1YMYA

Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
382
structure length
376
Chain Sequence
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-acetylglucosamine-6-phosphate deacetylase
publication title Crystal structure of the N-acetylglucosamine-6-phosphate deacetylase from Escherichia Coli
rcsb
source organism Escherichia coli
total genus 115
structure length 376
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.5.1.25: N-acetylglucosamine-6-phosphate deacetylase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1ymyA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ymyA02
2OQLA 4QRNA 2Z2BA 1JGMA 3GTFA 1KRMA 2R1KA 3UPMA 5G4HC 2UZ9A 4C6MA 1J6OA 4LH8A 2PUZA 1I0DA 4IQJA 3GRIA 3TN5A 4GK8A 3S2NA 2R1NA 2Z4GA 4DLMA 3FEQA 5FSEC 1YBQB 3GGMA 1EZ2A 2QT3A 1K1DA 1P6BA 4R85A 3B40A 2BB0A 1GKQA 1QXLA 1RK6A 3UR5A 5HMEA 3LA4A 4F0SA 4H9XA 4AQLA 1KRAC 3LU2A 4LALA 4KEUA 4ERGA 3QGKC 2OGJA 4B3ZA 3WZ0E 2GZXA 3LNPA 3TN6A 3WMLA 2VC7A 4UBPC 4KQNA 4OFCA 3GU9A 1R9XA 4C6CA 3F2DA 3QY8A 1A4MA 2EG7A 3DUGA 4ICMA 4BY3A 3D6NA 5HMFA 4J2MA 4EPBC 3AU6A 1EJRC 1ONXA 4RZBA 4KEZA 1IE7C 4LAOA 3T81A 3MPGA 4PCPA 2Z2AA 3V7PA 4MUPA 4Z42C 2HQAA 3HM7A 3JZEA 2WJFA 4C6IA 4QSFA 3F4CA 3HTWA 4C65A 4C6EA 4LAMA 1VFLA 4EPEC 4WGXA 1UMLA 5E5CA 1DPMA 4LEFA 2EG6A 3OOQA 3IV8A 3IJ6A 2DVXA 3O7UA 3DC8A 2Z28A 3UBPC 4IFKA 1GKRA 3SO7A 4CNSA 5LXXA 4CNUA 2ICSA 4H9MA 4DLFA 4QTGA 1E9ZB 3C86A 4TQTA 1NDYA 5AKQA 1M7JA 4L6DA 1P1MA 1J5SA 2FFIA 2Z7GA 3FDKA 1M68A 3E38A 2Z25A 2I5GA 4C6JA 4C60A 3EWDA 1PTAA 3F2BA 3B0XA 4DIAA 1EJTC 3S4TA 2P53A 4GX8A 4J35A 4LAKA 4NG3A 1I0BA 4HK5A 1RJPA 3URAA 4IFKB 1A4LA 3LSBA 4LFYA 2EG8A 2Q09A 3S2MA 4C6KA 1R9YA 3A4JA 4XD4A 2YB1A 4BKNA 4KETA 4C6BA 4AC7C 3N2CA 1W1IE 1YMYA 4DYKA 2FVMA 4RDYA 2HPMA 3E0FA 2AMXA 3QY6A 1UBPC 2VUNA 2G3FA 4IFRA 3MDWA 3PBMA 2HBXA 1XGEA 4CQCA 4XD3A 3CS2A 2Z29A 2BGNE 1V7AA 3OQEA 3IARA 3GU2A 4GBDA 4DZIA 3MDUA 4EP8C 4G2DA 4HJWA 1A5NC 1EJUC 1ADDA 1UIOA 1A5MC 3K2GA 2RAGA 4QROA 1FWHC 1V51A 3IACA 3ID7A 4NP7A 1QW7A 3EWCA 2AQVA 2R1PA 4H9TA 4YIWA 3ICJA 3WYZA 2GOKA 2KAUC 2HNHA 3QGAC 3CJPA 5CH9A 3T8LA 1FWBC 2D2GA 3PNZA 4INFA 3GUWA 3LS9A 4RDWA 3QY7A 2WJDA 4CQDA 3GTXA 3NURA 1ZZMA 4EPDC 3FDGA 4F0LA 4XAFA 1ITUA 1XRTA 1YRRA 2CZVA 1FWJC 4C6QA 3KM8A 3MTWA 1E9YB 1FKXA 4IH3A 2DVUA 2UBPC 2QS8A 1POKA 4ZSUA 3TN3A 4ERIA 3E0LA 4WVXA 4DI9A 3GIQA 2PLMA 2O4QA 4QS6A 4DNMA 3S2LA 2ANUA 2OODA 4F0RA 4UB9A 3UR2A 1RA0A 2QPXA 3URQA 1ITQA 1NDZA 4GZ7A 1J79A 2D2JA 2WM1A 3UF9A 4RDZA 4I6VA 1RA5A 2I9UA 4IG2A 4I6KA 3K5XA 2P9BA 3F4DA 3MVTA 3ORWA 2GWNA 2E1WA 2PGRA 3E74A 3SFWA 2Z00A 4HK6A 3RN6A 4KIRA 4CNTA 4LANA 4EPKA 1R9ZA 1RAKA 4RDVA 4XAGA 3PNUA 2P50A 4PBEA 4H9YA 1YNYA 4GOAA 3K4WA 1M65A 2YXOA 4HK7A 4C5ZA 1S3TC 4IF2A 3E3HA 4DI8A 2F6KA 3ITCA 4P5UA 3TNBA 1FWAC 3O0FA 2GSEA 1YIXA 1FWIC 2YB4A 3AUOA 1XRFA 2VC5A 1GKPA 4IFOA 2HBVA 4B92A 3E2VA 3GTHA 4R88A 4C6DA 4H9ZA 4XD5A 3CAKA 3GU1A 3LY0A 4LCQA 4G7EA 4GX9A 4IG2B 4M51A 4H9UA 2HPIA 5FSDC 1NDVA 1NDWA 1J6PA 4C6NA 1A5LC 2OOFA 1FWGC 3LGDA 4V1XA 4XD6A 3URBA 2Q01A 1HZYA 4IGMA 3RHGA 3MKVA 2ADAA 2Y1HA 2XIOA 3ISIX 4KESA 1RK5A 4C6FA 1PO9A 4XAYA 1EJWC 2PAJA 4IGNA 2R1MA 4QS5A 2R1LA 1PB0A 1V4YA 4H00A 4V1YA 4LCRA 4PCNA 4ZSTA 4H01A 1EJXC 3RCMA 1FKWA 3BE7A 2O4MA 3PAOA 1ONWA 2Z26A 4G7EB 3MJMA 1O5RA 3GG7A 4B90A 4E3TA 3G77A 2ZC1A 1A5KC 1K70A 2Z27A 1PSCA 3HPAA 3NQBA 2WJEA 4C5YA 3OJGA 4GYFA 4H9VA 3A3WA 3A3XA 1V79A 3PANA 4CEUC 2YZ5A 3GIPA 4DO7A 1EJVC 2FTYA 2AQOA 2D2HA 1UIPA 3OVGA 3EGJA 2W9MA 3IPWA 2OB3A 2VR2A 3IGHX 1FWDC 1POJA 4BJHA 3NEHA 4L9XA 3LSCA 4NI8A 3MSRA 1O12A 4PBFA 4KERA 4JOMA 4KF1A 4WHBA 4CEXC 1XWYA 2VHLA 4GY1A 4DZHA 3LGGA 2FTWA 2Z24A 4C6LA 3S2JA 2PGFA 3OODA 4C6OA 4ERAA 2FVKA 3B0YA 1BF6A 3IRSA 3URNA 4LCSA 4B91A 1P6CA 1K6WA 2A3LA 1WXZA 1NFGA 1EYWA 4KEVA 1FWFC 1V77A 2DVTA 3DCPA 1RJRA 4J5NA 2GWGA 4C6PA 5A6TC 1EF2A 3RYSA 4PE8A 4XAZA 2E25A 4GY0A 3OU8A 2VM8A 4D8LA 4GXWA 4R7WA 1KRCC 1KCXA 3T1GA 1RJQA 1A5OC 4RE0A 4HA0A 1FWEC 1WXYA 1YBQA 1KRBC 3TN4A 2IMRA 4CQBA 5HMDA 3MVIA 4GY7A 1EJSC 3R0DA 3F2CA 2QVNA 3GTIA 4GC3A 3AU2A 1FWCC
chains in the Genus database with same CATH superfamily
3RGTA 1XYFA 2DORA 2GOUA 4MNKA 3R8GA 3UP8A 3WQ8A 1CXLA 5KZ6A 1KRMA 3CIXA 2A2IA 3P61A 4NZ3A 2YX0A 4FXFA 1E71M 3HJEA 3FA3A 4O54A 1I0DA 3WLSA 1YE4A 1P7TA 5HNUA 3FEQA 1GTEA 2GVYA 4PB3A 1TRIA 2DT2A 3ITXA 1H0GA 4UNIA 5KT2A 5CBJA 1TRDA 2PD5A 3DHFA 4CU8A 5HMEA 4PUNA 5JH1A 4YCOA 2O55A 3VI2A 2AL2A 4F0SA 4XZIA 3AJXA 3QV7A 3ZVHA 1PX3A 3PUOA 1NELA 4CNPA 2VX6A 3B9DA 4PMZA 2CWNA 1TVPA 1BF2A 4KRUA 2IPJA 3HGOA 4KEMA 1KFLA 3WG6A 2X7VA 1IZJA 3NQGA 3ZJ7A 3EPGA 1E70M 1HVQA 1QNSA 3HQ1A 1UZ4A 1A80A 3OGSA 3KE0A 1OFRA 5KEZA 1P0EA 1A50A 5JUVA 4QBXA 3UJFA 4EPBC 1N55A 1RQHA 2F8QA 2YIHA 3AU6A 4PSPA 4QEEA 4I3GA 4EYIB 4AF0B 1KTBA 2YW4A 5KFBA 3PFMA 2CW6A 4Q43A 3MR5A 1GVQA 2R8IA 5EY5A 1V93A 1QI4A 3VUSA 4I7UA 4OBSA 1JYVA 1FDJA 1VPYA 5FOOA 2Y70A 3HMJG 1QNOA 4FBUA 4JQ4A 4E4FA 2ONEA 2ZIDA 1QCWA 2WOQA 3MZNA 3F1QA 1GKRA 1FWRA 2A6LA 2VRJA 4F4ZA 1CB2A 2BR0A 4QM1A 3B9NA 1S0MA 1VR6A 3ARWA 2ABBA 5FIPA 4F50A 3H23A 4JTRA 1R3QA 2F7FA 3NYZA 4NLGA 2Z7GA 1ISWA 1JZ2A 3A64A 1PTAA 4Q8TA 1XIJA 3AIEA 5MF5A 2JQXA 3S4TA 3ZIZA 5FJOA 4C7GA 1F6KA 3U4FA 3BAJA 2EG8A 1Q6CA 4MLRA 4KWUA 2Q09A 4PUMA 4Z0SA 3BSGA 5DCDA 3L21A 2NQ9A 4J9JA 2EBNA 1BFNA 1VLWA 4GFIA 5REQA 3S42A 2ZX8A 4YYCA 3EOEA 4ASTA 4AIBA 3GDBA 3W72A 3Q58A 4IFRA 2NUXA 4BA0A 3AYVA 2JIWA 3BANA 4AZBA 3SUSA 3RPMA 3GVGA 3ZWSA 4TUFA 3ARQA 6TIMA 2JEQA 5H91A 1OYCA 4ZR8A 3E0WA 3V36A 1A5NC 2OSYA 1VQTA 3QV6A 1OC6A 3OIXA 3P62A 3MFIA 3PF3A 4NP7A 3C61A 2EHHA 4ZQRA 5CAHA 5L6UA 2I57A 3PK7A 1OZMA 1ITCA 5D8WA 3WYZA 3LBMA 2CBVA 3G8RA 2DDXA 3CAQA 1F73A 1GOQA 2WKLA 3RM8A 1VLIA 4FOKA 4US6A 4V33A 1K4GA 1W5PA 4HGXA 4J9NA 3W7CA 1HKIA 3CUHA 1TPDA 3IJ7A 5BMWA 2VFFA 3BLIA 1QNQA 4WR3A 1TQXA 3SGUA 1NSJA 4MDOA 4UFJA 1Q66A 1AJ2A 1OD0A 3G0XA 4HCDA 5ABFB 3MKKA 4TQRA 5FEZA 1K1QA 3R4IA 4RE2A 1NU5A 4EWND 2I9UA 1RBAA 4ZQMA 3VILA 1GOWA 2HSAA 2E1WA 4F3HA 1Q5MA 5DXXA 1XIGA 1RAKA 2WQPA 5AFDA 5FL1A 3W2MA 4TIMA 2E1DA 2D1ZA 2ZZ4A 4MG4A 2PZ0A 3JW7A 3DHPA 1XUUA 2VFGA 4AYSA 4GIEA 3WBXA 4W7VA 2C14A 2PEVA 4R88A 4XTDA 5E6YA 3V5OA 4V2XA 2D2OA 4GVIA 1E0UA 4HZ7A 3N13A 3B8IA 4P2VA 4JYFA 3PPGA 2J7CA 1IXQA 5MKGA 4PUEA 1XSIA 1BVZA 4DXXA 2Z6JA 4YVPA 2OO0A 5KFTA 2Y4SA 2FIQA 3CHCA 1WZAA 2XIOA 4MZ1A 1IF2A 2P1FA 2WZEA 3DG6A 3T0AA 4GHRA 1EJWC 3S1WA 2WXDM 1PB0A 1XLMA 4WY0B 2BODX 1L8PA 2WSQA 3IVSA 4Z17A 4B5TA 4G7EB 3DERA 4PUKA 3T9PA 1TWDA 1A5KC 1E0TA 2WKJA 4X2PA 3GV8B 3QOMA 2HISA 3SY1A 4NNAA 3EB3A 4XQ6A 1K6AA 2ZX9A 3IJ8A 4EIVA 1N8FA 3IIPA 1Q2SA 5D04C 4PYSA 2ISWA 6XIMA 1F76A 1XX1A 3NIYA 4L9ZA 2E67A 2C0AA 4AD0A 3T0DA 2BZNA 4G3IA 4HMEA 2ZA1A 2NVDA 4HYKA 3SCOA 1A0DA 1SZRA 3RUBL 4ZGYA 1A3WA 2Z1WA 3HF3A 5KFOA 2DPIA 3SIZA 2FTWA 4W5UA 4EANA 3NPXA 4MPQA 3DHDA 3MZ2A 1WKYA 5DN1A 3T40A 2Z1KA 4U33A 2J9ZA 3I3DA 3AZTA 4J9OA 2OYMA 2VGGA 1Q4WA 2ZVRA 2Z1XA 3HQOA 2J6UA 2A4AA 1OADA 2ZVIA 1DIDA 4WRHA 2X8RA 3I6EA 1GW1A 4IIHA 3TFXA 1K02A 1T7LA 1JPHA 2PE4A 4R7WA 3PVXA 2XFWA 2XWDA 4IP7A 2GYIA 3WNKA 4YR2A 4RX0A 2ZTKA 5C9UA 4FLRA 3NZPA 4JV2A 1KLYA 1SO4A 3BURA 4LBUA 1EP1A 1B3OA 1QNRA 1WOAA 1JGMA 3GM8A 4FSAA 1XR2A 2IBKA 2O9RA 4O18A 3I65A 3S1VA 1YDYA 2YKKA 1F07A 1V6WA 3GRIA 3VUPA 3R8HA 3HV8A 4DLMA 4RR4A 2HS8A 4V28A 1WUEA 3KRZA 2IKIA 4ACZB 3G6XA 2I14A 3INPA 4H9XA 1RPKA 2QMJA 4LALA 3QGKC 3KZPA 4H19A 3T09A 1QHPA 4JQ3A 4IMAA 1XKJA 4PA8A 3OQ8A 4NF7A 3REQB 1A5AA 1DKWA 5HWJA 3CHEA 3T5LA 1RCQA 5FAGA 4UBPC 4ZO6A 4N2YA 1U5VA 1R9XA 4CD8A 4W89A 3SCVA 2NW0A 1AL7A 1UC4A 4ZOAA 4KEZA 4PTNA 4RXFA 2Y62A 1X1OA 5M3WA 4J28A 5A6KA 3W38A 1JXJA 1R46A 3HM7A 1OFPA 5CC6A 3WBYA 3NQ6A 4GYJA 4P7RA 1VS1A 5CBBA 4YWSA 3VNZA 1P0BA 2GJXA 4QITA 4L61A 5F2MA 4ZQCA 1E9LA 3OTRA 4YWIA 5LA1A 4U28A 1XP3A 2C22A 2Q3RA 3ZZ1A 5BCAA 1IEXA 5KG6A 3S2CA 2NV1A 3PJTA 4S1FA 4L6DA 2WBKA 1HGWA 1OGBA 3KCLA 3H55A 3AZRA 1JFHA 1FX6A 3IVUA 1DTUA 3OSNA 3LSBA 2W8LA 2BWGA 1EIXA 4TMBA 2YCLB 3UJRA 1UR4A 3GNNA 2B0MA 4QX4A 3O06A 4GO8A 3MI6A 1DJNA 2VT0A 3U7BA 1WO2A 2OG9A 3JS3A 1OFQA 4GRSA 4LF2A 4QDWA 1HKWA 4O0ZA 2CBIA 3KHGA 4KMQA 5C7VA 3BDKA 1VYRA 4J9LA 1W3JA 1TUXA 1FBAA 2RGLA 2J88A 3AMKA 2I7GA 1B3XA 3W84A 2QIIA 2UVVA 1JI1A 1DOSA 3T5JA 2VYOA 1B9BA 3LHVA 3TH6A 1GG1A 3TU9A 2E9BA 4IMCA 3NGJA 3DKJA 3WL0A 3B06A 1O95A 3N6HA 2BY3A 2RDTA 4P61A 1KQYA 4CCZA 3CUFA 1K9TA 2F84A 4DJFD 1ICQA 4L80A 2CESA 3CZ8A 4JY8A 3HQNA 2JEFA 3MO7A 1IZCA 3TSBA 2PDGA 2V68A 4JD4A 2PBOA 3GG0A 2D24A 3W81A 4IH3A 1PV8A 3PPCA 3T78A 1PXGA 1LLZA 3E0LA 1MFUA 2A3EA 3NQ8A 1K9FA 2QDHA 3W1TA 2FZBA 3URQA 1US3A 4RJEA 4GZ7A 2J8GA 3TQKA 2VCCA 1BRLA 1ELSA 3W28A 3QQ1A 3A22A 1SFSA 1VFFA 4RNOA 3O0KA 3E74A 4UTWC 4DHGA 1RLDA 1TTPA 3H40A 3WLMA 1R9ZA 4HSHA 5FJJA 5JBEA 1E4NA 4L1XA 3GYCA 3TNBA 1W1A1 2G3MA 2YB4A 3P2VA 2DY3A 2PF8A 1E6NA 1NOFA 2ZKMX 1LWHA 3P14A 2WC4A 1JDFA 1GQNA 1ZAJA 5B7YA 3LRLA 1ISZA 5DRIA 2NSXA 1KM3A 3L2IA 4YLWA 3RBEA 3R11A 3AISA 1E4IA 1XLEA 1JG9A 4NKCA 1D3HA 3E02A 1LRNA 2WSRA 3WQ4A 3FAWA 3WDIA 2C13A 2D3LA 4MWAC 3W82A 3O05A 3DZ1A 3MWCA 3ARRA 4PBGA 3WDJA 5HQEA 5LGZA 1NOWA 3UD6A 1DTNA 1NQ6A 1HIZA 2QR6A 1YPXA 3RO8A 2O9OA 2ZC1A 4DUOA 1V0NA 3KDOA 2J7EA 1W9VA 3NQBA 3WQDA 1ZRQA 3SRDA 3NDYA 1XRSA 1KFJA 2QAPA 2OX4A 3WBAA 1OX6A 2GLKA 3VGBA 4OWGA 2VR2A 1FWDC 3T5KA 4ECWA 4JKLA 4YXGA 2PBGA 4NUWA 5H1WA 4H2HA 5IDZA 1O12A 4DJDC 2C7FA 4QLLA 1IT7A 3FIGA 4JFSA 3RJXA 2XINA 4JX5A 1OVDA 1TWZA 1SZGA 2A3LA 3VZZA 3PBYA 1EYWA 4D1IA 4D6IA 2PA6A 1OCJA 2IPWA 4HSNA 3C3NA 2A7RA 3MU7A 1JDDA 3WLJA 4LOCA 4JTGA 5GJNA 1XICA 4O3PA 3T1GA 1QVBA 1M7PA 2TPSA 3CV7A 2RDWA 2A5HA 4W8LA 4NL1A 3LHYA 4ZBCA 2D3NA 3UZZA 3W76A 1ITXA 2GVLA 4Q8UA 5I7GA 3CHFA 2ZX7A 3W85A 3D46A 4R9OA 2Z2BA 3VA8A 4Q45A 2FZ9A 4HHHA 3EXSA 5G4HC 3U9IA 4CNOA 4X0VA 4Q44A 4DVOA 4JEJA 3FS2A 3KLKA 5HJYA 3CZLA 3VOJA 1G69A 2V38A 4JHZA 4AAJA 4O1BA 1RK6A 1UKQA 4OGZA 1QK0A 1KFKA 1K9DA 5K3VA 3NA8A 4IUOA 3STFA 5CQ1A 4MHBA 1KBIA 4F4YA 3M0LA 3WZ0E 1XBYA 3T6CA 5I78A 5FCZA 3I7SA 1J0KA 1P7TB 4OV9A 4PCFA 5CEWA 1W9DM 4KWWA 5JMUA 2IQTA 3W7LA 3WLQA 2D22A 5HMFA 5GNZA 1P4CA 2AL2B 3N2TA 4LNCA 4D8ZA 2V2HA 2WK2A 1KKRA 3ZVHB 1UB3A 1MW1A 5AC6A 3KOYA 2OH2A 2XVLA 4O14A 4AU0A 2FDMA 2IKJA 1UR2A 3HB9A 3HTWA 2GGGA 3NDOA 3PM6A 4O15A 4UTKA 3IV8A 3GZ3A 1U33A 1XPYA 4RE3A 3W26A 4J7RA 1JAKA 1OCBA 3GQYA 4O3NA 4JV1A 2VD9A 4QIUA 2DSUA 1BPLB 3S0CA 4H9MA 3NFUA 1UWIA 4BWLC 2V8ZA 4EVZA 2UVWA 2DSWA 1XD0A 3E2QA 4YL2A 5DMMA 2X2GA 3LCHA 4PULA 3R89A 1VH7A 3UYIA 1SR9A 3AXMA 4ZB2A 1KFCA 3ARUA 1KM4A 3V5CA 5EWEA 2HXTA 1GEQA 2C79A 2OX1A 2J9YA 4FNSA 1AW1A 3NO1A 4JDBA 4HZMA 4FALA 4ECTA 1R9YA 3O8AA 1J9YA 4NXSA 2H9AA 3Q4DA 3S1GA 3TC7A 4KETA 3NSMA 3RPDA 1JIHA 4HU3A 4PTXA 3G1RA 4F0KA 5G1MA 4PH6A 3NL5A 2WCAA 1CI1A 2XZ9A 1TJPA 1VBUA 5M5DA 3FKKA 4Q8FA 4MF4A 2VGIA 1X39A 4UIOA 4KS0A 4PEKA 3QLLA 1EQPA 3AIVA 1F3EA 4CNNA 5ABTA 1H3GA 4IZGA 4LU0A 1TVLA 5REQB 4UQCA 3BW3A 3MSGA 1X38A 2ZA2A 4AEFA 4XZMX 3UCDA 5EMMA 1DJHA 1U1HA 1A5CA 3E6EA 4RDWA 4R27A 1TA3A 3QZ8A 4LY4A 4B5WA 4AMCA 3UQNA 1B54A 5LNVA 1VFHA 2ZX6A 2Y0FA 5F4SA 3CUZA 2DSVA 2YZRA 1SO3A 5D32A 1VIZA 2OZ0A 3AXHA 4WX2A 4ZSUA 5A6BD 2PWHA 2QGHA 4MB3A 1FY6A 1S5NA 2VA2A 2ESCA 1J12A 1LG1A 1Q7ZA 3BO9A 1F9CA 3H4DA 2XN2A 4JQ2A 3MP4A 2OT1A 1O7AA 3BK0A 4AIUA 4GBUA 3TK7A 3PWAA 1A3XA 3NDZA 2UV8G 3OBKA 1TX0A 3G1YA 3QMTA 4JIRA 1CCWB 4O52A 3BLOA 4PFHA 2OKTA 4Y2WA 4CVUA 4DI8A 2XVGA 5EB8A 6A3HA 3NQAA 2IXUA 1FWAC 4QAWA 4ATWA 5D9MA 3IK2A 1XFCA 4KPLA 5DQHA 1F74A 2HBVA 4JTTA 1XGZA 3GNOA 1MUCA 3GV7B 4XVDA 4LPCA 1UUMA 3D47A 1I2OA 1PDZA 4X0NA 2R8WA 5CSRA 2WZTA 4O3QA 3S3GA 4AX6A 1UR3M 2HE5A 4OECA 4S3BA 1UWSA 3P67A 3UZYA 1WBHA 3BAXA 4OVXA 5EBAA 3E1F1 3RHGA 3TYEA 5C54A 4C6FA 5KETA 3WIJA 1Y65A 4TOQA 4W84A 7ODCA 3DYMA 1XDLA 3WLIA 4DUVA 3N04A 4LCRA 4V1YA 5IRPA 3S6TA 3EWUA 3AS3A 1EJXC 1W6TA 4DWDA 2O9PA 1E6PA 2PF0A 3Q94A 1ONWA 3IEBA 3VC6A 5G1TA 5EFDA 3WJYA 3CASA 3W1PA 3NOYA 1H7WA 3IVTA 4Q7NA 4J40A 3MS8A 5MKGB 3WQCA 3P93A 2O7QA 2F6UA 5KFSA 1B0IA 2BXYA 1RALA 5EWFA 4D6EA 3GDKA 2FJKA 5DQPA 2YLAA 1XLDA 3VFCA 5BW6A 4LYPA 1CNVA 5D05A 1K03A 1QOXA 3IJIA 4UFLA 4MIMA 2WBGA 3IGUA 4NJIA 1JZ6A 5E0FA 3KS5A 3WQFA 1QAPA 4WY0F 5TAOA 1C93A 3XINA 2INZA 3GFXA 2Z24A 4BEQA 4QP0A 5LIUX 4UTTC 1OC7A 4QDPA 2JF6A 3ZJ8A 1CT5A 2NWSA 1UJPA 4UCGA 3UPBA 2QIWA 4FX6M 3AC0A 1LT7A 5I3JA 2VOMA 3EPMA 4K36A 3GIIA 3LENA 3GG1A 1AMYA 2PD9A 3EA2A 2VM8A 1CWYA 1LQ2A 2JGQA 3NM3A 1QPOA 4ZFMA 2VWTA 5I5RA 4B15A 3BC9A 4M3PA 1BGGA 2QULA 3G6VA 1K7FA 4O3OA 3SN1A 3O6CA 4O17A 1CXHA 5A69A 3LCIA 3W87A 4WZHA 4PEEA 5DELA 1M41A 3O6AA 3T05A 3S1XA 2VCBA 2UZ9A 1GZGA 1J6OA 4JL1A 1WP6A 1W1B1 3DGRA 3WQWA 4AIOA 1KBKA 3N2XA 2OO6A 3HG2A 3G0UA 4M6UA 1X96A 4H8UA 5F1UA 3UXLA 2BSLA 4GXPA 1UKOA 3H21A 1ZENA 1ZP4A 3GAYA 2WMJA 1A0CA 2OGJA 5CCZA 1I1XA 4JFTA 3AHTA 2BHUA 4O50A 5FD0A 4FLQA 2V2DA 1HKMA 3WD0A 3T42A 1OIMA 2JGYA 2BQUA 2W9BA 1B3WA 5A8MA 3TLLA 2PC4A 1TV2A 5HUOA 4TQSA 4E3VA 2OEJA 1JCNA 2XHYA 2E40A 1FHVA 5IBXC 2A3CA 3V7PA 5CGTA 4XZ9A 3RJYA 5CGMA 5G1YA 1AW2A 1RP8A 2H3BA 4JYDA 1HN1A 3QMSA 3LEPA 4ECUA 4WXZA 3EWYA 1DPMA 4IMFA 2AQ4A 1NWUA 1J10A 1UWRA 3SRHA 1E1FA 1T5AA 1E72M 3MR3A 1DWIM 3UCCA 2X0YA 4NZ4A 1XBZA 2ACUA 4DL7A 3DU0A 3N25A 4CNSA 1E9ZB 1K7EA 1RD6A 1M5WA 3APYA 1O60A 1H7NA 4JPGA 1W3KA 3CZGA 4A3UA 5BOEA 1GWJA 2GUYA 1FHUA 1P6WA 3F4VA 4D6CA 1VPQA 5DRCA 3B0XA 1WDRA 3BCFA 2GJXB 1GVEA 5IHSA 3CUJA 3GHSA 5CZ0A 4MOZA 1V3JA 1A4LA 1B5TA 4LFYA 4JX4A 4LB3A 4UFMA 4Z1BA 3VAVA 2FLNA 4AEOA 3FA4A 1V3MA 1EPXA 2G50A 3NSXA 1XLIA 3LZ5A 1DQUA 1W1IE 1W3HA 1UBPC 4DL2A 3QPYA 4W5ZA 1EEPA 2HBXA 5DLCA 4X63A 2YYTA 3OHIA 2R8HA 1ZLPA 2Q3OA 1TG7A 4DM2A 3E96A 4J9MA 3ALGA 4LVDA 3MDUA 1M03A 5FAJA 1RQBA 4H7CA 2CHRA 5BXTA 4XK2A 3TQVA 5HNTA 2O7SA 4Q4MA 2J7FA 3TROA 1R87A 3QQ0A 3KTSA 4R9XA 4DELA 2GOKA 2PU0A 5CH9A 4J3WA 3QPEA 4Q8VA 1W54A 1YHTA 5AVHA 3GTXA 1SJBA 2YGYA 3NQCA 3WNPA 2HEJA 3BJTA 1R3SA 3NQFA 4YVVA 2PB1A 3FSUA 2CZVA 4M6PA 3DC0A 3SM0A 4MJZA 1S3HA 1X98A 1QDSA 2ZUWA 5DFAA 3C0QA 4QNWA 1ZTVA 4HMCA 3W7NA 3N1AA 4XBSA 2O4QA 4QS6A 4DNMA 1R30A 1GVYA 4LVGA 3MHUA 3PZGA 1TREA 3F5LA 4ES4A 1F2JA 5KFQA 4RDZA 3KRBA 5D2WA 1LJYA 1MNSA 4O3SA 3BZJA 2BTMA 5A6MA 1XYAA 2QEZA 3EWWA 4O19A 1MEIA 3TKFA 3BW4A 3W27A 3G0SA 3E3HA 1CLKA 4P5UA 3A5VA 3VIKA 5JU6A 2VUYA 1V0MA 2PLCA 3QW4B 3Q8SB 1UR8A 2VP8A 3N6JA 1W1TA 4KW2A 4JUZA 5KFAA 1R3VA 2XTKA 3K1GA 1BRLB 3WNMA 3MUCA 2ZZ1A 3RIKA 2PDXA 4AEEA 2AGOA 5C71A 5I0DA 2OOFA 3AWOA 3V6JA 4KKXA 3LK6A 1PWMA 1OG0A 3A4XA 3BTNA 5C9WA 3D0CA 4YMZA 1JFXA 3AYTA 4HOXA 1TJ0A 3K4AA 4P8XA 4DZAA 1XUZA 2YBUA 1RK5A 1J18A 4DYEA 3LMZA 4DBSA 1KM0A 1NH6A 4XAYA 3POCA 1UWAA 1YDVA 4G1KA 1U5JA 2H8ZA 3PZMA 4QNEA 1KXHA 2XIQA 4ZSTA 4G5DA 2CLEA 1OYBA 2XIMA 4RNHA 3BE7A 3WK2A 3EOLA 2I56A 4F4RA 3L4UA 2VZVA 2X16A 2SFPA 4XSLA 4GYFA 1JQVA 5BZAA 4UR9A 4JIHA 3PANA 2VTFA 2XDFA 4DX3A 1H0IA 1IIGA 2X1TA 2FLLA 4Q6XA 3OVGA 4NVTA 4S38A 4IQLA 4K37A 5KG1A 3KRSA 3R7MA 1S10A 3B03A 3NTYA 3HV9A 3DYPA 3MSRA 4XZLX 1PEZA 1BEUA 1RD5A 4H4IA 4M1RA 3A4WA 4MFDA 4JN7A 1XSKA 4GY1A 5FKYA 3LGGA 4O10A 3UY7A 1X6LA 1LRQA 4C6LA 3GB6A 2H6RA 5HJLA 3T0CA 5K4ZA 3U2EA 5E1QA 1O5XA 2PGFA 4W86A 1EDGA 4FPSA 3MCNA 4B91A 3LNMA 1V77A 2O92A 4WD0A 5D09A 2QUTA 3RYSA 1E0WA 4YHGA 5DG8A 3K8LA 2DGAA 3GHTA 3H2MA 3WQ6A 4FAMA 4BZYA 1A5OC 1XDMA 1VJZA 3UJEA 1YBQA 2OEMA 1Q6GA 2BY2A 1WZMA 1S2CA 3CO8A 4ZQPA 1XYBA 2NX3A 1UH3A 3UA3A 1UKTA 3SW6A 1GVIA 1KM1A 2HS6A 5K9DA 4FLOA 1OG6A 4S2CA 1P1XA 1SFTA 4WOQA 3FJ6A 4G7FA 4S3EA 3H53A 3M5YA 5DY2A 4AWSA 1F3XA 2HZGA 4DJED 3PWGA 4O12A 1TPC1 1OF6A 3Q65A 2O0TA 3H22A 4MB4A 1O5KA 3M9NB 3KVKA 5LIYX 3STCA 3B40A 2JEJA 4E2BA 2X30A 1OT2A 2J7DA 1CGWA 4JBRA 4H83A 1AK5A 4L4PA 4DYJA 5B7ZA 2DZWA 2R82A 4JTEA 3RF9A 1H09A 1RUSA 4L5ZA 4DBDA 4MSSA 2ZRWA 3MB9A 1JL8A 2PU1A 4ZO9A 4GC7A 5SWUA 1SMAA 4PMUA 3LRMA 2W6RA 3OZMA 5CXPA 4WUIA 5JH2A 1RQEA 4ICMA 4BY3A 3ONCA 4AX7A 1MNZA 3VIIA 5A8QA 1FP9A 2W9AA 4PMRA 3OGRA 4LAOA 5DGBA 2BQ3A 4Q8EA 2Z2AA 1A53A 2VFHA 2VEPA 5FF0A 1VCVA 3KVMA 3TTEA 2Y63A 3WJZA 4NNBA 2FPVA 4IPLA 3VXGA 2DVXA 3WF2A 1Q7QA 1W32A 4GH3A 4RW3A 3N29A 4IPJA 4DWSD 1D3CA 1UHVA 3N9SA 1UH4A 5CPOA 2AGQA 4O11A 4GINA 5KZMA 1QR7A 1Y5XA 4Z2GA 3LHTA 1BSLA 3R58A 1S97A 3ZLHA 1DJQA 1M68A 4FXSA 3GWQA 2HV5A 3MYOA 2PDFA 4XTIA 5DT5A 4LY8A 3IIOA 3G1SA 4HVXA 5KFZA 4L4LA 1Z44A 5EU9A 5I03A 4ROPA 1G6CA 2QAFA 4R53A 1W1PA 3CMJA 3C0SA 3FXYA 3BCJA 3TTYA 3EB2A 3UG5A 1X7FA 1XCFA 3FYPA 3TQ0A 5L1LA 1S46A 4AWEA 1DJZA 1YNPA 3CH0A 4O4WA 3W22A 4F0MA 2CCRA 5CBIA 1L9WA 4X9SA 3V0SA 4CQ9A 5G2IA 5HAOA 3U5YA 3E0VA 3CC1A 4ATLA 3HOJA 2V5BA 3VFLA 4XZNX 1VFMA 3Q8RB 3C2FA 3W37A 2H9AB 1TO3A 4QLKA 3K2GA 1B57A 1FWHC 4K2SA 5KFJA 1IYXA 3B9OA 3BAKA 5LIWX 1MMFA 1W3LA 2ZADA 3S9IA 2VFEA 5FEWA 4KGLA 1C3FA 3DH7A 1EF3A 5LNUA 5FJRA 2QPSA 1XG3A 1W5MA 1S5VA 1MDRA 1XSJA 2LLEA 3ZR5A 4Q6JA 4Q33A 5E6ZA 5JIWA 2NV2A 4E2VA 3VDCA 3PTQA 4UOZA 4AY8A 7ENLA 2AQWA 2DQWA 4UMAA 3R10A 3MTWA 4OOZA 3LXAA 5I3KA 2DVUA 5KINA 2A3AA 1FA2A 3EOOA 3NYDA 4QW8A 1LQ0A 2YW3A 2PDJA 4MPKA 1TA3B 3H2FA 1ZJHA 3KLLA 2Y2WA 4NJKA 2WVSA 3AS2A 1Z41A 3GNDA 2QUNA 1UC5A 3AWNA 1W0MA 4RV3A 3TZFA 4PR4A 1KQZA 3LXCA 5H8MA 3EWBX 1UMYA 5U4NA 4CNTA 1TTQA 1UD2A 4XAGA 5G2WA 3AI0A 1YNYA 1DJIA 3WN6A 1K7XA 4HK7A 4L7ZA 3N18A 3N4AA 1Z48A 3O0FA 4H6KA 4O1CA 4J3TA 2VC5A 3W74A 4NASA 4F2BA 2DIJA 2OMAA 2WPGA 3OHAA 3CAKA 4WLCA 1REQA 5HXMA 2B4GA 2VFIA 3E5PA 7CGTA 4XD6A 1WE5A 1FVPA 3QF0A 3EDFA 3BQ1A 3Q67A 4ZE5A 3NQVA 4JCLA 4D6FA 4LS2A 4MFEA 3IV3A 4GWEA 4YU1A 1R0MA 3GS6A 4TXEA 2R1LA 4NZ5A 1YLVA 1FCQA 2XJ7A 1OK6A 4GZJA 3RCMA 2ZUSA 2F9RA 2YBTA 3GG8A 1O5RA 4HCLA 5CKSA 4NZCA 1DQXA 3V75A 3TTQA 4I90A 3TFCA 3AS0A 3VGHA 1SPQA 1V79A 1K1SA 4GNKB 3DBPA 4Y8FA 2AQOA 4FA3A 3DAQA 2Y5JA 3OBAA 3BMVA 3I7QA 4FMVA 4V15A 2ALDA 5K2ZA 1TTJA 5LA2A 4BJHA 1XIIA 2VNCA 1NP2A 1BWKA 3KDNA 1QUMA 2INEA 4HMDA 5DF0A 1TB3A 1OX4B 3EKZA 1XWYA 3DEQA 4DZHA 2CBJA 4JEQA 4KFOA 5I02A 1X97A 3VOFA 2P0OA 3U3HA 3S6DA 4ERAA 3N4EA 2GL5A 1KO0A 1EDTA 3B0YA 3IRSA 1EKOA 4F9JA 4KCVA 2TODA 3VYLA 3UWZA 2XISA 2ZUMA 3E2SA 4AD4A 3RO6A 1IR2A 4Y9PA 3IAQA 1HO4A 1RJQA 3VPLA 5RUBA 2XGBA 1G1YA 1MZRA 1Y0EA 2WMFA 1WXYA 2DPEA 4NI3A 5A5WA 3QM3A 1T94A 2IMRA 2ALZA 3B4UA 1EJSC 2BVTA 3UZWA 3O6DA 2J6VA 4IJCA 3G1FA 4ED1A 2OQLA 4QRNA 3RB3A 2OLAA 3IIVA 3BGAA 4G8TA 4HA4A 4FF7A 2PUZA 4A8RA 4IQJA 5LA0A 2DH3A 4JZ5A 3M0VA 4O0KA 4MY1A 1IEVA 4GKTA 1F8IA 5K9CA 3CYJA 1JZ5A 2CLFA 5A6BA 4RUAA 1G4TA 3QVQA 1AD1A 2CLLA 3OA5A 3TCSA 8A3HA 2W8KA 3LU2A 5DLFA 3GXDA 1HO1A 4N9BA 7PTDA 1B4KA 2XH7A 2FZDA 2Z0IA 4JTCA 1CYGA 1FFRA 3UR8A 1UPMB 2YFOA 1US2A 2VC7A 3GVVA 3WMSA 1X6NA 3M41A 4YS1A 1E40A 1DJGA 5HWNA 4UQAA 3VK5A 4F4XA 4R3UA 2VEMA 4ECSA 3PB0A 5M03A 2J77A 1F3TA 1TV8A 4Z2KA 4BQ2A 1IXOA 1BKSA 2QCHA 1KD0A 3O15A 1KBJA 4BWLA 3UZJA 3RBDA 3LM3A 3CWNA 4AFYA 2FHCA 4N42A 1JZ8A 3BLPX 4KFNA 2V2CA 4C6IA 2D0FA 3SI8A 2J6XA 3KCJA 3G1VA 1QPNA 4GYPA 2G95A 5E5CA 3E49A 4JNMA 1H7XA 4LEFA 1OFBA 2W9BB 1IWBA 1XDJA 5C9XA 4FF5A 2Z6IA 3T7VA 2Y24A 3VIMA 3QLDA 4B9ZA 2OPJA 1YXDA 2V5DA 3VX1A 3DYOA 3P7YA 3SO7A 3TMLA 3LDVA 5D30A 3OHBA 4DEFA 3GNXA 1RXOB 4OU1A 1NWSA 1M7JA 2UWFA 3OHMB 5KMYA 1H62A 3ARVA 2W7OA 4PB4A 1ZPTA 2WNZA 4OKDA 1QJWA 3GR7A 5CPTA 4EF9A 2E5CA 3PZTA 1S1PA 1M9HA 1RVKA 1XCWA 3A21A 4FS2A 3IAPA 4ZXLA 3MV01 1W9UA 4GX8A 4Y9AA 2YDAA 3ZXWA 1BLIA 5I3FA 5C55A 1B3YA 2XCPA 3M0ZA 1KCLA 1VFOA 3KX6A 4K7YA 1O4UA 1V7YA 2BHZA 5HA7A 3W24A 3QH2A 4RDYA 2FVMA 5CPNA 3M0MA 1UR9A 4YCPA 5C9ZA 4FHAA 3R0KA 4CU6A 2BS9A 4PL1A 5EMJA 2BXVA 2A1YA 4M24A 3FXGA 1FTXA 4DZIA 4JIIX 3SB0A 1B30A 1H7RA 2YXXA 1H1YA 4IP5A 2QJNA 1VEOA 1PKYA 2FKPA 5HQMA 1F6YA 4EWJA 1G94A 2WWDA 3QOKA 1JUKA 3T2QA 2ZX5A 1RYSA 4XISA 4GE8A 1JNDA 4FI4A 1XPGA 1CX9A 4ZZ9A 3RCYA 5BOFA 3RG6A 2Y5EA 3CJPA 3K1DA 4H2CA 1DYSA 4CD6A 2NQZA 5KFRA 3NOEA 3QY7A 3EWXA 3PJWA 1UJQA 5A8NA 3GIJA 1A5UA 1PZ2A 3RAQA 4PMXA 3M9YA 3RILA 1V0LA 2NT0A 3WDRA 2DUAA 4QDMA 4K1WA 2CZDA 4ERIA 1Q3NA 2PLMA 3WQGA 3LCWA 3PBGA 2WMHA 5DANA 3NEVA 4Z2HA 5AC7A 3UF9A 1EGMA 4CCEA 1ZU8A 3TJXA 5AYBA 1AQHA 4HU4A 3K5XA 4KH2A 4HOWA 3F4DA 4QWDA 2BNJA 1YDOA 2C19A 4KIRA 4A22A 4LANA 3F03K 4QGCA 1EWDA 3HQPA 5LHFA 2YFNA 3CLMA 2FZ8A 2WM0A 2GQAA 1V3HA 2CWXA 2H90A 1D7FA 1SU5A 1YIXA 3SFKA 3ZT7A 1EBHA 4AXKA 2FGLA 4E6MA 3GTHA 3KS6A 1ZJBA 4LCQA 3TDFA 2J74A 3CPUA 1P0DA 2HVOA 4D2JA 2ATSA 1XLBA 1BWVA 1WZKA 2GDVA 2WNQA 3UWWA 2I17A 3REQA 3QR3A 1R6WA 1XQKA 3BWWA 1EP3A 2PCQA 4ZFCA 3TC6A 3OYXA 4JNZA 3OIHA 3VKJA 1ADSA 2WCGA 3P8JA 4F66A 1ISVA 2VX4A 4B4HA 3OJGA 4HHPA 4GPNA 2WMIA 4A2SA 3ME3A 1GOKA 4G56A 2CU0A 4N6EA 3KOXA 3V0TA 1LTDA 2J66A 2X41A 3HPFA 3NR0A 4JTJA 2OB3A 3IGHX 2DSKA 3UY8A 3BOXA 3QYSA 2WV8A 3W25A 4WKFA 1UASA 1PPIA 3BJYA 1HKKA 3CAWA 1Q6FA 1GGOA 1RCXB 2PWGA 2QJGA 2A7NA 3R8RA 3WDHA 4ACYA 3G6LA 3AS1A 5CZJA 4Q8QA 2WANA 3C2OA 2JKPA 4GVHA 5LNSA 1KWGA 4GQGA 4PODA 1GOXA 2UVUA 4RPPA 1K6WA 3ABOA 1JCTA 3B8WA 3MMTA 3VKDA 5LIXX 2Y7GA 3K46A 4RE4A 4XAZA 3ITLA 4D8LA 2YCLA 2HVMA 4MZYA 4GNJA 1GORA 3HGRA 1E4LA 4O13A 4Y9MA 2V3FA 5XIMA 5EKYA 1GQJA 3BMWA 1IGSA 1TJ1A 4EE9A 1E1EA 1XGDA 2GGHA 3QC0A 1J0YA 4CQBA 2QDGA 3M1ZA 2QQ6A 2J78A 3C0LA 3I3EA 1C8VA 3BG5A 2MNRA 5DMYA 5J04A 3WFAA 2ZUTA 1ENUA 2R1KA 2XIBA 2Q6ZA 1TE1A 2VR4A 3PP7A 1TPH1 4HA1A 2DEPA 3W1QA 1YBQB 5IXEA 1E73M 4WSHA 2L5HA 2HJPA 3FAXA 3CMFA 4H8HA 1TVNA 3W1NA 3I68A 3A23A 3BOLA 4JV0A 5IOBA 3TJLA 2NT1A 4B9YA 4B3ZA 3SGZA 3N3MA 4KQNA 2DPJA 1TZ7A 5AZ1A 4BI6A 3IGXA 4JR5A 4LS1A 1PIGA 1UP3A 3MV11 1T6MA 3T2OA 3PZPA 1L6WA 1GYNA 4JXCA 4TR9A 5I09A 1NAL1 4W8AA 2WNWA 4MM1A 5A6JA 1WYIA 4L56A 1R3YA 2V3DA 3MPGA 3BAWA 2FTPA 5CG0A 2QGYA 3QRHA 3VIOA 3RU8X 4C6EA 2WVTA 2WKGA 2P88A 4GUGA 1H49A 3HU7A 3ANUA 2VL4A 3LPPA 3NL3A 2Z28A 4O4VA 3EX3A 1FCVA 1KW1A 4HBKA 1NIUA 4F9DA 4R5EA 4FOJA 3K8KA 2GDUA 3HFYA 3KBWA 1HKVA 4CNUA 4UFKA 1BQCA 2P3EA 3H7RA 2NX1A 1Z3NA 1DBTA 4GXMA 3ZWTA 1ZALA 3WD4A 3L68A 1UR0A 5A8PA 3LV6A 4U5KA 4C1NA 5ECVA 1XC6A 2P8CA 3WQOA 3AMGA 2RJHA 2VGFA 3B9EA 5XINA 1RSCA 1XBXA 3HG3A 4FB7A 3KWSA 5HBFA 4JTAA 4TVCA 4IL2A 2XVKA 4AC7C 2X0HA 2CFFA 5IFPA 3E0FA 1IIHA 2Y8UA 3FV9A 4Y7EA 3MANA 3NQMA 1Q6OA 2V3GA 5DY3A 1IXPA 4HA3A 4TO8A 5BXRA 4HSOA 3KTCA 3ABRA 3QW3A 5DGAA 1JCXA 2YA0A 3OQEA 1HFBA 3GH4A 2Q8LA 1Z8AA 2VENA 4HJWA 3WNLA 3RM9A 3DI1A 4HNNA 1YYAA 3M64A 1A5MC 3KWXA 4PUWA 1MQQA 2FFCA 3V18A 4FNUA 3SQMA 4N9DA 3GKFA 2AQVA 4YHEA 1VAHA 1CIUA 4Q8WA 3LTYA 1PKNA 1QI2A 1KFEA 2V5LA 2V63A 3GAKA 1F5ZA 3W88A 1OCNA 3HFTA 4H6RA 4DF2A 4M1BA 1WDWA 3RLHA 3QR1A 1OEPA 1F3WA 4MNMA 2OSWA 1W9BM 4M7SA 3LV5A 4HNLA 3R13A 3RCNA 6ENLA 8CGTA 4LUSB 4XB3A 4MB5A 3VNMA 4NJJA 4C6QA 3AROA 2ZBTA 1O6IA 2BXZA 5CZSA 3W4RA 3UXKA 4PTMA 4B5UA 4DJEA 4NRSA 3M44A 3AXKA 2NWRA 3THUA 1U1JA 1KM6A 1RA0A 2QPXA 4Q22A 5KFKA 3EWZA 1ITQA 3HPXA 4WF7A 1J79A 1GW9A 2DW6A 1N8IA 3MBDA 3WH9A 2X40A 4JTSA 5C0QA 4O1AA 3AHXA 2DV0A 3FY1A 2F38A 4X61A 4M82A 3RN6A 1W5NA 3AJ7A 3B8DA 1TCMA 2YDRA 3L0KA 4IIGA 3TWBA 4IF2A 1MFVA 1TV3A 2CZEA 2DZBA 3ITCA 3TAKA 1CGTA 3BCDA 3LOTA 1LM1A 4KT2A 1XRFA 4WDWA 5AYZA 4ZQNA 1G9HA 5AHNA 1GEHA 4GUJA 2OVLA 4C6DA 1OABA 4E8GA 2W4XA 4Z08A 3AIUA 5D33A 3M0KA 3W1LA 4M51A 4TTUA 4AD2A 4MYXA 1DWAM 4JFUA 2CHNA 5BOOA 3P60A 4E2DA 4PMNA 1BXBA 5KT5A 3H2NA 2WO5A 5A6AA 1YNQA 1UD3A 3W3OA 3GY1A 1CGYA 3IGSA 3A3HA 5AYIA 1TTIA 3ZM8A 3GQCA 2YL6A 4B5SA 3CGTA 2R1MA 3CV2A 2IMWP 1VBRA 2EJ1A 3PBUA 3RR1A 1REQB 3GILA 1E6ZA 5KITA 5HOSA 3GDLA 3ZO9A 4LYRA 4DWSA 4GVFA 4ZCWA 4WEVX 1KGXA 3HPAA 3G8EA 2WJEA 3V3WA 3A3WA 5KFGA 1GJPA 2ZCGA 4FX8A 4AVOA 2OWWA 1HKJA 3EGJA 5FJTA 4JX6A 3TTSA 4P8VA 9CGTA 1EQCA 1OB0A 4ZODA 4ZO7A 2PTDA 3NEHA 3VNYA 2JK2A 3NGDA 3FX4A 2DJLA 4BK9A 2FHBA 4I9TA 3A6OA 1SW0A 3GDMA 3BSHA 1B4EA 3H4GA 2OEKA 8RUCA 2X09A 1UPPA 3OVPA 1YTEA 4L6HA 5KTLA 3CQJA 3L66A 3M0JA 1FFQA 2AAMA 2CLOA 5KT3A 5KT7A 3KVJA 1WXZA 1Y5VA 4NRRA 2DVTA 3DCPA 2FB3A 1XIEA 5KFCA 5T91A 2GSHA 1F4HA 3W1UA 1QATA 3VZYA 3EA3A 4L1WA 5J8LA 3PBVA 2BVWA 4JFVA 3FCPA 3UR7A 3V1HA 3TONA 2VQTA 3A47A 3FNDA 2XIIA 3BL3A 1SW7A 1GVRA 3P5YA 3VKCA 3ARZA 1O5QA 2HXUA 1XISA 2G5WA 1UKPA 4GACA 3RB4A 3SECA 2VZUA 5KFVA 4HYVA 2XGPA 1BWLA 1IV8A 2G0WA 4S3AA 4GUIA 1W9PA 4GQBA 1XI3A 2EPHA 4RKAA 4DO4A 3GGMA 3W1XA 3LTSA 1P0KA 4OOUA 1QXLA 3W23A 3P6LA 1VP5A 2QZRA 3VC5A 1ML1A 2CITA 4HHMA 3VDAA 3HN3A 3H7UA 1XIDA 2ATLA 4XZWA 3S9YA 1M3UA 3UG3A 3K13A 3VNIA 1EA9C 2C18A 3QN3A 5TBOA 3VGDA 1E6SM 4M6VA 3USBA 3PHAA 1WKDA 4BFAA 3WQEA 1VHCA 4YVXA 2EG7A 1YTDA 5T8GA 1ONXA 3WENA 4H7VA 4PUJA 3RMJA 5BYWA 3T81A 1JDEA 2J7HA 4RLIA 5C2CA 2OR2A 3VU2A 2EGZA 2WJFA 1OK4A 4L4OA 1C8QA 4J9KA 1B9ZA 3T08A 3DFNA 4WJEA 4PRRA 1VFLA 4K7VA 1DXEA 2PFHA 3O7UA 1FHLA 3UCQA 4IFKA 4H3DA 2PRLA 3OEXA 3LGEA 4UTLA 5D2TA 3B4YA 4BQ4A 2FPTA 5T14A 1R8LA 3ANYA 2OCZA 4I8DA 1MWOA 4JN6A 3W7DA 1YPIA 4C1KA 1VPXA 3H4BA 4TU1A 1R7OA 1BHGA 2Z25A 2PLJA 4C6JA 4QQUA 3F2BA 2CHOA 4MZ8A 4S39A 1DL3A 3L0NA 1U1UA 3W7HA 2BFGA 3G3DA 2ZZ6A 5DEZA 3WX7A 1KKOA 3VM7A 2PDLA 5CPQA 1VHNA 1FQ0A 3TUUA 5GJPA 2W7PA 4PTDA 3DDMA 4UNLA 5D03A 7TAAA 2IPGA 1W1YA 5HMSA 1EPVA 4EBEA 4U3CA 4LGXA 4UTIA 1A5BA 4NILA 3QPZA 5TQLA 4QHRA 5GNXA 5D38A 2Z29A 4MLJA 1HG3A 1BXNA 3WCZA 1H60A 3THDA 1GJWA 1PWLA 4JTUA 4QROA 3BQ2A 3B0VC 3S5YA 3VGEA 3IACA 1LORA 2X1IA 3IN5A 4KWVA 3WEZA 2A6NA 2G4JA 2R1PA 5BWAA 4YIWA 3LTPA 4UZUA 2WQDA 1R86A 2HNHA 1W37A 4Q7BA 3L4TA 3C4UA 2OTDA 1VBHA 3U2CA 4BF9A 3GXIA 3WNNA 4DL4A 2RDXA 3TXVA 3GFZA 4JQAA 4U4MA 2E5DA 3O2LA 1VYSX 4LYKA 4Z2JA 1V03A 4AHQA 2C8NA 3TQPA 3IUHA 4K6AA 2CLKA 1CXFA 3MO4A 2VOTA 3LI1A 3SZ8A 2ACSA 3QBUA 2V69A 1H11A 1H2JA 2WLZA 3C2YA 3QSTA 5KFNA 4J3XA 4PMJA 2ANUA 4F0RA 2C71A 3VM5A 4U7CA 2W67A 4ZENA 4NY2A 2IKGA 3FJLA 1YDNA 2FHFA 3LB0A 2P9BA 3CU2A 1CDGA 3VO0A 3SFWA 6PTDA 4RDVA 3Q8PB 3NZGA 3PNUA 5AHMA 2JEIA 4ECQA 4PN2A 1KXQA 1IZKA 2E8YA 1FWIC 1GKPA 3N19B 5EDWA 3FFSA 2CEQA 3NL6A 1U5HA 5FSDC 1AJZA 3L5AA 2PODA 4C6NA 1HL2A 3C5QA 3QV8A 2PCEA 3GXMA 4V27A 4G1NA 2GFTA 4F40A 4J3SA 4RNJA 2DZUA 3MUIA 1T41A 1TX2A 4UOQA 5CPSA 3UXIA 1AZ1A 3MY9A 4CLMA 4IIEA 3H26A 1JPKA 1E6QM 2W63A 2FH8A 1KA9F 4H01A 1Q6QA 1MEWA 4Q8PA 3CEPA 1K70A 2ZUVA 3VIHA 5EFFA 1KFBA 3HMCA 3LXBA 4IJRA 2PC8A 3FSTA 3A3XA 3M47A 2OYKA 1RCOB 2FTYA 1E43A 3VD5A 2F61A 3BGGA 3WF0A 3LLDA 4XKMA 3MMDA 3PZVA 3C8NA 3QHNA 4PRWA 5KG4A 1Q85A 2Y8VA 1GUVA 2XFYA 2RHGA 4N7QA 4X2RA 4AZIA 1EIBA 3WO8A 1YEYA 2WPBA 2VEIA 4NZJA 2CKSA 1NEYA 2WMIB 1UG6A 4DAIA 2ZZ2A 2F2HA 4AH7A 3NQ2A 1ZJAA 1IHIA 4S3GA 4YP3A 1E15A 3EKLA 1EYEA 4RUBA 1EF2A 3OO2A 3RMEA 3ZVIA 1XH1A 3NPWA 1R7AA 2NLIA 2J47A 3SDOA 2F6XA 5C2XA 4RE0A 5KG5A 1J96A 2QCCA 4UMBA 4P7QA 4Q4KA 2ISDA 3II1A 4LUTA 4UR7A 3AIWA 4GQRA 3PZIA 3VOCA 3MVIA 2BOGX 3EDJA 1S5WA 1K8XA 1JD9A 1QO5A 3QZ6A 3L5LA 1UD8A 1OT1A 1WV2A 3ITYA 4PZVA 1RV8A 1UZDA 4LXFA 2DUZA 4LH8A 1D3GA 1HJXA 5EMKA 4FIRA 4DXKA 4GK8A 1NQKA 3LUTA 1VZWA 2VELA 8XIAA 3DFOA 2G3IA 5F1VA 1F05A 3V4BA 1W31A 2P3ZA 4P7OA 3ZJ6A 1S39A 4XIAA 3UESA 3EB4A 3CK5A 5C9RA 4O8RA 3AIBA 4QWEA 2C6QA 4IISA 1UBSA 4ECLA 2G4FA 4PUDA 5T26A 3U7VA 3W53A 1Q65A 1ZNNA 1E3ZA 4B4FA 2JEGA 3G18A 5HPCA 2AAAA 3QGVA 4URIA 4PMVA 1FCBA 2HK0A 3E2RA 2BP1A 3M5XA 4U10A 2MUCA 1GCYA 2EEXA 3C2RA 4FS9A 1W2PA 3DUGA 4QJ1A 2RDJA 3VOHA 1ME7A 3A9IA 3CXOA 4FOUA 2W91A 3HPZA 3TE9A 4MUPA 1MRQA 1QRQA 4DL5A 1I4NA 4HPNA 4AMAA 3VCCA 3BMXA 1LQAA 4QCFA 3B9AA 1H1ZA 3SY8A 3WLHA 4QAIA 4I7VA 3M5ZA 1A3HA 3N11A 3QQWA 4P8UA 4MKVA 3DC8A 3GW3A 1PIIA 4JTKA 5CLWA 3PPFA 3XISA 1LUCB 3NJ3A 1KM5A 2E6DA 4D1JA 1WXJA 4GIAA 1OF8A 4GJIA 4RZRA 5DBUA 3CPRA 3PUDA 1OHLA 3GH5A 1GTHA 3MMWA 1H5VA 3W7EA 3FA5A 1W9XA 4M6QA 3AHZA 1L8NA 3FYOA 1P1MA 1I75A 3AO0A 2WZHA 2B7NA 5HNRA 4HD5A 3L9CA 3DFYA 5D2YA 2XGIA 4GGBA 1DXFA 1A5SA 3URAA 1RJPA 3VKKA 4HCHA 3VVGA 2TYSA 4O16A 3S2MA 4O0QA 3M4HA 3F5JA 3H4WA 1TMLA 2ZXAA 5I3DA 2C28A 4GI9A 5T9CE 1DXIA 1FXPA 1YMYA 2HPMA 4Q8OA 2AMXA 5EPDA 1M1BA 3GC5A 4UOJA 3T2PA 5A94A 2VUNA 2G3FA 5EL1A 4IRDA 4Q8NA 3FW6A 4ZE4A 3TW9A 3KHLA 1V6XA 5H8PA 4C1NB 4A3QA 2V9WA 2NLYA 3MR2A 4D6HA 4M7TA 3LQGA 5BU6A 5F9NA 3N6QA 2VZSA 4L1GA 5AOUA 4E2OA 1XYLA 4Y90A 3QV9A 4EP8C 2ZICA 3WJSA 4W8BA 1EJUC 2RAGA 1QW7A 3A12A 4C90A 2EPKX 5D37A 4PTWA 1DJWA 3EX2A 3UG8A 2NQHA 4IICA 2QF7A 4GISA 4IQDA 2PWFA 1JPDX 2HNEA 4QWAA 1JDAA 2A3HA 3OZYA 3T8LA 4I9AA 3QKEA 1C8YA 2ZXDA 1FWSA 3C8FA 3VNLA 1ZFJA 1PYFA 2WJDA 3HZ3A 2YCKX 3A5FA 5F2LA 1XBVA 2YOCA 1T8QA 3OYZA 3G22A 4UMCA 2W5FA 4MB1A 3KBSA 4LBRA 4RNFA 2FPYA 4LV4A 1E9YB 5D2VA 2F2KA 4HZ8A 1R38A 5M1TA 3GIQA 4MKSA 2OSXA 4OQVA 2OODA 3UR2A 1EOKA 5I23A 3Q2DA 2QF8A 1G4SA 2V3EA 1I8JA 2J6TA 4RNIA 5M2FX 3MUAA 2QJJA 1UUQA 3BQ6A 2J7BA 1PHWA 3ORWA 2V5KA 3H2CA 1AH3A 3APTA 4W7WA 2IPFA 3ATZA 3VTRA 3TOPA 4LUJA 4A35A 1EFZA 4W7UA 4GI8A 4PBEA 3SCUA 2J8FA 3L4YA 1KLZA 2YXOA 1VCFA 4UNKA 1JNEA 2NZLA 3NL2A 4LAZA 3AUOA 5LGXA 1KCKA 3L65A 1TJ2A 4YR3A 4K68A 1TPUA 3GHRA 4M56A 3L0GA 2QUMA 1AMKA 2PDYA 2TAAA 5FACA 5A8OA 1O1HA 2EXOA 5BXPA 3GIYA 1ONRA 3H2AA 4KESA 4ORIA 4F4WA 4IRCA 3PS7A 3IJ9A 1HW6A 3WJWA 1OIFA 4H00A 1BSIA 4PCNA 4UQEA 2GQ9A 4B90A 3S5NA 3G1AA 3LG3A 1HGYA 1PSCA 2X05A 4L9YA 1I6NA 1PE1A 2OQHA 4JN8A 4J3UA 1TE6A 1FRBA 4KBXA 3HG5A 3J7HA 3RLGA 4OIFA 2YZ5A 5L1KA 2ODOA 3MSYA 4MWAD 2OLHA 1FWWA 1IWAA 2ASJA 1PX4A 3PPHA 1J01A 3C2EA 4CCDA 3LPGA 4IOTA 1JIBA 2GGEA 3WLLA 2X2YA 4WSJA 1ZHAA 3HA1A 4IR1A 4DPQA 4J1OA 2YJQA 3W6YA 7REQA 1UZHA 3LD5A 4NI8A 3SJ3A 4ZQOA 4K39A 4PBFA 4DWSB 3L4VA 2VI0A 1VEPA 2FJUB 1F4AA 6REQA 4GIRA 3FJ4A 3NPVA 4BHYA 2GUBA 3S2JA 1SM9A 1EL3A 1JZ4A 4J27A 4DBUA 5A2CA 2A3BA 1GPFA 3DG3A 1W8GA 4Q3MA 4DJDD 4WJ8A 2VGBA 5A6TC 1Q6RA 4PE8A 3NSNA 5I07A 3STGA 2VD8A 5CPLA 2PTWA 2VZOA 2X7WA 1TWIA 2ZWYA 1E5NA 1I45A 1FCUA 1J5TA 3SSZA 3O63A 3W7RA 3UPWA 3W9ZA 4GY7A 3R0UA 3R0DA 3MMUA 3F2CA 2WVUA 1ICSA 1ZSXA 4LRSA 1FWCC 3FN9A 1MUWA 3QZAA 2OT0A 4PCSA 1EX5A 2A85A 4P7LA 1T0OA 4ECVA 5FEPA 2AMGA 1QWKA 2QJMA 2QCNA 2ZXBA 4RZ5A 4ICCX 5CZKA 1WNOA 1JF5A 1KC7A 3BJFA 4QEHA 3F5KA 2R1NA 3U6WA 5KFUA 4MJ2A 3WF4A 2PWVA 1K1DA 4R85A 2EKGA 3GXFA 4I7WA 1AD4A 4JS3A 3EMZA 2D0GA 2NSOA 1KRAC 1VFTA 3GH7A 3G6YA 4QJ3B 3PFRA 2C1GA 1O1ZA 2GZXA 3LNPA 5KG3A 3I4KA 1TPVA 2PP1A 2V4QA 4U31A 3BLLA 3FHQA 2FH6A 1B3VA 3CLWA 4B2DD 1QW9A 3UJSA 4FNQA 2E28A 4PMYA 5HR6A 2G41A 2CPUA 5TNVA 3VMNA 3KOWA 4J2MA 1KM2A 3SAZA 2NQLA 4PC8A 4K8HA 2HCVA 2FYMA 1QBAA 4A21A 1IT0A 3MHGA 3W1MA 1V5XA 4RNNA 1M7XA 4PCPA 4Q7IA 1K8ZA 1OM0A 1CBGA 4AZCA 1G5AA 2QCMA 4UXDA 4WGXA 2E7FA 3GD6A 3MYPA 2ZA3A 1KB3A 2J25A 1DHKA 3N14A 4TQTA 4MAVA 1YKWA 2PDPA 1LL4A 3U0HA 3T07A 3O3RA 3E5BA 1TWSA 2W62A 3FDKA 3CAVA 4IIDA 1XYZA 5M17A 2XU2A 3W2LA 3CNYA 1K9EA 1GHSA 2XSXA 3IK4A 1I0BA 4IFKB 3BPWA 2ZRXA 4HMNA 3ARPA 4XD4A 2E9LA 5BROA 3BQ5A 1FWTA 2W61A 4UFHA 3WLTA 3N2CA 2G96A 3B8UA 1B90A 2ZQ0A 4FNTA 2VO5A 1TV7A 3QY6A 4R7JA 3WY1A 3N73A 3S8HA 4D6JA 4RW5A 5HINA 5D2XA 3QTPA 3N3TA 3UZXA 4CQCA 4OZOA 4LS0A 1SGJA 2BASA 2V9DA 1R2TA 3GIKA 2IUZA 1V7AA 3QC3A 3CZEA 4FIQA 4EXBA 1B2YA 3STEA 2JIEA 2DFAA 3WKZA 4DUWA 5I00A 1W5OA 1RYRA 3H54A 4ADTA 3CB8A 2XH4A 3WQPA 1QFEA 1HQTA 1XLKA 2QCDB 3K8MA 3ICJA 1EJ7L 3MR6A 2E09A 2D2GA 1OX4A 3TWAA 3PNZA 3M46A 1LRTA 4WOZA 1IEWA 2I1OA 4IXHA 1TPB1 3KHDA 4EAYA 2AGTA 4ED3A 3S47A 3PW4A 4H41A 2I9EA 4K38A 5EA9A 4XAFA 1ITUA 1UP2A 3ZSSA 3PR4A 4PTVA 2XFRA 1SJAA 1D9EA 5DLGA 2A21A 1E55A 2VXNA 2DT3A 2VCAA 3FHAA 3DFTA 4RNMA 4EF8A 1LOQA 2XG9A 1KV8A 3M6YA 3UETA 4Z1CA 5HK4A 3BLEA 1JR1A 1XH0A 2ISFA 3W01A 4R7OA 1XYMA 2VR5A 3DXIA 2C15A 3VIFA 3M0YA 1C9DA 4D9PA 9RUBA 4AW7A 4KRTA 4IG2A 2J7GA 1WUFA 5DCEA 3NXLA 2HMCA 2PGRA 1MZHA 1C92A 4W93A 2ABAA 3GXNA 4H9YA 2ZXQA 4GOAA 1M65A 1BYAA 2J9XA 1KGWA 3VDHA 4AXNA 3ZMRA 4J2PA 1T96A 6TAAA 2J75A 4C91A 5C7HA 1R85A 1PZ0A 2XIJA 4LQ1A 4DBWA 2FZMA 1PVNA 2C16A 4GX9A 1WKFA 1HUVA 3V6KA 3P8IA 2GJLA 1OC5A 1QNPA 1TV4A 3SR7A 3OB8A 3LYEA 1JD7A 1UD4A 3SSJA 2GGJA 2CXGA 1VD6A 3MKVA 2PTXA 2ADAA 5H8UA 2QMKA 4PFMA 3LZ3A 3QJAA 2CLHA 2GSJA 2HRWA 3WF3A 1ZCCA 2R8KA 4EXAA 1MYRA 1XHGA 4JTQA 3O16A 1UQZA 4IXXA 3MJMA 3LCGA 4JTFA 2WVVB 1B3ZA 3LPOA 2BY1A 4HB7A 1BQGA 5A3HA 4C5YA 4IGHA 1VFSA 1ZL1A 3PW7A 5MHBA 4HN4A 3PAJA 4CEUC 5FL0A 4L64A 2ZDRA 3PW5A 2AOSA 5KSWA 3PWIA 3IPWA 3BV7A 4ORMA 3VNKA 2ALRA 5FJUA 2DIEA 5HPOA 1EWEA 1POJA 4O3RA 1UA3A 5I6SA 3ARYA 2VQUA 2HWGA 1KFWA 1E4MM 3LX9A 4YTQA 1JF6A 1GZJA 2DJXA 3AMCA 2V5CA 1WZLA 3TYBA 2JEPA 1QPQA 2J13A 1NVMA 4ZVJA 5C5YA 3TX9A 3WEOA 5I2UA 1SSDA 3R79A 2FVKA 3QHOA 1VFUA 4LCSA 1SJDA 2ZE3A 3L67A 5E93A 1QT1A 2Y85A 4CD5A 1QI0A 1FDYA 1R5YA 3TYCA 5CSSA 3HIJA 3F4NA 2VDIA 3EKGA 5BRPA 3OU8A 1AJ0A 1G01A 1BAGA 1UQYA 1AUSL 1XLJA 3IJQA 1L6GA 1PX8A 5CZTA 1W3TA 2XSAA 2PWEA 5E9AA 2GJNA 3CB3A 1U2YA 5LIKX 5I3IA 1EHAA 1S2AA 1WQ5A 5AHLA 1BG9A 3CL6A 5C70A 1GNXA 4FR6A 3ARTA 2R24A 2QDDA 3HGSA 1GT8A 4GJJA 1BYBA 4DO6A 3NO5A 3IJLA 1ODZA 3FGCA 3MJYA 1OINA 1ZGDA 4Z1YA 4NAEA 3CZKA 1QK2A 1F61A 5FF2A 1GJUA 4EXQA 3L5MA 4XAPA 4LUTB 3MI2A 1CXIA 5KG7A 4ED0A 5ECUA 4B5NA 1JUEA 1BKHA 1HL9A 1Z42A 4UTJA 5FJPA 3WFLA 4P7NA 3T44A 1WDQA 2EPNA 1TMQA 5FI8A 1CEOA 1ODUA 4QE4A 1XC4A 4J9RA 3TN6A 5A6SA 3CYVA 3WH7A 1P43A 4GJ1A 4PB5A 1Q8JA 1EUNA 1QI3A 2BVYA 2C3ZA 2YR1A 3QY8A 3A13A 3V1PA 3R1ZA 4U6PA 5FESA 3SY5A 2ZUNA 3EDDA 1ADOA 1FOBA 3M43A 4I5RA 3VIGA 5AVNA 3PZNA 5E9XA 4ECXA 4H6EA 4IMDA 1KTCA 5L9XA 4IR9A 4LVBA 1OZQA 1RPXA 1BYCA 3ELFA 4US5D 4DBEA 3GDRA 1KXVA 2Y5SA 3GNRA 3KOZA 2WWCA 3OVRA 1J4EA 3OGVA 2C1HA 4Q4SA 4OUEA 3AUJA 2WB5A 2WLYA 4AZHA 1W56A 2CLPA 3ZFHA 3IUIA 1MDLA 1ECEA 1HVXA 3EX1A 2BV9A 3TQ1A 5KZEA 1NDYA 4WKAA 1GVFA 3GW0A 1JZ7A 4QWBA 4IPIA 1XXXA 3FYYA 4QG6A 4GUFA 3NVTA 3SCQA 4JTDA 4YNGA 2YDSA 4JDYA 2FGZA 3UG4A 1C29A 1JPIA 3AHVA 3MI3A 1LWIA 4J35A 3R43A 5EBUA 4K3ZA 4IL0A 1UW9A 4MY8A 4HK5A 3DESA 3OVQA 1UH2A 2W92A 4ML9A 2TRSA 3O9NA 2GVGA 1S5TA 2CLMA 4JL2A 3W7KA 1X1ZA 2UY3A 5HNNA 3TR2A 3CM4A 1MVYA 3WBEA 3MDWA 4AHPA 3UT0A 3ARSA 3MCOA 4NNCA 4JTIA 1KR1A 3QZ7A 3GV5B 4R8UA 2Z1SA 4ED2A 4RZ4A 1UOZA 2W9CA 1DORA 5KFWA 1E6XM 3S9ZA 4POCA 4DJFC 1UZ1A 4U3AA 1HL8A 3TJIA 4ZXOA 3N12A 1J93A 2FLPA 3BAYA 1LBLA 3W7OA 3QGAC 1G7UA 4U2ZA 4Z2LA 3SURA 3H7VA 2OLSA 4M5PA 3EPNA 1BTMA 1SW3A 3CQHA 4RUCA 3ITTA 1CLVA 1J0HA 4H7ZA 2C2RA 4BR1A 1WAUA 5EMLA 3BZGA 5JXQA 1SVDA 1XRTA 3B05A 1YRRA 3SRKA 3M5VA 3GVRA 3H8AA 4MKNA 6ALDA 3PSWA 4PUUA 2H3DA 3WL1A 1SO6A 3ATYA 3SQSA 5E0CA 4RCXA 2RH9A 1B1YA 3EOUA 1JYNA 2IA6A 3S2LA 4UB9A 3WLKX 1IM4A 4EEYA 2Y7FA 2YA2A 8TIMA 2IKHA 4RXGA 4W87A 5GJMA 2J62A 4QISA 3NUKA 1D8CA 1UP0A 1GYLA 1S5MA 2WSPA 1N2VA 4PMDA 3MCMA 3C6CA 1XM3A 4LB4A 3W7MA 3V16A 3I6RA 4OE7A 4AC1X 4LF1A 1NARA 3UVIA 4Q4PA 2DZXA 2QXWA 4NJGA 3FOKA 3NNTA 1SSGA 4Q4OA 3I10A 3FLUA 4ATDA 2D23A 1Q8AA 1T40A 3WUBA 4GC4A 5BNKA 5J5DA 1KWKA 4E8DA 1HF6A 3LLFA 1J6PA 3LM7A 1BGAA 1XLCA 4LVFA 4ZMGA 4M29A 5IDIA 3DI0A 1RLCL 3IUDA 3FKRA 2JFEX 4YPJA 3KAOA 4DN1A 3GVWA 2Y6ZA 2FVLA 3W7IA 1GHRA 3PTKA 3VE9A 3BSMA 5ENLA 4F48A 2DT0A 1JXKA 4F2TA 2CETA 4K8EA 3W73A 2QJIA 1ZJIA 1FKWA 1SO5A 3FVMA 2VVSA 3WMCA 1V0KA 1GK8A 4NIRA 2ZFAA 3UA4A 3L12A 3KBMA 5EGRA 3SCRA 2EPLX 4LWWA 2B7OA 3ZSTA 3TSDA 4CQ8A 1G4PA 2VWSA 2VVNA 3KEHA 3RX3A 4IPPA 1WCGA 4DL3A 2YDQA 4WDXA 3MUY1 1TJRA 4Y6GA 2R6OA 3T8QA 2ASHA 1Q45A 5DQIA 3TP4A 4LEQA 5KFIA 4L9XA 4S23A 3TYAA 4N9EA 5DBTA 3SN4A 2GQ8A 1SUXA 4AY1A 3CUXA 4JOMA 1XJBA 4JY9A 4WIWA 5F7UA 2EJAA 3OA3A 5CJ5A 9XIAA 1OGGA 1C7TA 2Y7EA 3UU0A 2GK1A 3W6LA 3DKLA 5LNRA 4C6OA 4IWWA 3R12A 3N9RA 3NXFA 4GCAA 4NSBA 2P8BA 4XIMA 2IXVA 7A3HA 1MXSA 2VEKA 2JBMA 1DWFM 2GJRA 1T8XA 1ONEA 4ED8A 4N4QA 2KX9A 7REQB 3WK3A 3ABQA 1ECQA 3PTMA 1EGVA 1ZETA 2G8ZA 1UROA 6REQB 4C1LA 1V6UA 4QR6A 3KTXA 3PZOA 4XUGA 1H4PA 4FS1A 2PI6A 4I9JA 5KT4A 4XSMA 3RX2A 4N9CA 3GTIA 3EPOA 1YE6A 1MRAA 4N4PA 3THQA 4NHVA 1V3LA 1QPKA 2FZNA 1TV5A 4LVAA 3UEQA 1JRBA 2OZ3A 1Q7MA 5CSUA 1SYTA 3CV1A 3Q45A 5KFPA 1HTIA 5KFLA 4DY1A 3WEMA 1JRCA 3EEZA 4IUGA 4F0HA 2Z4GA 1SR0A 5FEXA 1XL9A 3SN0A 2PWDA 1M6JA 4A3HA 3YPIA 5CGQA 5A2BA 2J79A 1QI5A 2QHAA 2GVEA 3PVFA 4NX0A 2PDNA 4OV4A 4J3ZA 3EMCA 1H41A 4J9SA 3BVJA 3UWEA 3SQLA 3TXZA 1DHPA 4LUSA 2OWCA 3AYRA 4OHQA 3CPGA 5FF3A 3F2DA 1LOLA 2PRMA 2CLIA 3MP5A 3NQDA 3UNTA 5BMXA 4RZBA 4LW7A 2WZIA 2YL9A 4AUBA 3Q37A 1AH0A 1QOQA 1ZCOA 4EACA 3WUFA 3VABA 1KCZA 3JZEA 2OQYA 1CTNA 3ES7A 2OU4A 4P8WA 4Z2IA 3ZLGA 4XWUA 4EPEC 5TD4A 5A6LA 1W1ZA 4ZB0A 4REQB 2XM1A 4UTWA 4XUYA 3RU6A 3STPA 4YYFA 3CUGA 5LXEA 3UBPC 1PS9A 2E8ZA 4GNVA 1RH9A 3I3BA 2C91A 3CV6A 2VC9A 1ZBVA 4QTGA 3M16A 1SZNA 4KCWA 2YCEA 4PGLA 3EPIA 1KNWA 1TFVA 1LLWA 3MQTA 3P74A 4AZCB 3MHFA 1PCWA 4MYAA 3EWDA 1AG1O 3EDEA 3CHVA 2P53A 3AMLA 5AYYA 5PTDA 3DX5A 4MWAA 2WZMA 4GD0A 3W86A 4GH1A 1R47A 2YB1A 3SJNA 2ZC8A 4GG9A 4MGGA 4C6BA 1R3RA 3TV8A 2FDSA 3WSUA 3KL5A 2AGKA 3V6HA 3AMDA 3PBMA 3NPUA 1AA1B 4IX2A 2EKCA 3B8VA 4BCEA 5I3HA 4MWAE 1G0CA 2BGNE 3GR8A 2PMQA 4NZFA 4XKYA 3N4FA 3NZQA 4NAFA 2BX7A 4QXIA 1JCLA 4ALDA 2Y61A 3RXZA 3QTGA 5KT6A 5FF4A 3KRUA 1ADDA 3ALFA 1LZOA 2PDCA 1V51A 3TYZA 2ACRA 2WHLA 3HO8A 2E6YA 3ABSA 3EWCA 4H9TA 1A49A 1XLHA 2GPTA 4DJDA 1I2PA 2KAUC 3KP0A 5KZDA 2CZ5A 2UVRA 3AIQA 1NWRA 3DFPA 3SADA 1DEDA 4DEZA 5BU9A 2VX5A 5D9OA 4ZB5A 1HP5A 1EC7A 4AB4A 4F0LA 1Q6LA 2PS2A 4LC8A 3LRKA 3VD3A 2CYGA 3GNPA 4BI5A 1Z89A 5GVJA 1JQXA 4HKPA 1JEZA 3VNJA 3PJXA 1DIOA 3WK0A 2PURA 3W7QA 2WC7A 1S2WA 4DPPA 4S3FA 2WHJA 3W00A 3CZJA 3QMRA 1SZFA 2V81A 2DZAA 4I6KA 3LCXA 1ICPA 4GYPC 2DSZA 2P5NA 4HYWA 1AW5A 1OYAA 4UC5A 2PWUA 1VKFA 1VIWA 3V35A 2P50A 2OYLA 1EXBA 3N9KA 4EK7A 3V5FA 3DG7A 3RDKA 2FGBA 4IRKA 5JVLA 3WFZA 4CCCA 3W83A 1XINA 4MNLA 4B2DA 3E2VA 3VDBA 2J24A 5C5JA 3HBLA 4NT0A 1IT8A 1PBGA 4IG2B 2C2EA 4H9UA 3GBEA 2ZZ3A 3CT2A 5CC3A 3VOGA 3R5EA 1J11A 3SCTA 3PR2A 4V1XA 4J9PA 2NXIA 1N48A 1HJUA 3PW0A 3ES8A 4LTSA 1E1CA 3BJSA 3KCOA 4EX4A 2BMBA 1WDSA 1RZMA 3ISIX 3PSVA 3RRAA 5CPMA 1C91A 3U2OA 3BLFA 3KXQA 4QG9A 1MI3A 5CG7A 3G77A 2W3ZA 1XQLA 3NZ1A 2Y7DA 1UA7A 5I24A 4WCJA 1M01A 1XRVA 1XW8A 4H9VA 2HDJA 3NM1A 2V5JA 1OCQA 3H70A 3S1UA 2GDQA 4DO7A 5CJMA 3C0JA 1S38A 3OZOA 4NQ1A 1NFBA 2UY5A 5HANA 1L6YA 4Z1DA 5HQLA 4OBTA 2QCFA 3POHA 1NY1A 4PMOA 4D8AA 3G6MA 1XLGA 1Y5WA 2E9MA 4WHBA 3B8TA 2X1UA 3P5ZA 2NVCA 4GI6A 2DZSA 1CPUA 1S2TA 4NYYA 3VKAA 1HP4A 2PDHA 2BHYA 3DGBA 1PIFA 5FF7A 3B8SA 5A8GA 1ESWA 3CO4A 4XZBA 4KEVA 4HZ6A 3RX4A 4XX6A 4FXJA 1YX1A 2VFDA 3ITOA 2R9RA 3GX9A 3UWYA 2DZTA 2QCLA 1I2QA 4GXWA 1S0OA 1KRCC 4E4PA 3NZRA 5E70A 2NQJA 5KFEA 3R6IA 3G1HA 2XUCA 4YN5A 4YTUA 3G1XA 1JCJA 4HP5A 1DJYA 2E3ZA 1GQIA 3EOSA 2O9TA 1PYMA 2EPOA 4OT7A 3AU2A 1OQFA 1LBFA 3RLVA 1TWWA 4RZ6A 3TSMA 3GTFA 4ECZA 4L4MA 1PAMA 3TC3A 4GQ0A 3TN5A 1KBBA 2HK1A 2VDGA 3OZPA 2XH2A 3VMPA 1VB9A 1K8CA 4HQVA 5JBFA 1L0PA 1LCOA 2IQ0A 1ZBCA 2DQXA 5JBDA 3MFHA 4I5XA 1TIWA 1JVNA 1G4EA 2AL1A 4HTYA 3NAVA 5ABHA 4ZOEA 3FGCB 1V6YA 3L4XA 4NAEB 3EMQA 1E5JA 4J4KA 3ECQA 2HVNA 3GU9A 2YCJA 4UWMA 1RP9A 3TEVA 4WQ6A 4C6CA 2C1IA 2PGEA 2VZTA 5CLTA 4IIBA 2WW5A 5KFHA 3MBFA 4JFWA 1EJRC 3T0BA 1JCYA 3LMYA 1L2QA 3PN8A 4Z42C 3IRDA 2XGQA 1ZBWA 3KHJA 4C65A 1Q2RA 2JKAA 2W66A 2EG6A 1J0JA 4M8UA 3IJ6A 3NWRA 2VC6A 3HPSA 3OG2A 1Z32X 4JYEA 1GOOA 3UW6A 2ASDA 4KCTA 5JUMA 4HNTA 5LZLA 5LXXA 3WLNA 2ICSA 1N7KA 3WELA 3SGGA 5A95A 2REQA 1CB7B 5C2GA 5DMNA 1DVJA 4EKJA 3AYSA 3P80A 4RV8A 3E38A 3ZR4A 2ZZ5A 4C60A 4K8GA 3E12A 1LL6A 4DIAA 3LLXA 4L65A 3GLCA 2FMOA 2OOGA 3WUGA 1J2BA 1PKLA 1O94A 4JNYA 1H51A 1TSIA 4C6KA 4GI4A 1W8SA 4JKKA 3G3MA 2NUWA 3GE7A 4MJ4A 4BKNA 4LBSA 4JICA 2OFJA 1FHDA 4AG0A 5IHRA 1WPCA 5U7SA 1A47A 4AHOA 3HGJA 2YCIX 1EXPA 4QG8A 1XGEA 3W02A 3XIMA 4LNYA 5F4WA 3ITVA 3I6TA 3CS2A 3VIPA 1I60A 4XZHA 3THCA 3G2GA 1CXEA 3IARA 3TVAA 3FK4A 2WTFA 3TOYA 4U2YA 4ENLA 2ZRUA 2R94A 1L6SA 3E0IA 4AD3A 3W71A 5L1IA 3VMOA 2DUXA 5AY7A 4DZ5A 3LHWA 5I06A 1OJXA 2BOEX 1D8WA 3AOFA 3RRXA 4FR1A 4JIPA 1CGUA 4A05A 3RITA 4B5VA 4AVFA 3WD1A 1FP8A 1LROA 1EH9A 2TMDA 3W2KA 2DZPA 4UTTA 2PDKA 4R8UB 1EC9A 3WH5A 1ZB5A 3W2UA 2W9CB 3NURA 1H5YA 3FDGA 2QCEA 1HNYA 4CD7A 5E09A 1EBGA 2XSBA 4ED6A 3EDKA 3H12A 5L1JA 2BQRA 4WKHA 2POTA 1OD8A 3MT1A 1JJKA 4TTGA 2DU2A 4DF1A 1JYXA 2C2DA 2ISSA 4O8AA 1NDZA 3RPTA 3B04A 2WM1A 4E0CA 1F7BA 2PZNA 1K8YA 4O1FA 3WK1A 1QMLA 1X1NA 3LERA 3PW2A 2GWNA 2Z00A 2Y88A 1EX1A 3B97A 2WSYA 1V8EA 2WMKA 4ML4A 6XIAA 5FJIA 3BG9A 1R2SA 1GONA 2X1RA 2IS7A 5H6HA 1OGSA 4IFOA 1H7OA 1QBBA 3ZLFA 2PTZA 3KBVA 4AVNA 3FJNA 1TR1A 3APGA 4D72A 4LUIA 2CERA 1NDWA 1C9WA 3MWAA 2O56A 3MW7A 2NV9A 4WK9A 1HZYA 1V3KA 5AHEA 3PG8A 4US5A 4L6OA 4OJYA 1YPFA 4X60A 2PDBA 1UYQA 1FH7A 1KGUA 5G2HA 2R8GA 5GQBA 3O07A 1E6RA 1V4YA 3S5SA 2JALA 4YTRA 4MVAA 1EHNA 3MC5A 3PAOA 3QEZA 5IBXA 5DQGA 4HOZA 1S2VA 3UFYA 5EWGA 4GO9A 4BF7A 4DRSA 1HXJA 3GIPA 2ZTJA 3DFSA 1W3IA 2W27A 1NF0A 1V3IA 1J2WA 1PKMA 2E77A 1LUCA 1L6FA 3GBDA 4MJMA 3LSCA 3Q8QB 1T99A 2TSYA 2XFFA 3KL0A 4UR8A 4UTHA 1YTKA 2G37A 1J0ZA 4MADA 2XGZA 3RR4A 2ZYFA 1XLFA 3CWHA 4A3YA 3CQ0A 1M7OA 2IQDA 1DJXA 3DBNA 2AGPA 4GVGA 3UWVA 3OBEA 4PCTA 3B0PA 4JAWA 1VCGA 3VIJA 4IMGA 3U4AA 1EB3A 3GC2A 4F2UA 4MMWA 4GGHA 3BOFA 4XVEA 3GKAA 3CIWA 1NFGA 4YTSA 4QLJA 1FWFC 4FBTA 1DQWA 4NX5A 1DP0A 2E0PA 2IW0A 3NCOA 4FZIA 4J5NA 5J5RA 2V6AA 4C6PA 1JAEA 2E25A 4DJEC 1ZQ5A 3DFQA 3H2EA 1KCXA 3BUVA 1TR9A 2UY2A 1S0NA 4R33A 5I3GA 1EGZA 1HX0A 3JRKA 3RFAA 2GK1B 4I8YA 2Q8XA 1AH4A 2X42A 2QNEA 4GABA 1XIHA 4EBDA 2QVNA 2CZFA 3GTNA 1K4HA 4FLSA 2P0IA 4XV0A 2GQ3A 3DECA 3TW6A 1KBLA 4GC6A 1TKKA 2PLKA 3PULA 1JPMA 5LNWA 5T9BG 2DW7A 3S2NA 1W5QA 2PP0A 2DT1A 1DWJM 2OELA 3P81A 1EZ2A