMA 3GH7A 3WMBA 3R7MA 4PUNA 3JUGA 1LBLA 3WELA 3UR8A 1K02A 1D3GA 3FFSA 2WMHA 4JTUA 4LQ1A 3LUTA 2OTDA 1C8XA 4L61A 5A2CA 5K4XA 4GI4A 1OYCA 3S6DA 3VTRA 3UZ5A 2PWEA 1B54A 2I14A 2FJKA 4RNMA 5J5RA 1Q66A 2G3NA 1HKJA 4AF0A 5D2YA 3DDMA 1XP3A 3XISA 4PEEA 3W1TA 3GU2A 3USBA 3D47A 4RDYA 3QEZA 1O6IA 4F8XA 5D8ZA 3W83A 4ALDA 4TX6A 1HKWA 3APYA 3W00A 1QT1A 5HJXA 2PWHA 1RPKA 2ZIDA 3PZUA 3L7RA 1DJHA 4GUJA 5M3WA 3B9NA 7TAAA 3KUMA 3GR7A 3UR5A 5AZ1A 1VFMA 3S5NA 3G6YA 1JPDX 3PWIA 4ERAA 1IXOA 1IQ8A 1JFXA 1VYSX 4GISA 3LCLA 2XYLA 3A5FA 2ZRZA 2CKSA 3MY9A 2HPMA 1DIDA 3RB6A 1IZJA 2YXXA 4DUOA 2A21A 2WNNA 3ORWA 1ECQA 5CKSA 4NQ1A 1YW1A 3B05A 1BTCA 1MQQA 1E5NA 1EZ2A 3KVJA 1DQWA 4UR7A 3LXBA 4UMBA 5D2XA 3V0UA 1G9HA 3T81A 1QI3A 3ZSTA 3K1GA 4MGGA 1JPKA 5A6TC 4WXYA 1NF7A 3W53A 3A3HA 1BF6A 5JIWA 3G6LA 2AL2B 4G2DA 1TWZA 1FH8A 3F7JA 4LUYA 1RYSA 1JCLA 1UH3A 1MUWA 3MBDA 2WZMA 2AGKA 5D03A 4IRKA 5AHIA 3WX7A 3USZA 4Q8OA 5FL1A 2NQ9A 4GVHA 3FDSA 4H7CA 3UFYA 4QROA 5TD4A 3TYDA 3AHZA 2J78A 1DTUA 1RSCA 3M0MA 1CWYA 2F2HA 4DN1A 3BG9A 4H8UA 3LCGA 4KKXA 2PP0A 4RNOA 4V15A 2W7OA 3WF2A 3BAIA 5E0FA 2PBGA 3TTSA 1D8CA 3AUJA 2NX1A 4XD6A 4YVPA 4XAZA 1CB7B 2PTXA 2VZVA 2JF6A 2OEKA 3RAXA 3TLLA 1JCJA 4DM2A 3CMGA 4D71A 3WH5A 1P1XA 1MW3A 3F5LA 1CGWA 3RIKA 4AZHA 3WDHA 5F9LA 4IMCA 2XVLA 3SY5A 1TTQA 4GC4A 4EPEC 3CEPA 1SYTA 4GZ7A 2ZXAA 3M4HA 3HPAA 1M7PA 3E6EA 1I6NA 3WLQA 4H9XA 5J8LA 4AXKA 2J7HA 2A85A 2FFCA 2WO5A 4GK8A 1V3HA 3BJSA 4L6OA 2QUNA 2FMNA 3U3HA 2F6KA 4JICA 5L9XA 1JYVA 4QS5A 1UP0A 2G5WA 3FSTA 2B7OA 3NO3A 1WDPA 4YR0A 4ASTA 4AY1A 4XQ6A 1OT1A 3PC0A 4NZ1A 3MHFA 3NPVA 1W54A 4GX9A 1IHIA 1HNYA 1XYBA 3S1VA 3RBDA 1NY1A 1KRCC 1X96A 4PTXA 4UOZA 3PNUA 3RR1A 1K7XA 1K7EA 1XW8A 2QJJA 1J5TA 1EYEA 4Q3MA 1AH4A 1B3WA 1AQHA 4YR3A 5TQLA 4MVAA 3NNTA 3NSXA 3TWAA 4Q4QA 4DO6A 1ITUA 1HL2A 4YXGA 2ZZ1A 3P82A 2MANA 1PKLA 1P6CA 2WHMA 2ZADA 4PZVA 1UHVA 5DT5A 3TR9A 4OWGA 3UY7A 6REQA 1VENA 1XLMA 1OG6A 3KP0A 5FEPA 3VIIA 1KTBA 4JFSA 2QS8A 4AHPA 3KZPA 5D2TA 2FGZA 1XV8A 3BOXA 4CEXC 2A3AA 5MF5A 3MP3A 4PEKA 4I7WA 2ISWA 2H90A 2PRHA 2FHFA 3OLGA 1BXNA 1E4NA 4GCXA 2UY3A 5JXQA 4JL1A 4MB5A 3GTHA 3M9YA 4FALA 5DCEA 1S10A 2VR4A 2GJPA 3FNDA 1TV7A 2W8KA 4CEUC 4GXMA 2GVYA 2WVVB 1FDJA 2OZTA 3PF3A 1K9DA 3IJ8A 4F0MA 1VR6A 3OZPA 3BXWA 5EGRA 1T8XA 1ML1A 3H40A 2ZX6A 5TF0A 1EGVA 4AWUA 1YADA 1SW3A 4QXIA 4JDYA 3N1AA 4H19A 1NFPA 2TODA 5DXXA 3RLGA 4MM1A 4B5TA 1KV8A 1KBBA 5LNSA 1FXPA 5A6BA 3PZTA 1L6FA 2Z27A 1Z69A 3FX4A 3QLLA 2J7BA 3NXFA 1EIXA 2CW6A 5TIMA 4R9XA 5EKYA 2F7FA 1CT5A 3N9KA 2J13A 2BWGA 2G96A 2H3BA 4XBJA 3VNZA 3W38A 4AFYA 8XIMA 1I1WA 3DFTA 3QFEA 1R3WA 5C8BB 4Q4KA 2NSXA 3ERPA 2QIIA 1CGYA 4UFLA 5F4WA 1E0VA 1IEIA 2EKGA 4MB1A 1AH3A 3SM0A 4MNMA 2QJNA 3UA4A 1UR3M 2POTA 4NJGA 4CU6A 4K6AA 1VBJA 4C6FA 4HGXA 2AQOA 2JEFA 2R24A 4G6CA 3WK0A 3GH4A 3V16A 4S23A 2IMRA 2VDIA 3GXPA 1KM0A 2G37A 5C2GA 4ADUA 4D8AA 3G0UA 2GUYA 1YMYA 4HNUA 4O1AA 4HOWA 2QVNA 2XVPA 1U1UA 4C6DA 4E38A 2CIPA 3FA4A 1JD7A 3AMDA 1UKQA 5D38A 3GQYA 1KTCA 2OSYA 4IOTA 3BJTA 4O15A 2QVHA 3UG8A 4ACZA 4OTKA 1WE5A 4U2ZA 3FYOA 4QWDA 1OM0A 3UPBA 1ADOA 3GDRA 1M3UA 4PC8A 3SZ8A 4HPGA 1IE7C 3GWQA 1D2KA 3QYQA 3W6MA 2R1PA 3LGDA 4NX5A 1G5AA 2X7WA 4AWSA 4XAYA 3H26A 4YU1A 3WUEA 4HQVA 1C3FA 2W9BA 2WMIB 4KFPA 1GVRA 2V63A 3ZOAA 3T9PA 4NZ4A 3VE7A 2BOFX 3LCHA 3CIWA 3PS7A 4F9JA 1TZZA 4NJJA 5FJPA 2QDEA 4W4QA 4UC5A 5T91A 3R2GA 1GGOA 2BQUA 5DCBA 3WNOA 4ZQPA 1BRLB 1JPIA 3GB6A 2WJDA 1U83A 1UG6A 3A24A 5FJRA 3JS3A 5CC6A 1PWMA 3N2OA 4M6QA 5CXPA 1LWHA 1XBXA 1BXBA 1JD9A 2G3FA 5DLCA 3PAOA 2J25A 5E1QA 1GZ1A 1JYWA 2FDSA 4O28A 5LGXA 3VKKA 2Y5SA 1RVKA 3QC0A 5BYWA 2OMAA 3F03K 3TDFA 4CD6A 4KPLA 1H1YA 3DIPA 4M6VA 1DJWA 3SCTA 4HOZA 3WKZA 4RNFA 4IGHA 3AIRA 3NOEA 4GWEA 4IQLA 3BW4A 3JZEA 2ANUA 3MDUA 4NZ5A 3BQ2A 1ME7A 1I2PA 2R6OA 1XFCA 3L4UA 3KLKA 2RKXA 5JBFA 2BVTA 4CNTA 5KT6A 3C61A 4WJEA 1PCWA 2CLLA 4L6DA 2DSWA 4B15A 5CG7A 4JGDA 4OFCA 4JHMA 2R8WA 1MQPA 2PURA 4E8GA 2PTWA 2WWCA 4B5VA 3NIYA 1GOIA 1LUCA 3EAUA 1SO5A 2PRLA 2PCQA 2LLEA 5E9XA 3QQWA 4CU8A 1VD6A 3GFXA 1OHLA 3SW6A 5EU9A 1KXQA 3NZQA 1BWLA 5CBIA 2PDQA 1K1QA 1QNOA 4UMAA 1JDFA 5GPRA 1ADSA 2I56A 4GO8A 4O1FA 2ABAA 4QLLA 1J0JA 1JRCA 2Y5JA 4QG8A 5D32A 4J9LA 1EHNA 2BS9A 3W70A 3NGFA 1BTMA 1RD5A 5AYXA 1O94A 3KZSA 1XINA 2RFGA 3O06A 2EF9A 2GFTA 3L21A 4FBTA 3CZJA 3FKRA 1ICPA 5IHRA 2RAGA 4J40A 3EX1A 1D3CA 2ZUNA 4QCFA 2ASLA 1ONXA 1EJRC 3TCEA 3KHGA 4MDOA 3NZ1A 1C92A 4KEMA 3F5KA 5KMYA 1B4KA 4QE1A 1XYMA 3E3HA 5D09A 3C2EA 4LAZA 4JIEA 3MI3A 2C1HA 3W7NA 2W9CA 4XZLX 1WDRA 1TG7A 4Q8PA 4AHQA 1E6SM 4K37A 4P7LA 3I6TA 2XCAA 1FY6A 3WD2A 3RX3A 3L5LA 4TVDA 3QPZA 1DJNA 4YN5A 3FS2A 2QT3A 3CHDA 4MNKA 3LPOA 1DORA 4BS0A 4LUTB 5BMXA 2QDDA 1OYBA 2GSHA 4XZMX 4FOUA 2EHHA 2E5BA 5EWFA 4GYPA 3SCPA 4CCZA 1GG1A 3QM3A 1UA3A 3P74A 4RE3A 1RBLA 3MO4A 4JX4A 1Z41A 4E8DA 4F9DA 2J8TA 2BV9A 3KL3A 3T4CA 4CD5A 1DQXA 1IEWA 3P8IA 4U28A 2WB5A 2PC8A 1UMYA 4JY9A 4GC7A 1E6ZA 3OBEA 4IL0A 5A2AA 1UBPC 3LTPA 3U2OA 4JXCA 4AWTA 4FS9A 5IFPA 3PVFA 2BVDA 4HHMA 3MV01 3SY1A 4MSSA 4MZ8A 3AYSA 3OHIA 3ATYA 2ICSA 5G1MA 4WSHA 4DF0A 1VCVA 3OVGA 4AZCB 3CQIA 4RV3A 3HURA 5IXEA 2XWDA 5BZAA 3BGAA 4QEHA 1HL8A 3KWXA 4E3VA 4GI8A 3I6RA 1W9XA 4RZBA 2BGNE 4GJ1A 1NP0A 4N0RA 1NFGA 1DKWA 1GQLA 4I5UA 5HMEA 5MHBA 4DO7A 4QW9A 2D0HA 4TVCA 2A6LA 1BYAA 1Q85A 3FK4A 1XDJA 4FZIA 3EDFA 2BTMA 4YVVA 1UJPA 2QCGA 1R3QA 5M2FX 3NL3A 3UCQA 4ZEPA 3BMWA 4C6CA 2VC7A 3Q65A 3RRAA 1RP9A 1LLZA 5KFYA 4N9DA 3GLCA 4L4OA 4JV1A 4KRTA 3TC3A 4ED6A 2PS2A 5F4XA 3G1DA 4G7FA 4H9TA 7ODCA 1HJWA 4P8WA 3ZWTA 3TYZA 4NJIA 3GVVA 3GYCA 4C6LA 2IUZA 3ZJ6A 2XN2A 1B0IA 3C2VA 5A2BA 3LDVA 1W5QA 4C6JA 1RQEA 2CLKA 4IGMA 2DH3A 3A5VA 2ZXDA 3UNTA 4JEJA 3GG7A 1V0KA 1KCKA 4RPQA 1UROA 1WQ5A 4HU0A 5CSRA 3V5OA 3FIGA 2YCLA 3W29A 3WFLA 3RR4A 4OJYA 1H62A 4OUIA 4ICCX 1RHCA 4M7TA 4W8BA 3U57A 2BX7A 2H9AB 5I3IA 1PIGA 5CPLA 3SDOA 4GNJA 2DEPA 4A05A 4XD3A 1TV3A 2D2JA 3D5HA 3ITOA 1EZWA 3LBMA 5I09A 5AYIA 5LIXX 5D37A 3T42A 3LCWA 3CTLA 4H1ZA 2BGSA 4ZTXA 4WIWA 2Y62A 3MR3A 2BP1A 4DYJA 3SSJA 4JCMA 1E4IA 2NUWA 6XIMA 2IPWA 1LDCA 3CU2A 3G6MA 5CZTA 2IKHA 1Q6DA 1GVIA 1U33A 1OFAA 4AWEA 3NZRA 4DL2A 2C7FA 5C2CA 1BVNP 4HZ6A 2FLLA 1Z6KA 1JFHA 5REQB 3SRHA 4PUWA 3LB0A 4A3UA 2ZC1A 2J75A 3O6YX 1DEDA 2R14A 3WQCA 3ARZA 4XO6A 3GBDA 4FLQA 3W1LA 4YVXA 5JBDA 3DBNA 4I6KA 4MWAD 4Q32A 5C5YA 2Z1VA 5U7SA 1TWIA 5FJUA 3BCJA 3AXIA 4KS0A 4WLCA 5DGBA 4TV5A 4P8UA 5IRPA 3PW5A 2DVXA 3F2BA 5E09A 2YLLA 4JKMA 3VD5A 1WKFA 1LP6A 1KCXA 4JBRA 1OB0A 1OX5A 4PMYA 3CO8A 3ABZA 1UYQA 3VGFA 5DGAA 3UXLA 1VEMA 4XIAA 1TVLA 2CLPA 2C2RA 1SW7A 2Q02A 1W2VA 1UIOA 1FWBC 3N2CA 5HANA 3O6CA 2OOGA 4AIBA 4A8RA 2P8BA 1O1HA 4LVBA 4X0NA 1WBJA 3NO5A 1SZRA 2X8RA 2I5GA 4BWLA 1XX1A 2IA6A 1XISA 3OOQA 2X2YA 1T40A 5BU6A 3PPFA 4EEYA 2YXOA 1V51A 1TPEA 4W85A 3OHMB 5KFFA 2WJZA 1DYSA 3O3RA 4DAFA 5K4ZA 1TWDA 2E8ZA 5KZEA 4C65A 5KFZA 2V5CA 1XUZA 4I3GA 3NL5A 3C3NA 3GC5A 3PSWA 1HL9A 4QX4A 1KCLA 1P0KA 1TPFA 4GYJA 2QF7A 5KFSA 2BY2A 2YDRA 1QATA 4KERA 4EVZA 1XIBA 4L9YA 4TTUA 4MKVA 4YYCA 4FNUA 3W37A 2NSOA 2PP3A 5EWEA 3WK2A 4DJDC 5JH1A 1XYCA 4RNJA 4HZMA 1VBRA 1LROA 1X7IA 4Y7EA 4JFWA 2YLAA 1W3IA 4GO9A 2B81A 3QH2A 1XLBA 1I8JA 4LYQA 1R87A 4IPLA 4HP5A 1M01A 3MSYA 2NV2A 3G3MA 4BKNA 2XPKA 4H9YA 6XIAA 5DQHA 1PHWA 3VCNA 2X1TA 1NU5A 3RMEA 3URNA 2TYSA 2CBIA 1JAKA 4UTUA 1VFLA 3B9DA 3N12A 4Q8NA 4D2JA 4W87A 1YTKA 4N4QA 2O7QA 3MC5A 4RDZA 1QNRA 2VX7A 3CASA 1VCFA 1LQ2A 2E6YA 4REQB 3P7YA 3QY7A 5L1LA 5FEWA 3RUBL 1JZ7A 3O15A 1JULA 1H1NA 3CUGA 3PZMA 3SN4A 1EA0A 3KBNA 1GONA 1QNPA 1W1ZA 3KVKA 3SQLA 4ZR8A 1LWIA 3QV8A 3CUXA 1XLFA 3VX0A 2QGHA 4OU1A 4DIAA 5ABTA 2REQB 3RGTA 2CLIA 1KNWA 4GYPC 2VEMA 2HTMA 2B7QA 4UNKA 5G2IA 3H7VA 1CECA 1TFVA 3DFHA 4M5PA 3KOXA 4G7EB 2GWNA 3QV9A 1K8ZA 3QMTA 3NUKA 1V3KA 1HUVA 1OX6A 3IJQA 3LCIA 2F84A 3ANVA 3O63A 4PTWA 4XZNX 5CPSA 3MS8A 4KCVA 3VYLA 3STCA 1TQJA 4EAYA 1AJZA 1E4MM 3IIZA 2RDWA 3KLLA 3QW4B 4UMCA 2CLEA 3TSMA 1ZBKA 3ITLA 1P6BA 3VZZA 5XIAA 2BXZA 1DL3A 1YLVA 2R1NA 4NVTA 2P50A 2WKGA 1A80A 4NX0A 2FPYA 3VILA 1IGWA 3FGCB 2POZA 4FBUA 1S0MA 1DIKA 4UZUA 2V68A 1XIDA 1AFSA 5BXTA 3ICJA 1YXYA 4PULA 3NVDA 4DZ5A 1ZB5A 3GC2A 4NILA 4Q6XA 3A4AA 2DZAA 3I65A 1G4EA 3SCSA 4UQAA 4LSBA 2QCEA 3M5VA 2GOUA 4HK7A 1REQA 1PL9A 3M0ZA 3RAQA 1PX8A 3DI0A 3SY8A 3CWNA 4HA1A 3S6TA 1M7XA 4ED0A 1XRTA 2A3BA 4DJFA 4MHBA 5CBJA 2FHCA 4FLOA 3KOYA 1O5RA 5CBBA 1TSIA 3BLDA 3EZ4A 3ARTA 2XM1A 4EBCA 3ARSA 5EDWA 2ZUMA 5G1TA 5SWUA 3URBA 3H2AA 1EJXC 3SB0A 3OVQA 3PZPA 3CWOX 3AUOA 3NPUA 4LH8A 1O12A 1AK5A 2ZICA 2Z28A 4WHBA 2ACQA 2Y6ZA 1LG2A 1PV8A 1Q6EA 3QOMA 4JNMA 3KOWA 4PODA 1AQFA 1J4EA 5H91A 1U5VA 1QWKA 3UXIA 3T7VA 2J62A 3Q2DA 4R8UB 4K38A 2QCLA 4LUSA 2QCFA 2EG6A 3G1YA 3DESA 3ABRA 1ZPTA 3TW6A 1OX4B 5AC5A 1EC8A 3NQCA 5H8MA 3U2CA 2FPVA 4ZENA 2WKLA 3QPEA 1K9FA 3BVJA 2EBNA 3V6JA 4IX0A 4FMVA 4HCLA 4IRDA 2VFIA 1AH0A 2F2KA 4JFUA 5AY7A 1S3HA 3DFSA 4U31A 2VZTA 1GEQA 3BLKA 4ZB2A 5FJTA 2VX5A 2Z24A 3GIJA 1YEYA 4JTRA 5FJOA 3SIMA 4DWDA 1LOQA 3IIOA 4C6EA 3UJ2A 1F05A 1H2JA 1BVWA 3GHTA 2Z2AA 2HE5A 4JN8A 4F3HA 2XG9A 4INFA 5CJNA 3LHVA 4O3SA 3A22A 3PG9A 1VS1A 2J8FA 4C6QA 3XIMA 5KFRA 4I7VA 4W5ZA 4HCDA 1RP8A 4OZOA 4JQ1A 3HPXA 3SCOA 4S3CA 3QLDA 3TN6A 1UQZA 2GSJA 2NXIA 3BZJA 3VMPA 3R13A 4UOQA 1WDDA 1QCWA 2XM2A 4GIYA 2VQTA 2GPTA 3LBCA 4WXZA 3W1RA 4D6CA 1CGTA 4CKQA 1QI4A 3KAOA 1JEZA 4WX2A 2EKCA 4LF2A 1J0YA 1H7RA 1XYLA 1M53A 2JEPA 4B91A 4GZIA 1IWBA 2YA0A 1PZ0A 2PMQA 3K1DA 3ZO9A 3GAYA 1CXEA 2ZUUA 3WCZA 1JCMP 3GHUA 1OC7A 3KFTA 5J04A 4UTJA 3BV7A 1QDSA 3AO0A 3FOKA 3HIJA 5EPDA 1OF8A 4I8DA 3R6IA 2CZVA 1I4NA 2VT0A 2ZVRA 3W72A 3C0SA 3GKAA 4AHOA 1TX2A 3QZ8A 1E6RA 4R3UA 4TU1A 4H6EA 4DL3A 1H7WA 3R8RA 4GVFA 1UWTA 3H23A 4DL6A 4JKLA 2PDWA 4CCDA 4HTYA 4DJED 4WDTA 1QI5A 5FF3A 3B0UX 2X2GA 5ABEA 1KFJA 1A5CA 4UCGA 1V77A 4JTSA 2G41A 3N29A 5F1UA 4L64A 5CGTA 1KFEA 2DT0A 3M9MB 4C6IA 4J9SA 4PCPA 1J96A 4GE8A 4PCFA 4Q45A 2B0MA 3IVUA 3A9IA 4LVGA 1ZAJA 2VI0A 1W56A 2VX4A 3NO1A 2ZKMX 5GNYA 3K2GA 3VIJA 3EWYA 3BCFA 4ZA0A 2ZTJA 4HNOA 4NIRA 1JF5A 4UQCA 3NOYA 1B30A 2ZRWA 4B3LA 5GNXA 2Q8LA 1Q5MA 1LUCB 1ALDA 3VUPA 1TCDA 3HFYA 3LTYA 4S3FA 1B2YA 2PDGA 1HQTA 5AN7A 4H9VA 2D23A 3QW3A 1S9FA 4MAZA 4AX6A 5EB8A 3LERA 1H60A 3E0WA 3S1GA 1J11A 4QAWA 2RDIA 4XAFA 4EX4A 1MXSA 3OZMA 1C91A 1VP5A 3IARA 1PTGA 2OSXA 3P6LA 1F73A 4FS1A 2E8YA 3E12A 2VGGA 5AHFA 3GNDA 3AHTA 3KRUA 3L2IA 5FF0A 5EYWA 1UW9A 2WC3A 3M41A 3EWXA 3V6KA 4XX6A 3TXZA 4GZEA 1FBAA 1DWHM 2GK1A 1HP4A 1TIWA 3MANA 4LCSA 5DG9A 2HVNA 2OEJA 4XG1A 1SR9A 1CB2A 2X16A 2R9RA 1A5NC 2PWFA 2G8ZA 2XFRA 4DZHA 1X1OA 1W3TA 2HXUA 3K4WA 5A8OA 1L6YA 3RU8X 5DXYA 3WN6A 4FP1A 1UPMB 5KEZA 2EJAA 3FW6A 3SUWA 4POCA 5AVHA 3ZVHB 5H2ZA 3KE0A 1WZKA 4EPKA 3LSBA 3GS6A 4UTLA 4NI3A 1GT8A 5F2IA 2J79A 2GGHA 1P43A 4A2SA 2BY3A 3TUUA 1D3HA 4DQWA 4O54A 3S2CA 1FCQA 4LW7A 2DIJA 2CKRA 2WNZA 4UBPC 4PN2A 1CYGA 2PDUA 1K8YA 4B2DA 2NXHA 1BD0A 3LYEA 5LIWX 1VC4A 1PWLA 1G1YA 3AMLA 5D30A 1MW0A 2XCPA 3ZLHA 4DWSD 4DHGA 5LA1A 4KFOA 3B9EA 3ZMRA 4IXXA 3I4EA 3B0VC 4DJDD 1QU4A 4A8IA 3C52A 1LL4A 1JCXA 1U2YA 3VD3A 4WR3A 1TE1A 2J9YA 3N04A 1F9CA 4L80A 4S3GA 1ZFJA 4PUUA 3UCDA 4L4MA 4TV6A 4RUCA 1UR0A 2RDJA 1PZ2A 4I6VA 3OO2A 2H8ZA 4XK2A 1LZOA 3VIMA 2GGEA 2PB1A 1TMQA 5DN1A 3DGRA 1ISZA 3M0IA 5MKGB 4UNLA 2PDNA 1N55A 3KCOA 4H01A 1HGWA 2IXVA 4GUHA 4GNKB 4FO4A 3IV3A 2WKJA 3AS0A 2DW6A 3IVSA 4PMNA 2UVVA 1RCOB 1WP6A 3STFA 4PFMA 2PWVA 1ITQA 3MW7A 3GIQA 2VRQA 3LMYA 2I9EA 4O10A 1TR9A 3PB0A 1M1BA 4AZIA 4C6KA 5HNTA 3QMSA 1EJWC 3T8QA 4R85A 4KWOA 2P76A 3L23A 8XIAA 3NYZA 1R9YA 1KFKA 3D3AA 4W8LA 5AC7A 5AC4A 3ZJ8A 1C8YA 2O0TA 4C6BA 5HUOA 4GXPA 1Y5VA 2NT0A 3PTKA 2XVNA 1P48A 4AH7A 4V28A 1S5TA 2GSEA 1TJRA 2PDLA 2ALRA 3O05A 4B9ZA 3BAYA 2ATLA 3WL0A 4WQ6A 4KGJA 4TMBA 3TROA 4ADTA 1WZAA 4G1KA 3ES7A 1TCMA 4ML9A 2WQDA 3W6LA 2PCEA 1HXJA 1KBJA 3NPWA 3K13A 2DW7A 6CGTA 1K77A 2HSAA 3PTQA 3H24A 2A3EA 3BICA 4ORIA 3M07A 1TR1A 3CPUA 3BQ0A 3P84A 3I7QA 1QMLA 3IUDA 3FAWA 3WLRA 5L6UA 3U0HA 4HK5A 5DY2A 1W9DM 3DHDA 2NLIA 4KFNA 1DWAM 4FPSA 3S2NA 4D8LA 2ZWZA 3RCNA 4F79A 3I10A 1AG1O 5AYZA 4AZBA 1EX1A 1JI2A 2C2EA 1RR2A 4H3DA 4LC6A 1GKPA 3O8AA 3QZ6A 3GFYA 1IR2A 1A0CA 1X1ZA 3GDBA 1F76A 4HYRA 2YW4A 3AIVA 4HNCA 5DMMA 5GNZA 3W7RA 3CEUA 5KFDA 1JYNA 2DT3A 5A5WA 4AEEA 2YSWA 1L6WA 1Z89A 4AD0A 3W4RA 5KG5A 4D1IA 1OC5A 3ARUA 4GY0A 4KCWA 2BZNA 3WF1A 4QLJA 4AC1X 3V18A 3PG8A 4MWAE 4U7CA 1LBMA 3H4GA 4QFUA 5HDRA 3GRIA 2E28A 4LCRA 2WZEA 4UTKA 1KWKA 3BG5A 1NDZA 4LYRA 1OZQA 1MUCA 4JIHA 1CPUA 3QR0A 3PUGA 1JUEA 2XIJA 1US3A 1E70M 1ZJBA 4XZHA 3G1VA 1QNSA 1PPIA 1WO2A 3HG4A 3W2KA 2PWUA 1A0DA 3AXXA 3FVMA 4S38A 3CL6A 2DUXA 3HG2A 3P3BA 2P9BA 4O4WA 3IK2A 3BAXA 1JZ3A 2YXGA 2C0AA 2Z4GA 5LXXA 3E02A 1RV8A 1UP3A 5LYRA 3VXGA 2DP3A 4H04A 4ZO9A 4IQJA 1F5ZA 5D02A 4PFHA 5C9UA 2FTWA 3GFZA 4A3RA 2ZRVA 5HULA 5LNUA 1UD8A 1DVJA 4AD3A 2FTYA 1WNOA 3KHDA 5BXRA 3WY1A 4FNSA 4WD0A 2VCBA 2C1IA 4LAMA 1N2VA 1S5NA 1U5HA 3NQGA 5CPTA 3E74A 2HMCA 4BCEA 5HJYA 4LRSA 3HB9A 1MW2A 5DBUA 1LT8A 3A4JA 2Z2BA 3UZZA 1KTNA 2BSLA 3ZR4A 4XKYA 5ECVA 2H6RA 4M51A 3KL5A 2CFFA 4QDMA 2O4MA 3QVQA 2J7GA 2TMDA 2BODX 3SR7A 1RJRA 1HO4A 1JQVA 4M56A 3WLNA 2V5JA 2CETA 4M19A 1QPOA 4K68A 1MDLA 1V6UA 3DHPA 3BW3A 3T1GA 2A7NA 2WNQA 3UJRA 1AL7A 2FH8A 3E0IA 4TR9A 4RNHA 3B3DA 5KSWA 2QDGA 5IFTA 1QVBA 3EWBX 3SJ3A 4G9PA 1JIHA 4NSBA 5DANA 4IH3A 4LGXA 1UASA 1X38A 1RYRA 2VD8A 3H6OA 4RW5A 2F61A 1ME9A 1XRVA 2DUAA 3L4XA 1W1VA 3S47A 1C8QA 3SCWA 1LORA 4I9AA 2JKEA 3O16A 3R4IA 1CIUA 1NWRA 3E38A 3R11A 3FJ4A 3WQ6A 3IAPA 3MSDA 1AZ1A 3QMRA 2RHGA 4PYSA 3AIWA 3S1XA 3GW3A 1WOAA 4NYYA 5RUBA 2VZUA 5CCZA 2Y24A 2GVLA 4OT7A 2PDBA 3HJEA 5I6SA 3VDGA 1F6YA 4E4UA 4ZVJA 1TJ0A 3MU7A 3SECA 3C56A 4ZQRA 3DUGA 3UJFA 1XS2A 1XLIA 3GSMA 1B31A 3PJTA 1XFBA 5KFIA 2QULA 5I77A 4HTBA 3L12A 1E43A 4IZGA 3CV1A 5EMYA 3OVRA 4CVUA 1FUYA 1UR9A 1DQUA 5DQIA 1Q3NA 1VHNA 4H6RA 3PP7A 4MPKA 3U5YA 1M9HA 3AIQA 1UMLA 1B3ZA 2MNRA 1J93A 1TWWA 4YPJA 3S2JA 1OSEA 4ZOEA 3THUA 2GJXB 4JQ2A 3WD0A 2NVDA 3W9ZA 2Y70A 4JTAA 4DO4A 1QW8A 5ENLA 4IIGA 1E0WA 4IUGA 5FKYA 1DP0A 3GX9A 2ASHA 1KM5A 4Y8EA 1ZQ5A 4YTTA 1UJQA 1JAEA 2XIBA 4A29A 2CWXA 3CH9A 4W7WA 1TVPA 4O14A 2HS8A 3WDQA 3QY8A 1KRMA 1OVDA 5HQLA 1AVAA 1HFBA 3Q8PB 3BURA 5AHEA 4GFIA 3A6OA 1DHKA 2BOGX 2ZZ4A 4Z42C 1HT6A 2GWGA 1R46A 4JX5A 1EO5A 3PZ9A 3H22A 3WDJA 3T08A 2OYLA 4H8HA 3H2CA 4AU0A 1WUFA 1GZJA 1TTJA 3GKFA 3KEHA 3O0KA 1BFNA 4LYKA 2R8KA 2YBUA 1RD6A 4CQAA 4FEZA 2Y7FA 3UZWA 2DDXA 3CGTA 2WHJA 1KFCA 5JQ9A 2Y63A 3W7GA 2QUTA 4ZO6A 3CZKA 2E5CA 4Q7NA 6REQB 2YCJA 4RR4A 1UZ1A 5DMNA 3SN0A 1R38A 4MYXA 4DI9A 1OJXA 4FOJA 3TQVA 4R5EA 1T6MA 4Q8EA 2OH2A 1UBSA 3M5ZA 3LM7A 3FEQA 4OUEA 3CZEA 4RJEA 5D04C 1SPQA 2NQLA 1E1FA 3QY6A 5LKYA 1UPPA 1DJXA 2DH2A 3MWAA 4YCOA 3DN5A 1V5XA 3M16A 3WJYA 3B8VA 3V5FA 1JCYA 6A3HA 1WBHA 5DQGA 1E0UA 3W1XA 4C6PA 3VOCA 3PZQA 2A4AA 5TAOA 1ADDA 2VELA 5AHMA 1FP9A 1JZ8A 3OLEA 3DYOA 4LS1A 2QCDA 5ABFB 4JX6A 4X2PA 3BSMA 1L2UA 3MT1A 3NCOA 4US5A 2WMFA 3P5YA 4QAIA 4O3RA 2INZA 5I00A 5DT7A 3Q8RB 3WNPA 4LANA 2C79A 1FWCC 3OLDA 3AMGA 1V3MA 4WOZA 1S5WA 1B4EA 4GABA 4F4YA 4LPCA 4XZWA 4ACZB 3G1XA 3GNPA 2V4QA 3MSGA 4OV4A 3B97A 1R5YA 3Q58A 1EP2A 4B4FA 4XISA 3WD4A 4J9JA 1YNQA 3L68A 2DZWA 1G7UA 4WZHA 3VDBA 3N4EA 1N8IA 3GG8A 3EDJA 1E6PA 5FSEC 4DEFA 4QJ3B 3QR3A 1RH9A 4XZIA 5FOOA 3T40A 2HQAA 1G4TA 5DRCA 4RUBA 3W73A 4E5TA 1XBZA 3EMCA 1TZ7A 4KEVA 5I79A 4GJIA 4MUPA 3MYOA 3QHOA 2JGYA 4IQEA 3BLPX 2OVLA 2AAMA 1H7XA 3TN3A 3RFAA 4N9CA 5KG3A 3W0KA 2XU2A 3W01A 2OODA 2IQDA 4RL3A 2QCNA 4J28A 5HAOA 5F7UA 1EDQA 3SUVA 5CPQA 1YQ2A 3M46A 1I2RA 2WANA 2QCHA 3IGSA 4UTMA 4JTEA 1TPC1 5FD0A 2DSKA 1UIPA 2R8IA 2V2CA 3U5UA 3TMQA 1KFLA 3TJLA 3W24A 4IFKA 3QF0A 4TX8A 3MFHA 4KWUA 3GTNA 1K8XA 4G7EA 5DG7A 5HPOA 1MZRA 3CAQA 3QGVA 1KR1A 1X6NA 2Y7GA 1JXLA 1Y7VA 1TPDA 1E15A 3KBSA 1MRQA 4P7RA 4DRSA 5DY3A 2YW3A 1XDLA 1EDTA 2XN0A 3H54A 3EOLA 3EWWA 4M0XA 2DZSA 3VUSA 3SQSA 4AMAA 3T09A 2PU0A 2AL2A 5DEZA 4D6HA 1YTDA 1JXKA 3OA5A 2PWDA 4AW7A 4PB4A 1XG3A 5AC8A 2VNCA 4JTGA 3UG5A 4DYKA 2ZCGA 1IXPA 3DFQA 1DXEA 4BI5A 4C5ZA 1RJPA 2ZBTA 2ZZ2A 2PI6A 1C29A 3T44A 1QI0A 3P60A 3L4TA 1QRQA 4AYGA 4D6EA 4EWND 3G3DA 2CXGA 1YE6A 3S9YA 4BJHA 2AGPA 1CENA 1TV2A 4O8AA 2HXTA 4GVIA 1L6SA 2DZPA 3AALA 1A5KC 5BXPA 4WGXA 2BVWA 3VCCA 3IUIA 1GUVA 3ZLGA 4BHYA 4L4PA 1C7SA 4DJDA 3KBJA 5K2ZA 1GJUA 2JIWA 3MWCA 3N13A 1AW5A 4UXDA 3VD9A 4Q22A 4UQBA 4U6PA 2OJPA 1TA3B 1V6TA 4QR6A 3MUXA 3LNMA 3RCMA 4XUGA 3VNYA 3N2XA 3T0CA 2P1FA 4TIMA 1GTHA 4V33A 3CS2A 1KCZA 3EPGA 4J3ZA 4AXNA 3WFAA 1FWRA 1FWFC 3IJIA 5K7JA 1F6PA 3NDYA 3DGBA 4F0LA 4IXHA 4RE4A 3RITA 4GKLA 3WDIA 4W89A 4TUFA 2G4FA 1UKOA 5T9BG 1LL7A 2A2IA 4PCTA 4UTWC 4DWSC 1OGSA 4NP7A 3W7LA 4UB9A 3RK8A 2DZUA 5CAKA 4GIAA 3TTYA 3FGCA 4LOCA 4ECVA 1E1CB 4FNTA 5M17A 3POCA 3REQA 1WA3A 5KFCA 4IPPA 1RBAA 2YDAA 3MDWA 1K9EA 4EXAA 1ZNNA 2AGTA 1I60A 2GZXA 4HYVA 3QR1A 2GUBA 2HJPA 1EJUC 1AJ0A 1BSIA 1L6GA 1Q6RA 3O0FA 2Y8KA 2WVTA 3B03A 4I9TA 2HVOA 4NZJA 1OADA 1Z9AA 1ZTVA 4RV8A 1H7NA 4O3PA 1BYCA 1W1IE 2PDHA 9XIAA 4Y9PA 1ONEA 3BV4A 1QOQA 3N73A 1Y65A 3APGA 2R1MA 1PEZA 4HJWA 3ABSA 3ZJKA 2O4QA 4Y9NA 1I45A 2XH7A 2XISA 2CYGA 3IVTA 3LXAA 1VLIA 2NV1A 3W7HA 3OJGA 3JR2A 4Z2KA 1QK0A 3F4VA 1PUDA 2OYKA 2PGFA 1T94A 4AY8A 2W9BB 4FX6M 3M9NB 5CJ5A 3WQ8A 3BAWA 4JKKA 1V7YA 4O52A 3IJLA 3VIKA 3CAWA 4Z2HA 5CSUA 3S9ZA 3U4AA 3A47A 3U7VA 2P53A 2PUZA 2VM8A 1W1B1 4CD4A 5EL1A 1XQKA 2WLZA 4QWAA 4O8RA 2VRKA 1ITXA 2DT2A 1MXGA 4JYFA 2PDFA 5I7GA 4LCQA 4PL1A 1TV8A 4L5ZA 4Z1YA 4HHLA 1EEXA 3AZRA 2CZ5A 3FYYA 4DY1A 4JY8A 4C7DA 2W9AA 1S2VA 1WXZA 3WQGA 4KMQA 2VRJA 2DUZA 2PF8A 4Q7IA 5E9AA 3R94A 1EIBA 1W0MA 1W9PA 1N82A 4KF1A 1HG3A 2W63A 5HQEA 4WSJA 3S2LA 1KFBA 1UWRA 3BQ1A 3EWUA 3B8IA 4UIOA 3C8NA 4QJ5B 4LF1A 3UA3A 4F2TA 3FYPA 2Y5EA 3DYPA 4ACYA 1ISWA 1JGMA 1UCWA 3B8DA 1FCBA 4JCLA 3FJLA 1E0XA 3WLTA 3R12A 2C3ZA 5LA0A 3CV6A 1UD6A 4KW2A 3OG3A 1VH7A 4A4AA 2R91A 5C55A 2R94A 1UP2A 2ZUSA 3QTPA 2PAJA 1UWSA 2D2GA 1B90A 1YE4A 1M68A 3PN8A 5KITA 3W27A 4H83A 2E77A 3GDLA 3SGGA 2EG8A 3PZOA 2CHRA 5HK4A 1XRSA 5KFVA 1PIIA 2GQ3A 1LRQA 4Z2JA 3W82A 3B9OA 1YDNA 3HU7A 3R58A 5CSYA 4RNIA 1ZCCA 4JTLA 3M9OB 1WDSA 1YBQB 4IR1A 1G4PA 4NU7A 3K5XA 3VOIA 1K70A 3RM8A 2NLYA 2VVNA 4ZQNA 4CLMA 4ONVA 5A8NA 1HJQA 3MZNA 4E2VA 4LEQA 3W26A 3GVGA 3OGRA 1W1TA 4QE4A 2VR2A 2XFYA 1A0EA 1ZBWA 2BBFA 5G4HC 2ISVA 2VUNA 4PCNA 4CNNA 2W3ZA 3UWYA 3LU2A 4JAWA 3IACA 3WNNA 4AX7A 3IS4A 2TPSA 2WSYA 5T8GA 3RG6A 3HGSA 2PPGA 4ZB0A 3WF3A 3W23A 2GGGA 3MUZ1 4JR5A 3GZAA 1NFBA 1VJSA 3NG3A 1XWYA 1VEPA 3CWHA 3MJYA 1EPXA 2WPBA 4I5RA 2CLHA 1OCBA 1W9UA 3QGAC 3MO7A 3CQKA 3PTMA 4QITA 1J9YA 4A3QA 3KBMA 3STEA 2GYIA 5C54A 1Q6FA 5C9ZA 1PX3A 1Z3NA 3W2JA 4J3SA 4EAMA 5CC5A 3GIMA 5A69A 2OLSA 5CLTA 4GQGA 3QPYA 3PAJA 4PTMA 3W75A 2VDGA 3M0HA 3TIMA 4PTVA 2BFGA 2J4GA 3OSNA 1JGIA 1PX4A 5I0DA 2B31A 2ZVIA 3W88A 1OGGA 2XDFA 5E6ZA 3W7CA 3EA3A 1XGEA 4J9NA 1C7TA 2BHZA 3Q8QB 1V0MA 4Z1AA 1EGMA 1F6KA 1YRRA 3B8TA 1XUUA 3W2LA 4YLWA 1P4CA 2FQIA 4QDPA 1XD1A 1A3HA 3TAOA 3UCCA 1YXCA 3EA2A 2DU2A 3TSBA 4Q8TA 1KGWA 5A6SA 3THCA 4ZGYA 1MFVA 2A3CA 2OKTA 1QPKA 3G1FA 4PMUA 4H9ZA 1FDYA 3PBWA 5C9RA 3VU2A 4AISA 3RO6A 1XC4A 4QNWA 2Y0FA 3U6WA 5BOEA 2UBPC 1EKOA 3W2UA 2X7VA 4HN4A 3MMTA 3TN5A 3KVMA 1R6WA 4MFEA 3CUJA 4ED8A 4C6OA 1GORA 5CSSA 4GBDA 1O5XA 3N3MA 5KFNA 2D0FA 1F8MA 2C1GA 2HROA 2WNWA 4R88A 1PYMA 3RM9A 3AYRA 1K3UA 2W67A 1O66A 1XIEA 4JIIX 2C6QA 4EYHB 1XLLA 4IISA 2V5DA 5C70A 4K39A 4IL2A 5FF4A 1YKWA 5F1VA 3M0KA 4IF2A 3N15A 3NQDA 3H12A 4Q4SA 2NQJA 4N02A 1UR2A 4Z1BA 1RBOB 3ZS4A 4YS1A 1VYPX 1ZAHA 4YWIA 5EMLA 3L5MA 5HMSA 1MI3A 3GBEA 2REQA 3R0DA 3O6DA 3WQ5A 2I57A 2G3JA 3IJ6A 4QEEA 1FRBA 3W7JA 1W5MA 2AKMA 4BA0A 3M7SA 3UYIA 1XYFA 4IGSA 2J6XA 1T8QA 3PZIA 5D33A 4WCJA 4G1NA 5E93A 3WLOA 4EPBC 1ZENA 2V67A 3PPHA 3H55A 4XTIA 2B4GA 2J74A 4X63A 1SW0A 1Q8JA 5A6LA 1A5BA 3AMCA 1A50A 2EXOA 2PGWA 3CQHA 4H41A 2ATMA 2YFOA 4FF5A 2VO5A 3PJUA 2W6RA 3SI8A 3OA3A 4D72A 1TUXA 4GIRA 1UH4A 2PLMA 1S46A 3BMXA 5A8QA 5GQBA 4K8HA 4QG6A 2WYSA 3CLWA 4L9XA 3WLJA 3KP1A 1PS9A 4J4KA 1O5QA 2JE8A 3F2CA 4KCTA 1CXIA 1Q65A 3G6VA 4OGZA