1IM4A

Crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
205
Chain Sequence
HHHHHIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DBH
publication title Crystal structure of a DinB lesion bypass DNA polymerase catalytic fragment reveals a classic polymerase catalytic domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 63
structure length 205
sequence length 209
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1im4A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 1im4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1im4A01
3LP1A 1JLAA 2RF2B 4H4MB 3K75D 4MIAA 5CB1A 1LW0B 3QGGA 1NKCA 1XR5A 4TUQA 5F8MA 1FK9B 2YNGA 3H59A 2Q0ZX 8ICRA 4QZAA 3OL9A 4DS4A 4F2RA 5KFVA 1MMLA 3C2LA 1RT3A 3GIJA 4QW8A 3CDUA 3Q8SB 2J6UA 5KFOA 3M9NB 3HVTA 1D9DA 2A1JB 2ISPA 1QE1B 4GC6A 5J2PA 3GIMA 2AJQA 2ASDA 2ALZA 5C24A 2AQ4A 1TK5A 1R0AB 1S9EB 1DTQA 1RTIB 1ZQFA 3KK1B 2JZBB 4YR2A 3HX0A 1KLMA 3JPSA 4ID5A 4EO6A 3KJVB 1ZQLA 2HHSA 2KN7A 2VA3A 2HHUA 4OL8A 1ZTTA 1S6QB 4Q0BB 4EYHB 2KZMA 2JEIA 2UVWA 3KK3B 1N5YB 1HMVA 1BQMB 3TANA 9ICCA 2WRMA 1JLFA 9ICAA 4IQVA 3M8PA 3KLIB 4KLHA 4YVZA 4KO0B 3C6TB 5KFIA 3KLEB 2YNFA 1T05B 4MEXA 3LANA 3LAKA 3DRPA 4I2QB 2ZD1A 3GQCA 1EXNA 3B0XA 1RTHB 3T19A 4M6WB 4DOCA 3MECA 4NLVA 4ECXA 1C1BA 2JEJA 4YXMA 4O3NA 1JLAB 4G1QA 2R2RA 1TAUA 2ZJ5A 1L3SA 4TY8A 4PHAA 3D28A 2FPKA 1RXWA 1XS9D 3DYAA 4YR3A 2YNGB 1D8YA 5F9NA 2VG6A 2AQ0A 1U09A 4QZHA 3PNCA 2BRLA 3ISCA 1T3NA 4ZPAA 4MFCA 1RTDA 2IC3A 1TV6A 2BKEA 1TKXA 3M8QA 3HW8A 2DPIA 2ZE2A 2BANA 1HARA 2HNZA 3HVWA 1KFTA 3DOKB 2WONA 1RTJA 1XWLA 3ISDA 4PGQA 9ICWA 4RUAA 1KEJA 1H38A 4KHMA 4DG1B 5J2PB 1RYRA 2IMWP 4MH8A 5C24B 1JLBA 2BCUA 4KLQA 5CYMA 2UVVA 2MUTA 4J9PA 4J9NA 3OGUA 4M0AA 2EC0A 1KLMB 4NLXA 2AX0A 4K4XA 7ICNA 1REVA 1RA7A 1ZQHA 4O4GB 1NK6A 1C0TB 2RDJA 3HP6A 3KMSA 4KMUA 2PFNA 4H4OA 3H4DA 3QEAZ 3BQ2A 2CJQA 3C5FA 4UB4A 4EEYA 3FQLA 1NNDA 1XO1A 2C2DA 2ISOA 4NLGA 1FKPA 2IM1A 3M9MB 4RPXA 4DSIA 4J9OA 2PI4A 3PY8A 1KFSA 1FKOA 5HBMB 4ECUA 2FLPA 4KBIA 4BXOA 2YNFB 2XY7A 3DI6A 3DRPB 4URQU 2VA2A 3PX6A 1LWEB 3EZ5A 1NK5A 2YKMB 1DTTB 1S1UA 2DFLA 5HHIA 4MK7A 1ZQVA 2P6UA 2YNIA 1RT4A 1U49A 4RQ1A 4R66A 3QZ8A 4ICLA 4WFXA 3G6YA 4DS5A 1DLOB 2VG6B 4I2AA 3KLGA 1RT5A 4BGDA 2OPRA 4TYBA 4F4XA 4WZMA 2Y1IA 5D46A 1WCNA 3SYZA 9ICBA 1RTDB 7ICKA 5BOMA 2IC3B 1BPXA 4MKBA 3H40A 4UBCA 4I2BA 1HQUA 4WYLA 4O44A 4NM2A 1K1SA 5DG9A 5DLFA 2ZE2B 3V6DA 2BANB 4DL5A 3KLHA 4ELTA 2HNZB 3E01B 3QZ7A 5KFYA 4I2GA 5KFMA 3QLHA 2E9TA 2XC9A 1JLBB 5CYMB 2FJVA 1ZJNA 1BQNA 5DB7A 2MUTB 3DDKA 5J0QA 4I7FB 1CUKA 2ASLA 2AU0A 3NMAA 3HWTA 2C22A 4PGXA 3DLKA 3C5GA 4DQIA 8ICCA 1WNEA 3RBEA 1TVRB 4BDPA 1KFDA 3ZDBA 3LDAA 4BWJA 1N6QB 3C1YA 1SKRA 3IG1B 3HKWA 2FMSA 5KFGA 4ECVA 2KZ3A 1FKPB 4MEYA 7ICGA 4NYZA 1NOMA 2NRVA 4HKQA 1X9WA 1FKOB 3PHEA 1BPBA 4B9LA 1RT1A 2HMIA 3CIZA 3KMQA 1S0OA 4NLOA 1MQ3A 4BXOB 4YN4A 2ZUBA 2BQUA 1UA0A 9ICTA 2R8HA 4U7CA 5J2QA 2B21A 4DL7A 4M9LA 4I2PB 4UBBA 4EZ6A 1TVAA 1ZQAA 2HHVA 1S1UB 2JEFA 5KFTA 1NK0A 2YNIB 4TUSA 4FBTA 3ISBA 5DBAA 8ICWA 4MK9A 4O5EA 4KITB 1S1VA 4QZFA 1BPYA 1QLNA 3QGIA 4DQPA 2I9GA 4M9HA 5J2DA 3KLGB 2OPRB 1HYSB 1BPEA 5CR0A 4KLLA 4KAIA 4O3OA 3AU6A 2HWHA 3C6UA 4ELUA 2IHNA 4O44B 1CSJA 1JLQB 4NCGB 3G86A 3V6DB 3KLHB 2WHOA 4ECTA 1VRUA 5HP1A 8ICQA 8ICYA 3B0YA 3HHKA 4DL3A 5KFSA 8ICBA 1RXVA 3QLHB 4YMOA 3OHAA 4QWDA 3RRHA 4EBCA 5KT5A 2W9MA 2FVPA 2R8IA 3I0RA 4DSFA 2FJWA 4NLRA 1DOQA 3PX4A 1BQNB 5DDYA 5HNKA 3MR2A 4YD1A 3DOLB 5EDWA 3OL6A 5F8HA 4RQ6A 3DLKB 4KLIA 3RAQA 5KG1A 3GV8B 2BPFA 2IM2A 5HMLA 4I2IA 3BQ0A 1LWFA 3DLEA 1RT2B 4DEZA 3RB0A 5KG0A 4PUOA 2UVRA 3MEGA 2QV6A 4TURA 4K4TA 4KLMA 8ICKA 1NK4A 1QSYA 3JPNA 1RT1B 4URGA 1ZQCA 2YKNB 2KFNA 9ICEA 4TXSA 3PJXA 3PW5A 4ECQA 9ICGA 4K4WA 1IXRA 5J2QB 2IBKA 3BSCA 1S6PA 3SFUA 3JSMA 1HQEA 4ECSA 1XC9A 2W9BB 1S9FA 4K4ZA 1BPZA 3V7JA 3NL0A 2IM0A 3BQ1A 4WFYA 3H8WA 4PHEA 2WB4A 1HNVA 3GV7B 3H98A 4RT2A 1KDHA 1A77A 1LB2B 3HT3A 2HW3A 1IKWA 1ZTWA 2FPLA 1BPDA 4QZGA 1C7YA 4CCHA 4ZVGA 5DLGA 4ELVA 1ZQUA 4DO9A 2W7OA 5KFNA 1YVFA 5JUMA 1SUQA 2OWOA 4Y2CA 4IQWA 3TI0A 1JKHB 3BSAA 4WE1B 4IRKA 3PW0A 4DFKA 1RT7A 4YP3A 1TL3A 4F4KA 3UXNA 4QWEA 1HNIA 4MFBA 1S9GA 3KHHA 1TFRA 4NLKA 1LV5A 3MDAA 4P4PA 1VRUB 1RT6A 4ZVEA 3TQ1A 5HP1B 4QZCA 1I6JA 3E2EA 5DGBA 7ICOA 1C2PA 4QWCA 9ICRA 5J0WA 3I0RB 4IR1A 3MFHA 4DLEA 5EWEA 3QIPB 3EWAA 4KTQA 9ICHA 2F1IA 4IH7A 1C1CA 1S1XB 4IG3A 3NGDA 4MKAA 3FRZA 3ORYA 2I1QA 1NK8A 4RNHA 5KT3A 4RW4A 3MF5A 4QPXA 1LWFB 2YNHB 3DLEB 3PMLA 8ICHA 8ICUA 4B3OA 3TAMA 2OPQB 5D4BA 5KTQA 4I2EA 2PFQA 1N4LA 4K4IA 3MEGB 4IH5A 4LVSA 4NLPA 9ICQA 1ZQJA 2IM3A 3H8JA 1XR7A 2Y1JA 1SV5A 1A76A 1ZQRA 4EO8A 1SKWA 1BGXT 1S6PB 3JSMB 4IG0A 4NLUA 1HQEB 3OJUA 1SL1A 9ICLA 5KG6A 3LP2A 2DPJA 1HNVB 4NRTA 5KFWA 4JV0A 4I2JA 1QAIA 9ICNA 2HHXA 4NLDA 7ICFA 1IKWB 1MC8A 4K4UA 5KT4A 5KFDA 2FLLA 5KFFA 5KG4A 2JC0A 3KK2B 3MR5A 4P4MA 4TY9A 5KFQA 1RPLA 4RQ7A 3V6JA 1D1UA 1SUQB 4HYKA 5DBBA 3NAHA 2VG5B 5K14A 3KLFA 2I1RA 1RT7B 4I29A 4ED3A 1LW2A 1TL3B 4MFBB 1S0MA 1HNIB 1S9GB 3I0SA 3CJ2A 1NJZA 8ICLA 1RT6B 3MR6A 4ZPBA 3T5LA 4LQ9A 8ICTA 3JPTA 4O3QA 2OPPA 3PX0A 1RZTA 1UWBA 3BSNA 4K4SA 5CP2A 3JPRA 4O5KA 1C1CB 4IG3B 4I2HA 4M04A 2V0NA 2FMPA 1IKXB 4RW9A 5J0TA 3MEDB 1L3UA 2BPGA 4O9MA 3RJJA 4B3OB 3H5XA 3TAMB 2D7SA 2RKIB 3FDSA 3CWJA 3Q8LA 3NAIA 3LP1B 3PZPA 1ZQIA 4M95A 3SFGA 2XGPA 4RZRA 3TFSA 1S1TA 5HP4A 9ICFA 3Q8RB 5L1IA 1SV5B 1Z4UA 2WCXA 5KT6A 3DRSA 3G6VA 2ILZA 1NKEA 4IG0B 2BDPA 2R8JA 3QIDA 3IS9A 4IR9A 1ZQPA 1XSNA 1RT3B 3LP2B 4R5PA 1HUZA 1UT8A 4DSLA 3RB4A 3HVTB 3OL8A 4I2CA 4DOBA 1RYSA 4LSNA 2ZJ8A 4JK1A 1IKVA 2B6AA 5F8IA 1DTQB 2KTQA 4KLJA 4X5VA 4F5NA 4EBEA 3PW2A 4ID5B 4R65A 3MBYA 1UA1A 3Q8MA 4O3SA 7ICUA 1LW2B 4BWMA 3TAPA 3MDCA 4J9MA 7ICRA 3I0SB 3QO9A 3IRXA 3RB3A 4MF2A 1KSPA 4I2DA 4KLSA 4X2BA 3LK9A 3PV8A 1HMVB 5F8NA 3EW9A 3MEEA 1X9SA 4KLEA 3N97B 1JLFB 3C1ZA 5KG7A 3T5KA 3M8PB 4C8KA 1UWBB 4F5OA 3KTQA 2BCSA 2ZUDA 1HJPA 3RRGA 2XO7A 4GC7A 5KT7A 5CHGA 9ICSA 3OSNA 1XU4A 3BQTA 2ZD1B 3PW4A 4DWIA 3LWLA 1JXEA 4KE5A 1TAQA 3MECB 3I5CA 3H8SA 4TQSA 1C1BB 5IIKA 4ECRA 3MTKA 3LALA 2OH2A 3KNAA 3GILA 4G1QB 1OS5A 4TY8B 2NRZA 2XCAA 5CA7A 1S1TB 4RQ2A 4RPZA 5BPCA 4IFVA 3DYAB 1TL1A 2XI2A 2HHWA 2W9AA 2BPCA 2FVCA 7ICIA 1TV6B 2JC1A 1ZQQA 4NRUA 3IS9B 4J9QA 1TKXB 4R5PB 3M8QB 2UUTA 3Q8QB 5KFJA 2F8EX 2AGQA 5J0RA 4Q45A 3OL7A 4UB2A 1V9PA 4Y2AA 3C21A 4Z6FA 2WONB 1ZQZA 1RTJB 1B43A 4LSNB 1JXLA 4ZP9A 3ZDAA 3CJ3A 3UQ0A 2FVSA 4B9MA 2R2SA 7ICTA 3ISNC 2IJNA 1NJWA 1SH0A 2HWIA 1SH2A 4F91B 4FS2A 4XPCA 9ICOA 1REVB 4NXZA 3NBPA 3FSIA 4ZP8A 2IAJA 3BR9A 5HROA 3GYNA 4M9NA 4JV1A 3BSOA 1NK7A 4H4OB 3AU2A 3IRXB 5HHHA 3DMJA 3IHQB 5J2CA 1TKDA 5D49A 4KSEB 4PWDA 1U45A 4I27A 3MEEB 2I5JA 3BREA 3H7IA 3KHRA 3RH5A 2W9CA 2P6RA 5J1EA 5KG5A 4QWAA 3V6KA 3H2LA 4RW6A 3DI6B 1KTQA 5KFKA 4EZ9A 5IIOA 4UB1A 5F8LA 4J9RA 4F2SA 1D9FA 5L9XA 1RT4B 3OSPA 3GIKA 5I3UA 4KV8A 1KHWA 4ICLB 3LWMA 5DKWA 5EWFA 5DQHA 1UT5A 2ATLA 2W8KA 4FO6A 4DF8A 1RT5B 8ICMA 3RJFA 1ZQNA 3PO5A 2B43A 4ED0A 4C8NA 1NJYA 3MABA 4K4GA 2QE5A 4WFZA 5CYQA 1HQUB 4P2HA 4XPEA 1NKBA 1QSSA 4E0DA 8ICJA 4KHRA 4TYAA 4JWNA 3IM1A 2ASJA 4M9JA 1HPZA 4UB3A 4EBDA 5C5JA 2ZJAA 4YCXA 5J2BA 1JLCA 4NLWA 4ZH4A 4DF4A 4UB5A 1L3TA 4Z6EA 2HNDA 4Q8EA 2XY6A 2E9RX 3D5MA 3CJ5A 2WK4A 7ICJA 1ZQXA 4B9SA 2BCRA 3NKYA 2O5DA 3KHGA 3NBPB 1KLNA 4DSKA 1EP4A 5L1JA 2VG7A 5HROB 2GIQA 2HNYA 4C8OA 4XUSA 4PPXA 1EETA 7ICMA 1S1WA 4RNNA 3SV4A 3RR7A 2GIRA 3RJHA 1T4GA 4Z6DA 3DLGA 2RDIA 4JV2A 1ZETA 4Z6CA 3T5HA 4DFMA 4NLQA 2I5JB 5F9LA 1XSLA 2XY5A 2WOMA 2W9CB 5J1EB 4ZPDA 4ED8A 5KFEA 2V4QA 5KFAA 2HMIB 2BQRA 3AUOA 4IRCA 2HVIA 3CJ0A 4RW6B 1C0UA 4PQUA 2AGPA 8ICNA 2HHQA 2NRTA 3BJYA 4FS1A 1ZQMA 3JPOA 4Q43A 3PJWA 4Q44A 3RJEA 2XGQA 3TARA 1S97A 4TN2A 4NM1A 3I5BA 3CVKA 5I3UB 3E51A 4R63A 4H54A 2PI5A 2C2EA 3Q8PB 5J0YA 1S1VB 1S4FA 3V4IA 1T94A 1LWCA 1ZQKA 3CJ4A 5KFHA 4QZIA 5IIJA 1ZQTA 1T7PA 4NLSA 4ZPCA 1MSWD 1HUOA 8ICZA 1QE1A 4NLNA 3C6UB 3UQ2A 1GX5A 4IH6A 2AWZA 4DFJA 4Y3CA 5KFCA 1SZPA 4QW9A 1S9EA 4M2YA 1HPZB 3JPQA 4ZP7A 1ZQWA 3MGIA 4DSEA 1PZNA 3FYHA 3RBDA 3ISND 1S76D 1JLCB 4ECWA 3KJVA 4R8UA 5KFRA 1T03A 2D3ZA 5F8JA 4QZ9A 4LQ3A 2ZUCA 5FDLA 3EYZA 5J2EA 4Q0BA 2BR0A 2VG7B 4IQUA 1BQMA 5J2HA 4KLFA 1EETB 8ICIA 2UVUA 4MFFA 3UR0A 3C2KA 5L1LA 1S1WB 4IQTA 2F1HA 3OHBA 3DLGB 4F4WA 3BDPA 4PUOB 3M8SA 4KO0A 4RQ5A 3C23A 8ICAA 3ETLA 4J9SA 3V6HA 3UXPA 1NJXA 4I2QA 4F4ZA 2BCQA 2WOMB 4YMMA 2WTFA 4IRDA 3N4MB 3C2MA 1S0VA 3M9OB 1N48A 1C0UB 4PQUB 1T8EA 4TQRA 2ZTCA 2FVRA 1SKSA 3RJKA 3OLAA 5EUHA 4YR0A 1Z00A 3T3FA 2VA8A 1B22A 4XA5A 4U6PA 4ZVHA 5J0PA 3V4IB 3N6MA 1LWCB 4ED6A 1JIHA 4NZ0A 1JLGA 5J2FA 1X2IA 4ECZA 3HPOA 4IOBA 4ED7A 4ZHRA 4GXKA 3DOKA 3DRRA 4MK8A 4F8RA 1L3VA 1CEZA 1KRPA 1RAJA 1ZQYA 4DG1A 1XSPA 3H5YA 1L5UA 1U9LA 4NLZA 1VRTA 2JEGA 4ED1A 2KFZA 2AGOA 1BVSA 3RJIA 5KG2A 2R2TA 4QWBA 4R8UB 1T03B 4O4GA 1C0TA 3OJSA 4JWMA 1SL0A 5FDLB 4RQ0A 2HHTA 4PGYA 4RPYA 5DG8A 2R8GA 3EZUA 3CDEA 1W25A 1XR6A 1S49A 4RW4B 2P66A 5J2AA 3CO9A 3I5AA 4QZBA 5DBCA 3PVXA 5HBMA 2JLEA 1ZQEA 3RB6A 2E9ZA 2FVQA 1AROP 3UXOA 3DM2A 4PHDA 2D3UA 3JYTA 1X9MA 1LWEA 1NHVA 2YKMA 1DTTA 2PFPA 4R64A 5DG7A 2J6SA 4GXJA 2R2UA 4YXJA 1RDRA 4M9GA 2B5JA 1COOA 2FPMA 5C42A 3GIIA 5DQGA 3PR5B 1TKZA 1DLOA 5C25A 4DFPA 1Z00B 4RT3A 4URSA 2XWYA 1ZJMA 4XRHA 3N6LA 4RNFA 2UUWA 5J2IA 3Q8KA 4YFKA 1JLGB 4RW8A 4WYWA 5IIIA 9ICMA 3V7LA 4ZHRB 4YQWA 4O0IA 4F5RA 2D41A 3E01A 9ICXA 3DRRB 5K14B 3KLFB 4KN7A 3UPQA 4IKAA 1K1QA 3G6XA 8ICXA 2V4RA 3IN5A 1ZQBA 2XCPA 2R8KA 1VRTB 4RQ8A 3MFIA 2H5XA 2ZTDA 4KLUA 4F4YA 2PFOA 7ICPA 3ITHA 4I7FA 4KKOA 3GFKB 4LZGA 2OPPB 4KLTA 1Z3EB 3THVA 1ZQSA 1U47A 1TVRA 2ZTEA 2J6TA 1TQLA 5F8GA 5J2JA 1N6QA 1QTMA 3MR3A 3NTUA 3TVKA 3ZDCA 5J0SA 3IG1A 1Y88A 4RW9B 4DL2A 4O5CA 1TP7A 4DL6A 4GXIA 4UAWA 3KOAA 3GV5B 4NLTA 4PHPA 9ICJA 3QEBZ 3CDWA 3LAMA 5IILA 4TUPA 5IINA 3DM2B 4RNMA 4I2PA 3JYTB 5EWGA 1MU2A 1NK9A 2HVHA 2NRXA 4ZP6A 2VANA 3DRSB 3QE9Y 9ICUA 5HMMA 2B5JB 2F1JA 5DB8A 3ZDDA 4I2FA 5C42B 1TK8A 8ICSA 4Q8FA 4DQRA 4F93B 1TKZB 3ZD8A 1GX6A 5J0UA 5C25B 3TAQA 2C28A 3UQSA 1SH3A 1HYSA 5KFUA 4LZDA 1IKVB 2B6AB 1JX4A 5I42A 2GWSA 4IFYA 4M47A 4RW8B 5L1KA 1JLQA 4NCGA 5J2KA 1QAJA 2IA6A 3RH4A 7ICSA 2OPSA 3EPIA 4ZMMA 3M8RA 3N6NA 1S48A 3EPGA 5J2MA 8ICOA 3QO9B 4F92B 5DQIA 3QGHA 4NY8A 2BCVA 5J29A 3DOLA 4KKOB 3ITHB 5EOZA 2W7PA 5KFLA 4MF8A 4K4YA 3V7KA 1RT2A 5BOLA 1NHUA 3H5SA 3HVAA 5J2NA 3PMNA 1ZQGA 4J9LA 4XQ8A 8ICGA 4ED2A 4IDKA 1S77D 1ZQDA 2BRKA 2YKNA 4KLDA 1IKYA 3GDXA 2NRWA 3OLBA 2CKWA 4DSJA 2ILYA 2W9BA 4IFVB 5KG3A 4UQGA 1TL1B 1MU2B 3QYYA 5HLFA 4O4RA 2XI3A 2FJXA 1JMSA 1SL2A 4DL4A 3LP0A 4I28A 4O3RA 4WZQA 4NLYA 3FFIA 4DQQA 3V72A 3UPFA 4WXOA 7ICEA 2IHMA 3KHLA 8ICFA 4GLXA 3V81A 1TKTA 7ICVA 1JKHA 5DB9A 2BE2A 3K4GA 4WE1A 5J2GA 4FBUA 5I42B 3RH6A 4IFYB 3BGRA 2FMQA 1JLEA 4TLRA 4YMNA 4EYIB 1S10A 5J0XA 1QSLA 3KLVA 4F3OA 4UAYA 4K50A 2OPSB 5DGAA 1U4BA 4LSLA 4F50A 4B9NA 2IAJB 5J2MB 4QZ8A 4J9KA 2BGWA 3JPPA 3ZD9A 4DOAA 1S0NA 8ICPA 4MIBA 2C2RA 5CWRA 4QZEA 3ZDEA 3DMJB 4PWDB 4P4OA 3QIPA 4MFAA 4XO0A 1J5OA 1S1XA 5D3GA 2AX1A 4RU9A 2MAXA 9ICVA 5DDMA 4YG2A 3RR8A 1JN3A 4RNOA 3PW7A 1WCLA 2YNHA 3PO4A 4KB7A 4KLOA 8ICEA 4KFBA 4RW7A 4YD2A 4KN4A 2OPQA 7ICLA 5J2NB 4Y34A 4RUCA 3IGVA 2RF2A 4H4MA 1KHVA 3H5UA 4B9TA 1LW0A 4IDKB 3FQKA 3VQSA 3T1AA 1QUVA 5CJ7A 1FK9A 2KZZA 5IIMA 3SI8A 4PH5A 4IQXA 4C8MA 3TFRA 4O3PA 3UDLA 1IKYB 1D8LA 2PXIA 2LYHA 4ZVFA 4KV8B 4F5QA 4C8LA 3RAXA 5HLFB 4QZDA 3H4BA 5J0OA 2W8LA 1ZYQA 9ICPA 4DQSA 1N56A 1TK0A 4YMEA 2A1JA 2IJFA 4DLGA 4JUZA 4UAZA 7ICHA 3LP0B 5T14A 5CYQB 3RTVA 5KT2A 3FFIB 3KK2A 1MQ2A 5KFBA 1IM4A 3IGNA 1R0AA 1RTIA 2BQ3A 1D0EA 5KFZA 4RQ3A 3KK1A 2JZBA 4K4HA 3V81B 1TKTB 4F5PA 4ECYA 1U48A 2BE2B 4WXWA 2VG5A 8ICVA 3BGRB 1JLEB 4M94A 3T5JA 4R0EA 2HNDB 3ICLA 1TV9A 3RJGA 2FLNA 1ZQOA 2HAIA 4LSLB 1S6QA 7ICQA 4K4VA 4RQ4A 2V9WA 1EP4B 3KK3A 1N5YA 2HNYB 3MGHA 2GC8A 4KLGA 4B9VA 3SZ2A 3KLIA 3SV3A 9ICKA 1J5OB 5D3GB 3C6TA 5TZVA 3KLEA 1T05A 1IKXA 3MEDA 3PR4A 2ZKUA 1RTHA 2M9NA 5KFPA 9ICIA 4B9UA 5KFXA 4M6WA 4KFBB 5JXSA 4RW7B 4G3IA 2RKIA 1DGSA 2BHNA 5DB6A 1RA6A
chains in the Genus database with same CATH superfamily
1IR2A 3WZ0A 3LP1A 1JLAA 2RF2B 3KG0A 3D4JA 1NKCA 1XR5A 4FPIA 1U6FA 3UD3P 5F8MA 1FX4A 5GVQA 3HFZB 3H59A 2OD6A 2W4CA 1RKJA 1F5AA 1GKPA 3OL9A 1XMOJ 1WC0A 3HHDA 1R0CB 2FVKA 2XZWA 2DHSA 1H0HB 3TRGA 3QPIA 1RT3A 2L5YA 3GIJA 2LHTA 3Q8SB 2J6UA 2OGUA 3AXMA 2DTJA 3SXLA 4HH1A 3WK9A 3QGPA 2ZH9A 1VBYA 1QY7A 4C0HA 2CQDA 5C24A 1TK5A 1KWMA 2RSQA 1S9EB 2RILA 3NNAA 1K47A 2G0AA 3KK1B 3H7HB 1Q1KA 2XTJP 3HX0A 3JPSA 4EO6A 3BE7A 2Q09A 2PA3A 2CJBA 4CO1A 2CFXA 1ZS6A 5JMNA 3U1LA 1TMJA 4Q0BB 1SXDA 5BXIA 3RGIA 3KK3B 3D9BA 1BQMB 1RLCL 2ZC3A 4X84A 1JLFA 1XRTA 2PO4A 3M8PA 3KLIB 1X4EA 3MR7A 2G1DA 1FFWB 3C6TB 2NPIA 1S5LU 3DRPA 4XAKA 3RW6A 2ZD1A 5DS7A 1EXNA 1YSJA 5FD1A 2KVSA 1N5TA 2YKQA 2MSSA 4M6WB 4DOCA 2NO5A 2MQQA 2IDEA 3L4BC 1YX2A 3TADA 2PMHA 1QH9A 4YXMA 2QG9B 4LBPA 5EE1A 4PPDA 2AHOB 2V2VA 1I94F 4CDGA 2XHWA 1RXWA 1XS9D 3DYAA 2YNGB 5F9NA 4XK8C 4X4SA 1TZ0A 4NI2A 3WBZA 4HR2A 2XYHB 2RQKA 1RTDA 4YIWA 3HRDD 1EF2A 2FQQB 3T9ZA 1K6WA 1TV6A 2MLYA 4USMA 2BKEA 1TKXA 2DEIA 2DPIA 2ZE2A 2R7VA 2EAOA 2HNZA 2LMRA 3DOKB 3EUNA 2WVCA 3EGZA 3ISDA 1KEJA 1OPIA 3CCRS 4DG1B 1URNA 1X4CA 3VALA 3MAAA 4KLQA 2MZQA 3CJKB 3CJ8A 5ALYA 3HKZC 1RK6A 7ICNA 3CP8A 1YI2S 3LYSA 3IP0A 2B9XA 3Q22A 4G9BA 3BQ2A 3C5FA 3HLUA 2BACA 3GZ7A 4F72A 2YWEA 4OO1J 1FKPA 3U1NA 5AKKA 2PI4A 3DU5A 3EUB2 3OOQA 4ECUA 3CB4A 4NV0A 2FLPA 1FXDA 2B0CA 4QIGA 4LJMA 3M6VA 4BXOA 3JTNA 3C16A 3TX0A 2VA2A 3PX6A 1EJVC 4ZVTB 1DTTB 1S6UA 2K8GA 2YNIA 2RHFA 2XB2D 3TVZA 3K1RB 1RT4A 1UCNA 3RUBL 4Q7AA 4CP5A 3QZ8A 3H20A 2K4PA 4WPAA 1YNYA 3PYGA 1RT5A 4C7ZA 4BGDA 2R18A 2OPRA 4O3MA 4ZPVR 4Y2TA 9ICBA 3IDWA 3K57A 7ICKA 5BOMA 4BC9A 4UBCA 3SQOP 1LK5A 4O44A 3P6YC 3KLHA 5C2GA 2UUAJ 2AQVA 2PA8D 2YN4A 3QZ7A 3WIUA 4I4BA 4WF9Q 1ZOLA 4LBIA 4YB6A 4I2GA 4HT7A 4GKKF 1RJQA 1OIAA 4LFBJ 2A2CA 2KD1A 5CYMB 2ZUAA 4DV3F 1WUUA 1ZXIA 1ZJNA 5DB7A 1YRXA 3LTOA 1AFIA 4NWBA 2F2AB 4CO5A 2FVMA 4G65A 4PGXA 2EZZA 2YVSA 4DQIA 8ICCA 4OV1A 1VISA 4YS2A 2FHOB 3ZDBA 3LDAA 3LGMA 4NL9A 3IG1B 3BH6B 1HBNB 4FYWB 1MN8A 2OEHA 3AQEA 1GMUA 4UT4A 4V19J 3PRVA 1HBMB 1NOMA 1ZOTA 4C4SA 3NUQA 1PK1B 1I5OB 3E0FA 1FKOB 4V19X 4Y2MA 3ZFVA 4OHWA 4CM0A 1UVNA 4LVNP 4YN4A 5FSEC 5THWA 2K1RA 1UA0A 3HHLB 3CCSS 1Y3KA 2A0FB 4WU3A 4UBBA 3I32A 1MWYA 2GW8A 2J0SD 1S1UB 1A9NB 5KAFU 1NK0A 4TUSA 2F65A 4PXDA 5D0GA 2F4VF 4P0PA 3GWCA 1HNXJ 4FZNA 1QLNA 3GJQB 4KQNA 3KLGB 2GO8A 2K60A 1AZSB 2LM1A 3SEIA 2N1RA 4Y2UA 2DHXA 2HWHA 1LFPA 3UCZP 3C6UA 4ELUA 3PEHA 4NCGB 3G86A 3V6DB 5IT0A 5KAKA 2Z00A 2KU7A 3TQEA 3QATA 4ECTA 4F3QA 5HP1A 8ICQA 8ICYA 3T1HF 3HHKA 5KOXA 4DL3A 1N63A 1X4HA 2E7WA 2WVEA 2R8IA 3GJSB 4Y2PA 4X62F 2JFKA 1OYEA 2HFZA 2IIHA 2PDAA 2ZBQA 5EDWA 3OV7A 2KG5A 1FWFC 2W01A 3DLKB 4KLIA 1E9YB 1SXLA 3BQ0A 1IV8A 3DLEA 5BYRA 1RT2B 1XNRF 3P4UB 3MUVP 2XYPB 3A1YG 3DLHA 2X1BA 3B82A 3Q0AA 3F73A 4TU7A 5SZTA 3MEGA 2DXFA 1HKAA 3GCWP 2QV6A 5HI7A 4CNQA 4KLMA 4NXNF 2DH8A 3FMBA 4CT8A 4TXSA 3PJXA 3ZTPA 9ICGA 4K4WA 2E1PA 2AIRB 3BSCA 4OYXA 3FSYA 1HQEA 2OOFA 1XC9A 1B70B 3V7JA 2AMCB 3NL0A 3BQ1A 3E74A 5HMFA 2UUCJ 5IT4A 4FVMA 2DB1A 3MD1A 2VU5A 3QX7A 1IKWA 4QZGA 1A7GE 3ONNA 5L9NA 5DLGA 3PYFA 2LMIA 1WG8A 1RA0A 5KFNA 5K4LA 1SUQA 1D9AA 2MXYA 3MTWA 2IRXA 4Y2CA 3BSAA 1YBAA 3S6JA 3PW0A 2QB0A 4FKYA 1E9ZB 4MFBA 4F4KA 3D6FB 2G3FA 4M5GA 1VRUB 3GG0A 2GGPA 3TQ1A 4QZCA 2B3TB 2KV2A 2CWXA 2E66A 3QU7A 1PSDA 3WKAA 5DGBA 7ICOA 1M5HA 2N3OA 3CD7A 2DIVA 9ICRA 3I0RB 1V6HA 4PG6A 4WKRA 3QIPB 1S12A 3SMZA 1I51B 2F1IA 2P9EA 2L48A 3NGDA 1YBQB 4CNYA 2P8IA 3ENVA 4RW4A 3ILOA 5CZXA 2YWKA 1CJTB 2OPQB 2PLMA 3SCLE 4LR8A 4IO9Q 2PFQA 2DY9A 4M8LA 3EDRB 4RDWA 4L73A 4N47A 3RN6A 1BC6A 4NLPA 2IM3A 2LVWA 1PIEA 4TU8A 4DV0J 1KQFB 4DUZJ 4NLUA 2GMLA 3MMCB 3F2BA 4A8YA 1SL1A 1ITPA 2PEHA 3BPSP 3LP2A 3P45B 4JV0A 5IZHA 5T41A 5GAEU 2QGFB 9ICNA 4NLDA 3N7SC 1E6VB 1RBLA 3W2VA 3L95X 3R5GA 2BJ7A 3HFKA 1WTFA 4BKNA 2HSEB 4ILLA 4TY9A 1WWVA 2COLA 3V6JA 5AI4A 4QIEA 2LXFA 2Z30B 3NAHA 3Q2TC 5K14A 1XNQF 1PO6A 4ED3A 3EDQB 1U26A 3LO3A 1UVMA 2QRRA 2W2NP 1JRPA 3SDEA 8ICLA 2JRZA 1RT6B 3A12A 3AQPA 2VC1A 4ZPBA 3G82B 2LQJA 2OPPA 1RZTA 2HKEA 2GFFA 1Q78A 1UWBA 4U95A 1C1CB 4I2HA 3W1YC 2EFGA 2W4PA 4YDDB 5LMNF 2AJ2A 4RW9A 5J0TA 1L3UA 2RD5C 2VUNA 2HVZA 4O9MA 3QNMA 3VAMA 1S3TC 1HWUA 1RK8A 3TAMB 3W2WA 2MQPA 3PZPA 5BYSA 2Q79A 3CXCR 2G0JA 4C8ZA 2XGPA 1VYAA 3ETOA 4HVZA 1SV5B 5KT6A 3DRSA 1Q7YT 3D6JA 2DO0A 3GFZA 2LEBA 2ZZNA 4KC5A 4R5PA 4PG8A 4DSLA 4OI0A 2OSRA 2XNRA 4DOBA 1RYSA 1YMYA 2ZXIA 1RAHB 1MROA 5CHCB 5F8IA 2HQGA 1V5VA 5AM5A 4FXDA 4G6VB 2HDOA 4EBEA 2GSEA 2ZH3A 3Q8MA 3MM9B 4G7EB 2H3FA 7ICRA 2CQHA 3I0SB 2R7RA 3QO9A 3L7PA 4ZLNA 4X2BA 3W9JA 3LK9A 1HMVB 3GONA 2MMYA 5F8NA 3JSBA 1X9SA 5LSLA 5KG7A 2DR7A 3R9LA 2ZUDA 3UN5A 1XU4A 1FNXH 2F63A 3PW4A 4DWIA 3LWLA 1B99A 1UEKA 4CLSA 4KE5A 1UPPA 1PJ7A 1TAQA 3DEEA 1ZD2P 5IIKA 3NS1A 4LRDA 2DGQA 1SC1B 3MTKA 1ZZFA 2OH2A 2BA9A 2GVDB 2G13A 2V8VA 2NRZA 5CA7A 1S1TB 3ZI4A 2MJUA 4P7TA 4UB8U 2XI2A 1KONA 2MKJA 3H0MB 2HS4A 1RWVB 1U1RA 2ZOFA 2KSOB 4OJHA 4J9QA 1EKRA 3M8QB 3PJ9A 2V94A 2UXBF 3Q8QB 1N5VA 5J0RA 4XDCA 2WONB 1B43A 3FK4A 1JXLA 3MPGA 3CJ3A 4JI8F 5D0RA 3M2RB 2CDQA 1SH0A 2VFUA 1BWVA 4MT1A 3ZO7A 4NXZA 2RRDA 1HA1A 1NAQA 3NBPA 3FSIA 2ZDOA 2HSZA 3BR9A 5HROA 1R31A 5AE1A 5LSOA 2RS8A 3BKTA 1PGZA 4JI4F 3BSOA 2C3YA 1IWAA 3I96A 3IRXB 5JU5A 5HHHA 1H6KX 4YEAA 2KO1A 4KSEB 3TWZA 1YZ7A 3VGTA 2EZYA 4DZHA 4I27A 4NPOA 3ZZOA 2I5JA 3BREA 2G06A 4B3TJ 4HACB 1NPKA 1YZ6A 4KH1B 3AY0A 2W9CA 2P6RA 1XTZA 3AH6A 4IO1A 5KG5A 3HSGA 2V68A 4EMDA 2CQPA 2JLGA 3W5YA 1KTQA 4UQTA 2CQ2A 4EZ9A 2ZDPA 2OLWA 4B3MF 5IIOA 5F8LA 1BQXA 4F2SA 3DN9A 2J76E 2BOPA 1NZPA 1OSCA 2LXIA 2P6TA 3OSPA 3N7PD 5I3UA 4LF4J 4LRBA 5DKWA 5EWFA 4F0MA 3IV8A 3F44A 2P50A 2ATLA 1RWPB 2R7XA 1UVLA 4JI3J 3E3XA 4ALZA 5CYJA 2BJ1A 4BBYA 3CJRA 1FTCA 3UMGA 1NSPA 2QE5A 4WFZA 5CYQA 2R7SA 3I31A 5ALWA 4TYAA 4FF4A 2L3MA 3LF0A 6FD1A 1HPZA 2GWNA 9RUBA 4PZOA 4P0QA 4CLYA 1RE1B 1QVGR 3P5TL 1JLCA 4NLWA 2YPZA 4AQYJ 3FRYA 4B9SA 3NKYA 1PC4A 1KLNA 4X4QA 5DZ6A 1RG6A 1WC5A 5I3PA 1DK2A 2VG7A 2GIQA 4QOTA 4AFFA 4G1PA 1S1WA 2F8LA 4RNNA 5B0FA 2F1FA 1T4GA 3DLGA 3FKBA 4QIFA 2WFAA 3T5HA 3Q23A 2VOOA 3D2SA 2MZTA 3UM9A 5J1EB 3PRBA 3S1TA 2ZH5A 2HMIB 3M2VA 5AKHA 2JH7A 3AUOA 3PNIA 1C0UA 3KZIU 3VR1A 2H9ZA 2NCKL 4GIBA 2NRTA 2FY1A 3BDEA 1VI7A 3TUJC 3TARA 2MHNA 5A8RA 5IFMA 4TN2A 5AI0A 3VAGA 3E51A 4H54A 1N33J 3Q8PB 2VODA 1S4FA 4PCQA 2E8PA 1T94A 2R7QA 4ZPTR 1VDVA 4BCAA 1T7PA 2HG4A 3US5A 1ONXA 2OHDA 1YRRA 3BYPA 3IM9A 5J8YC 1WF2A 2W1BA 2B0GA 3TUZC 4NLNA 3PSTA 4KGVB 5HMYA 3V7PA 5E3QA 2AWZA 4DFJA 3D54A 4CQBA 1S9EA 4N8OA 3JPQA 1R3NA 2WVFA 1RSCA 4DSEA 3RBDA 3I56S 2LEPA 1S76D 3DUGA 1NLKL 1IQZA 1J2NA 2YX8A 2WB1C 3NGKA 2DKZA 1M5OC 3EYZA 3FVYA 5J2EA 4Q0BA 1EJTC 2XIDA 1BQMA 1GO3F 5J2HA 4MFFA 1TFWA 1VQ8S 1I94J 1V4YA 3EGNA 1Q82T 3M8SA 4C7YA 3ADAC 5ALTA 8ICAA 1FVSA 4DPOA 4F4ZA 2WOMB 2JOQA 2Z7JA 4IRDA 1RTZA 3N4MB 2VH7A 3M9OB 2XHCA 3TACB 2KFYA 1N48A 1J5EF 4AQLA 1QAXA 3HM9A 1N36F 1SIZA 1EQ0A 3ISZA 3R5DA 2DNYA 1T9UA 5ALUA 2V2QA 3M1VB 1NNLA 4RQNA 2NYVA 5HR7A 3RJKA 1Z00A 1B22A 4K8RA 2VQFF 4NWIA 4ED6A 4MAKA 4YB7A 1Q5VA 4OYBA 1JLGA 5J2FA 1VDHA 1CULB 5ALJA 2I5HA 1AYEA 1QQ7A 4ED7A 4GXKA 3LVWA 1A5NC 3DOKA 1FDAA 2FHJD 4UAVA 1RAJA 4DG1A 2Y1RI 3O2IA 2E5GA 4DUYJ 2WVBA 4CF4A 2KFZA 4A8KA 1UFWA 5KG2A 3IXQA 2D69A 2JH1A 1PYOB 1WDDA 1KRBC 1T03B 5FDLB 2W55A 3I87A 1GFWB 2G0CA 3SQGB 1WHVA 2HGNA 3V2UC 1S49A 2P66A 3R5BA 5AKYA 2P6SA 3I5AA 1HBOA 3FUYA 4UAUA 3A0BU 3PVXA 2HOFA 2L08A 3GLJA 3HZEA 3S6EA 1P27B 2VHLA 4QR0A 3T8LA 1Q16B 3UXOA 2GAHC 2I38A 3DM2A 1P1MA 4FE3A 5MAOA 3MPUB 2AJ0A 1HWJA 1DTTA 2J6SA 4GXJA 2R2UA 5ETVA 1HWKA 4ILRA 1RDRA 4GKKJ 4X4RA 1I3OB 5B0CA 2KICA 1HHQA 5C25A 4DFPA 1PK3A 1XMQF 4RT3A 3HJVA 2J8AA 4F3MA 1HWIA 3A8EA 4QYZK 2UUWA 5J2IA 2CPJA 3WKBA 4I67A 1L7MA 2FE9A 2D41A 1EJ7L 2GMJA 3HJFA 4IKAA 1TTHB 3DHXA 8ICXA 2GOKA 2EC2A 2XCPA 2VFTA 1VRTB 3EWGA 2QFJA 4FPRA 4KKOA 4ZLPA 3IM8A 1ZQSA 2OTJS 1Q79A 1IXKA 4DV2J 2AYBA 4P72A 2J6TA 1FXLA 1TQLA 1L7OA 2V6AA 3NTUA 1Y00A 3TVKA 5J0SA 2OGJA 3IG1A 1Y88A 3AMZA 1CJKA 4DR1F 3PKYA 5GAEI 2F4VJ 3M6UA 4KX3A 1HBMA 3G71S 3J7ZT 1PK1A 3GV5B 1PBUA 4CLUA 1O6XA 4NA2A 3QJLA 3CW2C 3CDWA 1AT1B 2NUUG 3HHLA 2XMUA 3QWPA 5IINA 2ZJQQ 4RNMA 5A8WA 1MU2A 1NK9A 1LWXA 2RUGA 4JYAF 4ZP6A 1IJFB 4X4OA 3T1YF 2F77X 3RZAA 3W66A 2B5JB 2F1JA 3LW5C 4RBVA 1Q8KA 1TK8A 5AT1B 1TKZB 1GX6A 5J0UA 1QJHA 1OO0B 4X62J 4BUGA 2C28A 3UQSA 4M5DB 3UO0A 4XTTA 5HQLA 3EMTA 1UJ4A 4IFYA 1G6BA 4JI7F 4M47A 5ETMA 4NCGA 1GXTA 3GZFA 2E8MA 2OPSA 1GH8A 1P1TA 2AEJA 4ZMMA 4OHYA 3M8RA 1XNRJ 2OMLA 3ULHA 2ZKTA 2DNKA 3GP9A 5J2MA 1X42A 3BZCA 3QAUA 1B0PA 7FD1A 2PFDA 2OKQA 4AXJA 1KRAC 3ETRA 4CE6A 3IP4B 3GJTB 4UOFA 1HD0A 4EPBC 2W7PA 4U7UD 1FXRA 3QWUA 1VQMS 1XIQA 2WF8A 4JMUA 1S4EA 2JDJA 5IV3A 4XIUA 1RT2A 3H5SA 3HVAA 3PMNA 4C60A 2A19A 5L46A 2NXEA 2AYEA 2UZ9A 4J9LA 1ZQ1C 5E41A 4C0OC 1YJNS 4CTAB 1S77D 1OQ6A 3L3CA 3TJ8A 4AYBC 5AKEA 4UARA 1Y10A 1IKYA 2HRYA 3OLBA 3PG9A 1C20A 2G07A 4U96A 3H0LB 2QA1A 5HLFA 4C9DA 1FI4A 1T9YA 3BH7B 4F0LA 4UY8T 1JMSA 1TL7B 3PCOB 4DL4A 3LP0A 3THTA 2VKRA 3FFIA 4M5JA 3NASA 4DQQA 3W9HA 1VQLS 3V72A 4F0KA 4WXOA 4CGZA 3NCQA 4Q2LA 1UFLA 2IHMA 1LXNA 5F3ZA 1AQ6A 4JI2J 2W54A 3IAS9 3GYGA 4FBUA 2F8MA 2XZTB 2K4IA 2XMMA 1JNZB 1S10A 4DR3F 2RVJA 4F3OA 3UNYA 4USUA 4K50A 1YLXA 1RHKB 1U4BA 4B9NA 2BGWA 1PCAA 3JPPA 2UUBF 8ICPA 4MIBA 4R88A 3TO8A 4F4AA 3POTB 3ZDEA 1NB7A 2Y8YA 1B4FA 4DBQA 3QIPA 4MFAA 4XO0A 1DARA 1FEEA 4RU9A 1VQSA 9ICVA 4Q5VA 2IOFA 1YBQA 1HBUA 3RR8A 2PEBA 3ED5A 4ZCKA 3PO4A 4RW7A 5M2PA 1CJTA 2OPQA 4Y34A 2MGZA 4OLPA 5F0WA 1UZHA 3MMAB 4WK1A 2HHHJ 3I4HX 4WTOB 3H5UA 3BN7A 2E1FA 2DBYA 4IDKB 3T1AA 2G08A 5CJ7A 4K0KJ 1Q4RA 2FHKA 2YXLA 2LYHA 4ZVFA 3TUIC 1FFSB 2OO4A 3MMCA 4F5QA 2KOBA 1XNQJ 2JMGA 3GYXB 1LQ9A 2DRDA 5HAOA 2W8LA 4PXCA 5LL6d 2ZHOA 4UUWA 3B54A 3FEYB 4GVBA 4O0NA 4CDIA 1X0FA 1KVKA 3OW2R 5AK3A 1LEOA 3F53A 1R0AA 1F60B 2I6WA 4K4HA 1TKTB 4USTA 4GKJJ 8ICVA 2PUZA 5G0RB 1T95A 5LMNJ 1NPRA 3RJGA 1FJEB 4YDXA 2EDUA 2HAIA 4LSLB 1S6QA 1RU2A 3OPXA 2BABA 4RQ4A 5LT5A 2Q4TA 1EP4B 2J9DE 1ZBTA 3MXHP 2DRBA 1A5LC 4GY7A 5FIIA 4B9VA 3Q8UA 4C48A 2YKAA 3UD5A 5F0UA 2I9UA 2BBEA 4DV1F 5D3GB 3E58A 4N76A 1JWWA 4ZVRB 2F44A 4M5IA 9ICIA 2FDRA 1FCAA 3PACA 4QBUA 1T3QA 4G3IA 4DZ6A 5DB6A 2HZCA 4WFYA 4FKXA 1RA6A 1B0TA 1WJ9A 4AL6A 1RI7A 4MIAA 1R8HA 3QGGA 4TUQA 4QU7A 2MDAA 5FP0A 4LMZA 2QARB 2Q0ZX 4B02A 4Y00A 3FEQA 5A6WA 4DS4A 1XRFA 2HFVA 2BJ9A 1NCLA 4K2JA 3C2LA 4F7VA 4QW8A 1VC0A 1RCXB 3MOZA 2A1JB 2ISPA 4DR2F 3UDEA 1JI7A 2AZ1A 5J2PA 3GIRA 4UW9A 1DQ9A 2ASDA 2AQ4A 1YJWS 2CZ4A 2JL9A 1WHWA 2ZIUB 2EG2A 1RLDA 2PMZC 1SQFA 3K59A 5D6GA 1KLMA 2QA2A 3DHWC 1G2EA 1RHRB 1ZQLA 2A1BA 2BUNA 1FFGB 3QJJA 2B6GA 3MM9A 2KN7A 3MCMA 4CO0A 2FZGB 1CS4A 2VFVA 1ZTTA 2VDHA 4EYHB 2JEIA 1DY3A 1H2UX 1HMVA 3TANA 9ICCA 1O8BA 2CA9A 9ICAA 3WU2U 2KRBA 5BJRA 4EWTA 4YVZA 4DL0C 3KLEB 4LVOP 3VZHA 2YNFA 1T05B 4MEXA 3LANA 1N61A 4I2QB 2AYGA 2OMOA 3GQCA 2OD4A 1LKYB 4HEA9 3BR8A 4CO3A 4TVAB 1F5CA 2JEJA 2ZM6J 2CJ9A 3FMWA 3T9NA 4EX6A 1JLAB 1TAUA 2GVDA 4PHAA 4OI6A 2FPKA 1NXIA 3VGSA 5FLXY 1WTBA 1X0PA 2B56A 3EVOA 2R7WA 4QZHA 2BRLA 1T3NA 1X9XA 4MFCA 3M8QA 3L7UA 1VC6A 2BANA 4JI4J 4AL5A 3HVWA 4Y2RA 4OZ2A 4DX7A 2WONA 3JQKA 4PGQA 4KHMA 1RYRA 4CLWA 1T9VA 3ELHA 1RHJB 4MH8A 2IOFK 5C24B 2BCUA 3F41A 4J9PA 1WSRA 4M0AA 2EC0A 3FSXA 2AX0A 1RA7A 1YJTA 4C4TA 2JHEA 1ZQHA 2F76X 3MDFA 4O4GB 2BW2A 1U1OA 1NK6A 2RDJA 2YWWA 3HP6A 3KMSA 4KMUA 3R7NB 3S01A 1TUVA 2PFNA 3NGTA 3H4DA 1U1LA 1R8CA 3N9UC 2DGXA 2HS0A 2AF6A 4NLGA 2IM1A 4RPXA 4J9OA 1FWHC 4HACA 2RU9A 1KFSA 4ICAA 3BS9A 1KR4A 4YUDA 3C66A 4OX9F 4KBIA 2E5HA 4QU6A 3DRPB 1V5IB 2ZG6A 1JXVA 3EZ5A 4LH8A 2KT2A 5H1SV 4DXLA 3KUEA 2RIJA 5HHIA 3BF4A 2P9CA 3QRQA 4Y6IA 2YB4A 3M30B 5C0YA 2GOLA 3IR6B 1IVZA 2XS2A 5ITHA 2FY8A 4DS5A 3BKUA 4PL1A 2W43A 4I2AA 4NI2B 4TYBA 4F4XA 4WZMA 1GMWA 1WCNA 3SYZA 2LDIA 1RTDB 3H40A 3P96A 2M8HA 4UZBA 4W98A 3I9V9 5DG9A 2ZE2B 4DL5A 4ELTA 2HNZB 4L75A 1FRXA 4USJC 5KNIA 2R7UA 4PZNA 1X60A 1SI9A 3EE3A 1POJA 3I1YA 1EZZB 3O44A 3AJDA 3QAEA 1FO4A 2O66A 3QLHA 4RKUC 2E9TA 1FRKA 2E44A 3MAAB 2QLWA 4OI2A 1BQNA 3DDKA 4BLGA 5AKGA 1CUKA 1ZD3A 3NMAA 4DCCA 1N5WA 2K3KA 3RBEA 1EAYC 2AP6A 4L6V3 4FF2A 4BWJA 1N6QB 3DLBA 3C1YA 1BD6A 1SKRA 3M6ZA 1FNMA 5LXXA 3HKWA 3OR1A 1W26A 2OEKA 4GO5X 2KZ3A 1FKPB 7ICGA 2FLOA 1HI0P 2EBEA 1X9WA 1FJGJ 1YK9A 2HMIA 3CIZA 3KMQA 1S0OA 4DPTA 1MQ3A 4BXOB 2HRUA 2ZUBA 4LF9F 3K8WA 3C16B 5A8KB 2DGZA 3D2WA 2BJEA 4EZ6A 1SJRA 2M70A 1HEKA 2M52A 1IBLF 3R9KA 2YNIB 4S0MA 2RRNA 4FBTA 3JTPA 1NDPA 1V3ZA 4EPDC 3ISBA 2HBQB 2D1CA 5DBAA 8ICWA 4O5EA 4KITB 3J81j 4QZFA 1BPYA 1VJQA 2N3LA 1PAUB 1SWWA 2OPRB 4JI1J 2V4JA 4Z37A 2CQ1A 1O12A 5CR0A 4KLLA 4KAIA 4O3OA 2M5YA 3BN4A 2XWXA 4V1Ak 2IHNA 2EZXA 4O44B 5AE2A 1CSJA 1FFVA 1S79A 3KLHB 1SC4B 2WHOA 1RBAA 2HGMA 1Q5YA 5KFSA 1AXQA 2QYGA 1S7IA 4JB8B 3OUYB 4RJVA 4YMOA 1RWUA 4A47A 4LFCJ 3RRHA 2W9MA 3LSCA 1HNZF 2FVPA 4HI2A 1UCVA 4DSFA 4NLRA 3TA0A 3PX4A 3V5RA 5DDYA 5HNKA 4CEUC 3DOLB 2GCFA 5F8HA 4RQ6A 1J5EJ 3R7SB 3RAQA 5I4MA 1A0PA 1RQNA 1UETA 1IJEB 5E7OB 1VLYA 3H90A 4K5SA 4DEZA 2HFUA 2HBZB 1U2RA 3O6QA 1O51A 4LFBF 1OXJA 1SQGA 4M63A 4TURA 2VQFJ 3JPNA 2YKNB 2JRSA 2KFNA 4DN0A 2K1RB 3GR1A 2D3DA 2IBKA 2IVYA 1S6PA 3JSMA 4ECSA 2IBOA 2IM0A 4WIQA 2X51A 1HNVA 1UL3A 4L9XA 3FEZA 4I1TA 5C7PA 5IV4A 4FVCA 3HT3A 2HW3A 2ROPA 2G4BA 2G2OA 2EFVA 1C7YA 3MZIA 2ZBCA 4UBPC 4CLLA 4DO9A 2W7OA 3WQPA 3A3PB 5JUMA 2ZZMA 2NXNA 1DQAA 3KDNA 1UBPC 4IQWA 1RHMB 4CLZA 3TI0A 1ROFA 4WE1B 4IRKA 4DFKA 1RT7A 4YP3A 1Q0NA 2WVDA 4OHZA 1TL3A 3CYMA 1KQQA 4JI5F 3BO4A 3IG8A 2DNQA 4OV6A 5HP1B 5SUHA 4AP9A 1TR0A 4B3ZA 2CAJA 1HNXF 4QWCA 5J0WA 4CNTA 5AI6A 2APOA 1GXUA 5EWEA 2BYCA 3EWAA 1WORA 9ICHA 2NS1B 2W2OP 3OVSA 1PILA 3SQGA 3ORYA 1VIXA 2BXJA 1KC8T 3AB4B 4RNHA 1WEZA 3DNCA 1Q53A 3MF5A 2CQGA 3DLEB 3PMLA 1L6NA 1RKIA 5CD4H 2JVOA 4DR5F 3Q24A 1N4LA 4K4IA 2JVRA 1XMQJ 3MEGB 3BBFA 4DI6A 5HMDA 1XR7A 2Y1JA 1JB0C 3K5NA 4EO8A 1QUPA 2DR8A 2KHVA 1BGXT 1M0SA 4IG0A 1HQEB 3DOMA 2BVZA 3KUGA 4NX9A 5KG6A 4QIWF 1QAIA 2HHXA 1IKWB 5KT4A 2FLLA 5KFFA 2RQMA 2VQEJ 2I2YA 3KK2B 1OJ4A 4OFZA 1Q46A 4B3SJ 2FJDB 4OZ1A 1SUQB 1N2XA 4HYKA 2VF3A 3F0NA 2IVFB 4PL2A 1U0SA 2DWQA 2HVEA 4P2MA 2VG5B 2QB0B 4I29A 1K0TA 2PT0A 1LW2A 2OP5A 2CUYA 4MFBB 1S0MA 4DR1J 3QU2A 4OJOA 2VC0A 3CJ2A 2GGPB 3C8YA 4AC7C 3T5LA 5AK5A 4LQ9A 4O3QA 5K5MA 1PVQA 2DGWA 3CC2S 3JPRA 4YY3F 4RUBA 3T1YJ 1IKXB 4U9RA 4NASA 2CRLA 3RJJA 1S7HA 3H5XA 4LF8J 2D7SA 2RKIB 4DR4J 1Y5LB 4AD6A 2ZJPQ 3Q8LA 1V9OA 4OIXA 3SFGA 3TFSA 5HP4A 3OVBA 3Q8RB 3BO3A 5L1IA 5B0BA 4WP8A 2WCXA 3M7VA 1NUEA 2IDLA 4ANEA 2PE8A 1DGJA 1WI8A 5ALRA 2ZH1A 3O7UA 1A5MC 1OQ3A 2R8JA 3QIDA 1X66A 4NE9C 2QEXS 3LP2B 1HUZA 2GLEA 1FTRA 1Q8BA 1QVFR 2MKIA 4H9MA 2DITA 3RU0A 4I2CA 2P53A 1S99A 3VGUA 1F6TA 1DTQB 2KTQA 5ETSA 4KLJA 3ZXWA 2JWNA 4DV0F 4DUZF 2NSBA 3W64A 4F5NA 4ID5B 4NXMF 3MBYA 4O3SA 2AJ1A 2E1RA 3DDIA 2GV1A 1Z4OA 3J81Y 3SDEB 4WTYA 4ANCA 2Y1LB 5DDPC 4M5MA 4I2DA 2E5SA 3EW9A 3MEEA 4MKYA 2QJ3A 1VQYA 2DD8S 4KLEA 3N97B 2P2CB 3KKAA 3T5KA 2NLWA 4C8KA 1UWBB 4F5OA 3KTQA 3M1YA 3RRGA 3K2YA 2XO7A 3WHIA 5D0EA 5CHGA 2CNNB 9ICSA 1VHFA 3OSNA 3J81U 1NHKL 2QMXA 1JXEA 1ZAWA 2H1YA 1M1KT 1IWGA 1WC4A 1DURA 3I5CA 3H8SA 5D4LA 1C1BB 3W2WB 4ECRA 1MWZA 2WZ1A 3FCWA 3LALA 5A0LA 3GILA 5K8OA 1OS5A 5G5GA 4TY8B 2DEJA 3OFEA 2XNQA 4RQ2A 4RPZA 1TUWA 3SCJE 3BS7A 3MM5A 2W24A 2H3QA 4DR3J 1NZAA 2YKOA 7ICIA 1VQPS 3NNHA 3FC9A 4NA3A 4E2FB 3P3DA 3OTCA 4R5PB 3BQ7A 5EE9A 2UUBJ 3I9ZA 2AGQA 4GVLA 3OL7A 1HFEL 2GZOA 1ZQZA 1RTJB 4Y2QA 3R27A 3ZDAA 3Q83A 2ABYA 1MROB 3D0GE 3UQ0A 3FBEA 4B9MA 3DKDA 2IJNA 1NJWA 5AE3A 2CPRA 3TJ9A 4JI6F 4BJHA 2X1AA 4FS2A 1FX2A 4A46A 4G1IA 1Q7LB 1OPZA 4LUBA 3LUYA 2B4OA 2HS3A 2I9SA 1G1XA 4M9NA 2MU2A 1NK7A 3POTA 2WB1F 4P10A 2BV3A 4JB3A 4PRFA 3RH5A 2J7WA 3K5LA 1SV0A 5JRTA 2G2YA 2B51A 2QMWA 4ITSA 4YFUA 1EKSA 4RW6A 3MMAA 3HHLD 3MUTP 3KG1A 2MEWA 3GPAA 1GMVA 2FC9A 1M90T 4P73A 4J03A 2KJ9A 3ICJA 3GIPA 1Y11A 3CSKA 4R25A 1GTEA 2MQ8A 2LP4A 1RWKB 1X40A 2KHDA 9ATCB 1RAKA 4FO6A 4DF8A 4ZK7M 3RJFA 1A0OB 1F9EB 4ED0A 2DR6A 2NXUA 3R6GB 2AQOA 1FEZA 3CCQS 4P2HA 4OYZA 4ETXA 4XPEA 1HHTP 3UNGC 1QSSA 1KQGB 8ICJA 1U7LA 4JWNA 2ASJA 3KUHA 1YG0A 2A6OA 5E3CA 2VASA 4WU2A 4EBDA 5C5JA 3CJQA 1K44A 4ZH4A 5G0RA 1L3TA 2RHQB 4Q8EA 1HHSA 1KNZA 3RRKA 2L9NA 1FERA 3NBPB 3LPYA 3IAM9 1DBDA 5ALDA 1EP4A 3G9CA 5L1JA 5HROB 4C8OA 5EHHA 2D74B 2RLTA 2WBMA 2UV8A 4ED4A 2MB0B 2GIRA 2HYIB 2RDIA 4M5KA 1ZETA 4Z6CA 3TYTA 2I5JB 2WHEA 5F41A 1SV4A 2KT5A 3QYPA 2W9CB 3TUPA 4ED8A 2V4QA 2BQRA 2HVIA 2LFVA 3B8HA 4PQUA 5LSRA 2AGPA 3NVVA 3R5AA 1RABB 2RE1A 4DR2J 2YX7A 3R1LA 1EHWA 2XQCA 3PJWA 3RJEA 3NOGA 2VPXB 4WK3A 4QIWD 1VQOS 2VIHA 2QARA 2WW4A 3DLJA 1UZDA 1Y5IB 2JV3A 5I3UB 4B3TF 4R63A 3CF5Q 2PI5A 1R9XA 1S1VB 4D3GA 3CD0A 4QZIA 3R97A 5IIJA 1ECWA 4WIIA 3MM6A 1HUOA 5GMDA 2DNNA 4RPFA 2N82B 2D6FC 2AW0A 1FEHA 2KJ8A 5KFCA 3WC0A 4X4VA 4LF5F 1OUQA 1HPZB 4ZP7A 2ZIUA 4P0QB 3FYHA 4DFDA 1JLCB 4Y2SA 4ECWA 4DHVA 1HLWA 4QNLA 3QFWA 4R8UA 4QZ9A 3QSIA 3O0FA 3SCKE 4LQ3A 3ZZRA 1Y7PA 2BR0A 3HSJA 1K73T 2HFOA 2VG7B 1MMDA 4I68A 5GAHI 4KLFA 5ALPA 2XG8A 5L1LA 1S1WB 3DLLQ 4IQTA 4LF7F 3DLGB 2AYMA 2MA1A 3KOOA 4FZLA 2KDOA 3C23A 3H8YA 1Y4ZB 4U8YA 4I2QA 1UVIA 5ALGA 3K5PA 2WTFA 1EJUC 1LKYA 5AM3A 3NG8A 2CYYA 1C0UB 8AT1B 2R42A 4TQRA 2C3OA 4LF2A 3C2PA 3AM9A 2DNOA 2AJFE 2ZTCA 1XK8A 4Y2VA 1RACB 5A8RB 5IQQA 4YR0A 2GNKA 3QFHA 4ZLLA 4ZVHA 4ETZA 2KIVA 1OW5A 3N6MA 4UW2A 1JIHA 4IYQA 4NZ0A 1H2TZ 1EX8A 3HPOA 4X4TA 1VQ7S 1FWGC 1V85A 2DNHA 3O5TB 3MMBB 1NSQA 2HOQA 1ZQYA 1VLOA 3KKFA 4CLPA 2GHPA 1CJVB 2M0GB 2DGTA 4RX6A 1N33F 4OX9J 1YGYA 3LOUA 2C3UA 2JFDA 1VS3A 4O4GA 5D0HA 1RU1A 3TX8A 4JWMA 3KWMA 4Y2KA 4RQ0A 2VBXA 4OMFG 2DQNB 4CO2A 2HHTA 2GO7A 4PGYA 5IM0B 2V5HG 3CDEA 1F2GA 1XR6A 1YQHA 5J2AA 2I8EA 4D3HA 4Q2MA 3GU0A 2CG8A 4DCJB 5L38A 2JLEA 2YMMA 2V50A 3D2NA 3LVVA 3BGLA 5DJBA 2FTYA 2MZRA 2E9ZA 3GG1A 4P71A 1U1NA 1VOMA 2D3UA 3UW1A 3JYTA 4BS2A 2XULA 1NHVA 4CNZA 1Z1VA 2J5AA 2DCLA 3N5FA 1FIQA 2PFPA 5DG7A 1U6BA 1IIPA 2MQNA 2E7VA 4F71A 3MCSA 3NQBA 1AUSL 3PM9A 4M9GA 3GR0A 3GFYA 3M30A 1FD8A 3PR5B 2L9WA 2K4HA 1Z00B 4OYOA 4DPYA 1UEUA 3IGHX 2YPYA 3JQJA 3N6LA 2VBYA 2ESEA 4RNFA 3QBCA 2DY1A 3QRPA 3Q8KA 1WD6A 4YFKA 1JLGB 5D4NA 5IIIA 1RUSA 3V7LA 1RWNB 4O0IA 4KT0C 3SBMA 5DDOC 1X8DA 1YBTA 3H2UB 2PIIA 5BR8F 3OPKA 1ZZNA 3SAHA 2K7KA 2V4RA 3IN5A 1ZQBA 3PEJA 1PBAA 1CVJA 4C3MA 2ZTDA 2J7KA 1FRIA 2KYZA 2WB1D 3GFKB 4LF9J 4PYDA 3H25A 4KLTA 1O5JA 2G5HB 4DYKA 1RHQB 1U47A 3EGVA 3QU5A 1TUGB 1N6QA 1QTMA 3MR3A 1IBLJ 3AOCA 4PWUA 1VCTA 1BNPA 1VRQC 4DL6A 3SAFA 1TMMA 4DUYF 1HBOB 2NZCA 3KOAA 3QNWB 1DK3A 1KVJA 4MJKA 1YWXA 4P52A 3QT5A 5IILA 2F3JA 4UATA 3DM2B 3CCES 5A8KA 3NWRA 2CJYB 3UCGA 1BWEA 2MQLA 1M1GA 2HHPA 2EFOA 1X6IA 2K8CB 2VANA 3BBBA 9ICUA 3OTDA 5DB8A 3ZDDA 1SJ1A 5ETLA 4Q8FA 4DQRA 4F93B 2RQ5A 1VMBA 1HNZJ 2ZIXB 3ZD8A 1PYTA 5C25B 2YQ3A 2R3VA 2BM1A 1SH3A 2O67A 3MGJA 4J7CA 5KFUA 2CQBA 1IKVB 5I42A 5ALKA 1ZM4A 1WKJA 5J2KA 1QAJA 2HQ3A 3P8BB 1X4GA 5DZ7A 4LIWA 1L3KA 3EPIA 3QGAC 2GQQA 1S48A 1X4DA 3OUYA 8ICOA 4US8A 3JB9k 4ILMA 2MKHA 5DQIA 1FDDA 2H3IA 2BCVA 1FWLA 3DOLA 4KKOB 4QR2A 3H0RB 3Q8VA 5KFLA 5ALZA 4K4YA 2CJAA 1Q3VA 2BDUA 4W90B 5BOLA 5J2NA 3X3UA 4UB9A 3M32A 1CJKB 4XQ8A 1R89A 5BYQA 2BRKA 1XQIA 2YKNA 5KL1B 1NO8A 2EH9A 2OELA 4KLDA 4OI4A 2HMXA 1S8OA 3NGSA 2ILYA 4HI1A 3C46A 2UP1A 4DV2F 4NLBA 5KG3A 5A8WB 2CXYA 1MU2B 4CLTA 4JI5J 1FWKA 2XI3A 1GMWD 2G0IA 3F5EA 2W2PP 5M2RA 3IFEA 1KL9A 2X1GA 3ZNJ1 4NLYA 4WZQA 5JVGQ 2RP5A 1NJIT 2B7CB 8ICFA 5B0AA 2QA4G 2Y0BB 2BE2A 3K4GA 4WE1A 4P7VA 5J2GA 3HD1A 4IFYB 3BGRA 5K20B 2H3ZA 4YMNA 5J0XA 5AI5A 4UAYA 3OTQA 3D2QA 3A8JA 3PKMA 2OPSB 3RJMB 1AA1B 2ES6A 4DR5J 3WC2A 2IAJB 5J2MB 4J9KA 2IPOB 2J0XA 4TLQA 2PMZF 2C2RA 2H65B 4HH0A 1Z19A 5I3QA 2K8BB 2C2NA 3DMJB 4Y2XA 1O03A 1LNQA 2ZH2A 1J5OA 1SGGA 1FESA 2HAFA 5DDMA 3EXYA 1XO0A 2DCUB 4RNOA 4C80A 1WCLA 4KB7A 8ICEA 4KFBA 7ICLA 1RM6C 2WF9A 1VR6A 3EVMA 4OX8A 4BX9C 3CMAS 3IGVA 4H4MA 4A8OA 2KE7A 3VWSA 2YX4A 1LW0A 2Z2MA 1VBXA 3FQKA 3FCHA 4M51A 1FK9A 5IC6B 2KZZA 3SI8A 4IQXA 1UAWA 2E1CA 3UDLA 1IKYB 1D8LA 1AB8A 2HBYB 4KV8B 1F3VA 1VQ4S 3M7DA 1NZ8A 1KRCC 3NGRA 5IC4B 5HLFB 2AD9A 4QZDA 1XNSA 5J0OA 3QT6A 4DQSA 3WIVA 2FIUA 4EU0A 3W65A 4DPWA 4KRWA 4DLGA 4UAZA 7ICHA 3LP0B 5T14A 2YY3A 3RTVA 4OJLA 3FFIB 3KK2A 3HXMA 3QT7A 2Q66A 3RBZA 5GTHU 4Y0FA 5AJ3F 1RTIA 2BQ3A 2JZBA 4F5PA 4ECYA 1U48A 3T81A 2VG5A 1MN7A 4YY3J 5EX0A 4M94A 2DGVA 1VQ9S 4OJ5A 3NGUA 2HPUA 3D6TB 3IR5B 1ZQOA 2NXCA 3K5OA 2XMJA 2V9WA 2FTRA 1N5YA 3CD6S 2HNYB 5ALLA 2V69A 2GC8A 4KLGA 4I56A 2PMWA 5HSPA 2OIHA 3CC4S 4JI2F 5AXLA 2Z0GA 3WKDA 3T6BA 3TADC 4OI3A 3L3FX 1IKXA 1HBUB 1R8AA 3M8YA 2ZKUA 5K8MA 1RTHA 2M9NA 4I6AA 4B9UA 1MNEA 4RW7B 2L9DA 2RKIA 2MGZB 2BHNA 2B9YA 2B4PA 2KMDA 3K75D 1GQEA 2DUYA 1EJWC 2BM0A 1FWBC 4F2RA 4WFAQ 1TE2A 5KFVA 1MMLA 4NXMJ 2OAUA 3CDUA 3M6WA 3M9NB 2CJXB 1JJCB 1D9DA 2C2ZB 2HHHF 1QE1B 4GVBB 3AODA 3NS5A 4GC6A 4F0SA 2LQBA 2NYIA 2ZEJA 1KTVA 2ROGA 1R0AB 4K0KF 1DTQA 4U67Q 2N7CA 2R7OA 1KN5A 4FDFA 4ERDA 2M8DB 3DXBA 4ID5A 3KJVB 2E29A 3I82A 1O0PA 2A18A 2HHSA 5DETA 1Q3UA 2VA3A 3ET6A 3AQFA 5E33A 2E1EA 1S6QB 1UW4A 2KZMA 2HVDA 3VVUA 2YQ0A 4KHPF 1Q8IA 1VGYA 3FEXB 5HJYA 3PFEA 3OQ2A 4IQVA 1W7WA 1EJSC 4KX5A 4KO0B 3GU3A 4GKJF 3VVTA 1FE0A 2N4DA 3LAKA 1YBUA 2M0NA 3B0XA 1E6YA 1VQNS 2B8QA 2DHAA 1KQSR 1C1BA 4OJ1A 4ZLJA 3HT0A 1N60A 4CT9A 1GTHA 1ICEB 2PC6A 4CQ1A 2R2RA 1B7YB 2ZJ5A 1S72S 1L3SA 4TY8A 3I76A 2JSXA 1Z4NA 2OYYA 5HO4A 3PFOA 4NA1A 2VG6A 2AQ0A 1U09A 4L76A 3ISCA 2E5LF 4JI6J 2AEFA 2DKXA 4OZLA 4LRCA 2IC3A 4OJGA 2W3RA 2GQ2A 2M9KA 4CH0S 3HW8A 1U1MA 4EFAC 3HZGA 1KFTA 4HTIA 1LXJA 3J7YI 3AT1B 2UZAA 1RTJA 3BYRA 2XYGB 1GXLA 5J2PB 2IMWP 1SJQA 4HL9A 1JLBA 3VZIA 2K89A 2MUTA 3OGUA 5M2UA 1KLMB 4NLXA 4K4XA 1UPHA 1WC6A 4NL9C 5AIAA 4B3RF 1A5OC 3CJTA 1JQGA 3HCXA 2E1AA 3QEAZ 1CS4B 2JZ5A 2W2QP 2OUGA 4KY3A 2CJQA 2W7AA 4P9SA 2G1HA 1NNDA 1EIYB 1X4AA 3TP2A 4DSIA 2LU1A 2UU9J 1ZH5A 1NEEA 4KH0B 1QCKA 4F04B 1NZBA 3BEGB 4EX7A 4P74A 2YNFB 4PQAA 3MUMP 5AK4A 5FSDC 1LWEB 2MLXA 1NK5A 2YKMB 1Q8LA 5B7WA 2DFLA 2QZ8A 1ZQVA 2CIMA 1R6YA 4RL1A 5D4PA 1RJJA 5J1NA 1ZD5A 4WJBA 3G6YA 1KBUA 4N7TA 5DDRC 4EPEC 3JSYA 2KJWA 1BPXA 5CEHA 3DXSX 4LJXA 4WYLA 3ILIA 2BANB 3FZBA 4F0HA 3A8KA 2ZM6F 2VIXA 1RWMB 4LSZB 4Y2YA 2EW9A 3B78A 2J7UA 5KFMA 2HFSA 2A6MA 2XC9A 1YIJS 3D6NA 2ZJRQ 3DU6A 2FJEB 3KJNB 2VD3A 2C3MA 2V8HA 4I7FB 1VQKS 2D9PA 2ASLA 3N0VA 3CPWR 3HWTA 2C22A 3EM1A 3C5GA 1PC5A 1WNEA 1NDLA 5CAAA 1K9MT 4BDPA 1KFDA 3ENQA 2FMSA 5KFGA 3MTJA 2DH9A 2XZDB 1ZD4A 4ECVA 2V63A 5K8PA 1VBKA 4NMLA 2F3NA 4YOEA 4ZDNA 4HKQA 3PHEA 1SB6A 1BPBA 1RT1A 4NLOA 2LCWA 2LA4A 4KGKA 4KGMA 9ICTA 2R8HA 5J2QA 4I64A 2HWTA 2R4FA 1X31C 1ZQAA 2HHVA 2DNGA 2JEFA 5KFTA 1MLAA 4LF5J 2H54B 2VHGA 3MCOA 4ER8A 1SJ4P 1S1VA 4KIRA 1WKKA 3QU4A 3QGIA 1HW8A 2I9GA 5CH7B 2CN1A 4M9HA 3WX8A 2ZH6A 1PAEX 4DZDA 3QSYB 4OZJA 1X4FA 1JLQB 2LU2A 1VJWA 1K70A 1UFKA 1YKWA 1SC6A 2QX0A 1BNOA 5HJXA 3HM7A 1T9TA 2CNKB 3VAJA 1WYGA 4LF7J 3B0YA 2VUGA 4C8YA 8ICBA 3QLHB 3OHAA 2ZNYA 5KT5A 3T79A 5HMZA 1X5SA 5GMKa 2FJWA 3CCZA 1DOQA 1BQNB 4M5NA 3OL6A 3CCLS 2OTLS 4ZJOA 5KG1A 2BPFA 1H72C 2IM2A 4I2IA 1LWFA 4ZPWR 2OM6A 2HK2A 5KG0A 3OR1B 2UVRA 3J7Z5 2OEJA 2VBWA 2M7SA 1HL6A 2W4DA 3FNNA 4X65F 4K4TA 1NK4A 1V97A 1K5OA 4URGA 4MHVA 3UVJA 5EGYA 9ICEA 1RYUA 2EFPA 4JV5J 3PW5A 3U27A 4ANDA 1KOHA 1S9FA 4K4ZA 1BPZA 3OBIA 2RMLA 2Y0SF 1IQTA 5AM1A 3GV7B 4RT2A 4ZOSA 1ZTWA 1S6OA 2FPLA 4UUXA 2LQ8A 4ZVGA 2ZHBA 4ELVA 2B9EA 1FJGF 4B17A 4ES1A 2CZ9A 3Q8YA 6AT1B 1NU4A 1YVFA 2V4JB 2D3O1 2OWOA 3TW0A 3MMBA 4GRSA 3WK4A 5AI8A 1HNIA 1S9GA 2XO6A 3A3OB 4M5HA 1TFRA 4NLKA 3MDAA 3EX7B 4P4PA 1SBRA 4ZVEA 1CJVA 2DGOA 2ZIVA 1ZPVA 1I6JA 2KP7A 3E2EA 2MTLA 3R2CJ 5B0EA 2G2ZA 3OVAA 5F3TA 3OFGA 2UXDF 4JI1F 4DLEA 4HAIA 2Y9HA 4KTQA 1QDUB 1ONWA 4IH7A 1S1XB 4IG3A 4MKAA 3FRZA 3KZXA 3ILJA 5IM0A 1PYSB 3MURP 4FF3A 2I1QA 1NK8A 1SXEA 3WK6A 2ZH8A 5AXKA 4QPXA 2YNHB 1ZA2B 1RAGB 8ICHA 3HHNB 4B3OA 1FHTA 2V34A 2CVEA 4LFCF 3UCUP 5AXMA 4FNHA 9ICQA 1VBZA 1A76A 1ZQRA 3R1HA 1SKWA 4Y2IA 1S6PB 3JSMB 3FGVA 2IMRA 2MZSA 1FRLA 1WOOA 5LM7E 4DR6J 3OJUA 1P9QC 1HIWA 9ICLA 1WUDA 4CIOA 2EVZA 3UFCX 5BR8J 2DPJA 4UY85 3L9ZA 1HNVB 4NRTA 5KFWA 2EXUA 1N5XA 4USWA 7ICFA 1PUZA 3CNQP 4FXVA 1MC8A 1GT8A 2KRRA 5KG4A 1RA5A 1NFGA 2FUG9 3MR5A 5CZVA 5KFQA 5AKIA 3LGNA 4OYWA 1RPLA 4RQ7A 4IUFA 1D1UA 1RWXB 5DBBA 5IXUA 2IFXA 1FWCC 2NR0A 3UBPC 3FAHA 3I28A 1NH8A 1U24A 1RT7B 2YKPA 1TL3B 2HFNA 7AT1B 2FHMA 1VLBA 2BOAA 3MR6A 1U2FA 3FBFA 2LXUA 3BM7A 3MWBA 1M5PC 3CCJS 8ICTA 4RWXA 5HQ8A 3JPTA 3PX0A 2IRUA 2QL5B 3AEVA 3THPA 1DAXA 3DGPA 2Y9TA 4K4SA 4O5KA 2P9GA 4LIRA 2DHGA 2V0NA 2FMPA 3OFHA 2F9DA 4DUTA 3MEDB 4CM2A 2WSEC 5F3XB 3G8QA 2ROEA 3EGJA 1ED1A 4FYDA 3SEOA 1X6JA 1B3TA 2LQ9A 4MTPA 1RISA 3D66A 3NAIA 1KDNA 1ZQIA 1ZM3A 1KW4A 4WHBA 4A8WA 2MY8A 1P9YA 1Z4UA 4WP3A 2K2PA 2X3DA 2QLXA 2XMAA 1X5TA 2ILZA 1NPPA 4IG0B 2BDPA 3DOMB 2HZAA 3IS9A 4IR9A 2CDRB 3LSBA 1XSNA 2IMOA 1UT8A 1UKUA 3RB4A 2EPIA 1N8RT 2ZIXA 3HVTB 2EKYA 3KD3A 4LSNA 3V4MA 2ZJ8A 4JK1A 1IKVA 4K2XA 1BY9A 1WC1A 1VC5A 3IC1A 1RBOB 2HBRB 3IA0A 3FJ2A 2ICSA 3VCDA 3PW2A 1T3OA 1UA1A 1PJ5A 7ICUA 3LQVA 1LW2B 4BWMA 4YB1P 4J9MA 2VFRA 5HMXA 4ZVOB 3RB3A 4CEXC 2H4WB 1ZRNA 2VQEF 3O3LA 3EICA 4PG7A 3HDSA 5AKLA 2GMHA 2KM8C 3C1ZA 4B3SF 2P9BA 1FF2A 2HI0A 4IC9A 1S59A 3NEKA 1HJPA 2JLFA 5KT7A 1F5BA 4J9UE 2AEMA 1GEHA 4OYPA 2MKSA 1Z2ZA 3PDNA 4BHQA 4OX7A 5ADZA 2UV8G 3QMQA 1Q81T 3MECB 1IBCB 4TQSA 2ZNZA 1COKA 2ZBRA 3QXGA 4G1QB 2MKYA 5EE0A 4ZS6A 4CRJA 5BPCA 1WC3A 2DISA 2I6XA 3NVWA 2KVQE 2ZBPA 2BPCA 1BXNA 2Z8QA 3AA9A 2EK1A 2D3OR 2LPEA 2JC1A 1ZQQA 2CQ4A 1WF0A 2CPDA 2UUTA 3CC7S 4LF8F 2MRLA 4DR4F 3MM7B 3FCVA 4Q45A 2ACMA 2VV5A 6FDRA 1V9PA 1WI6A 2RNEA 4Y2AA 3C21A 4Z6FA 1UEVA 1XMBA 4ZP9A 3J7A1 3UR3C 3CD5A 1UVJA 2FVSA 3ISNC 2XLKA 2HWIA 3ETMA 2YB1A 1SJ3P 1ZAXA 4C3LA 1QD1A 4XPCA 9ICOA 1REVB 4ZP8A 2IAJA 3VGVA 3SENA 1P6TA 3GRIA 1GAOA 1HI1A 3GYNA 2O6KA 4H4OB 4PXBA 4RWWA 3DMJA 1M5VC 4PZVA 1R7IA 5J2CA 1TKDA 4I69A 4F36A 1KEKA 3L5KA 4QCLA 3MEEB 1WG1A 5E3PA 4ATNA 4OYMA 3H7IA 3KHRA 2VL1A 2BE7D 3MPVA 2QYCA 4FXWA 3TNVA 4QWAA 2IJRA 1YJVA 5ALOA 5CD4A 1R0BG 4PAAA 2KHCA 3DI6B 3MI7X 4WBFA 1U6ZA 5ALQA 2DT9A 3QUQA 1WG5A 4UB1A 3CCMS 2OSQA 2ZHAA 2KHQA 2AZ3A 2Y0SD 1D9FA 3KYLA 2KIWA 3HMJG 2Q6BA 4O23A 5AJ3J 1FDBA 4OI1A 3GIKA 1UWAA 4KV8A 4ICLB 3LWMA 5DQHA 2R9LA 2ZZTA 3QJPA 3RFAA 3MM5B 1FNOA 3EZOA 1RAIB 2B9WA 8ICMA 3BS5B 4KPCA 3W62A 3ZNUA 4C8NA 1FRJA 1NDKA 3VF0B 3MABA 1A6LA 4C98A 1J97A 1F9HA 2VJUA 2LBOA 4K4GA 2CPYA 5A0YB 1HQUB 1Q95G 1NKBA 1N0UA 2YWFA 5GAGI 1YHQS 1NDCA 5D78A 4M9JA 3IG5A 3OTOF 5EE3A 4C4WA 3TOQA 2P5VA 2LYAA 4YCXA 1H3DA 4ZCMA 4DF4A 4UB5A 2XY6A 3D5MA 2WK4A 4ZVUB 7ICJA 1ZQXA 1BLUA 5FJ4A 3NY0A 5GADI 2O5DA 3KHGA 4DSKA 2HNYA 1TU0B 3UWTA 4PPXA 1EETA 2EI5A 2RRAA 2CQ3A 2MZ1A 1F0MA 4UASA 2QSWA 3HHEA 3RR7A 3SCIE 2C3PA 2MQOA 4Z6DA 4JV2A 4DFMA 5JTIA 5F9LA 2ACYA 1FA0A 3OXFA 4A8XA 2DXDA 2XY5A 3AD9C 1U2CA 2QO3A 5T7LB 5DRKA 4ZOHC 3CO0P 2E8NA 5KFAA 3IV6A 2E8OA 4RW6B 1FWIC 5HK4A 4KYZA 1IUJA 3BJYA 4FS1A 1J2MA 1ZQMA 3JPOA 4Q43A 4ZA1A 4Q44A 3NVZA 2XGQA 3MM8B 4LRAA 1S97A 1ZA1B 5AK6A 3NNCA 2WAQC 4OZ5A 4NM1A 1WOSA 3BGFA 3TEGA 3I5BA 2CG4A 3WK5A 3V4IA 5J0YA 2KYXA 4IOAQ 1LWCA 2KG0A 1ZQTA 2D9OA 1UJ6A 2GVZA 1RADB 4NLSA 3WK7A 4ID8A 1EARA 1N5QA 1ZAVA 3EJMA 4NLCA 4ZPCA 4LF1A 3R0DA 4OZ3A 1QE1A 1GX5A 2MZJA 3AOBA 4KHPJ 2VJ4A 1VK3A 4U7UK 4PYAA 3HX9A 5AXNA 2QIFA 3MGIA 3VCBA 1DRZA 4P75A 2QTWA 4EI2A 3KJVA 2JR5A 1MW7A 4KGXB 2KG1A 1FWEC 3MCNA 1IBMF 2KN4A 1R8PA 3JAMY 2KKHA 3SQIA 4IQUA 2QA4S 8ICIA 3UR0A 4DCOB 3HKZF 3LH2S 3RG6A 1IE7C 1WKLA 3NMRA 4F4WA 4J5OA 4PUOB 4DV4J 2BJ3A 4KO0A 4RQ5A 1QQ6A 3VAIA 2E5LJ 3ETLA 3UXPA 4CNSA 3AQOA 1KCXA 3JAMU 3C2MA 4PQUB 2ZIWA 5AI9A 2XMTA 4GFJA 2DR5A 1FWDC 2VM8A 1X7VA 4DCPB 1PJ6A 1WSVA 4DJBA 4JP8A 5HVGA 3OLAA 3T3FA 2VA8A 3TJAA 4C65A 4H4KC 4EGLA 4XA5A 4U6PA 3KFWX 4B3RJ 1X2IA 5A76A 5B0DA 2ZVSA 3MM6B 4ZHRA 3DRRA 2LYVA 2EAPA 2CPHA 2I0XA 4F8RA 1L3VA 1FDNA 4EP8C 4OD0A 2CJKA 3HI9A 3H5YA 5J8YA 3PSPA 1L5UA 1U9LA 4NLZA 1H98A 2JEGA 3R3TA 4ED1A 1M5KC 4CO4A 5LOQA 5L39A 2R2TA 3L09A 4R8UB 3MPWA 5HVFA 3OJSA 4OYAA 1SL0A 3MAQA 2BKOA 1FRHA 3OR2B 4RPYA 5DG8A 2R8GA 3EZUA 4K5RA 3G96A 5G5HA 3CO9A 1SZHA 2YH0A 4DV5F 3HHLC 2NREA 2OHFA 1NSAA 5IT9Y 2PFFB 3MPYA 3NXZA 2Y3YA 1H7XA 3CE8A 2FVQA 4CYUA 5ETOA 2E5JA 1OY8A 1UTAA 2VJ5A 1LWEA 5LJ5Y 3HILA 4USKA 2QMUB 2YKMA 2J9EA 4R64A 3KNGA 2NUHA 1UVKA 5E3RA 2DL0A 5IWAF 3MAHA 1K1DA 2H5EA 3JQMA 3HPAA 5IT9U 2FPMA 5C42A 1GNKA 5ALVA 5DQGA 4QZVB 4PKDB 1KD1T 4GBDA 2C42A 3K7RA 4URSA 4NCAA 3VC8A 1RDFA 1ZJMA 4YN3B 4XRHA 1H7WA 1L7NA 4RW8A 4WYWA 3T6JA 4QR1A 2DGSA 9ICMA 4YQWA 2QKQA 5JJBA 9ICXA 1HR0F 5AICA 3ICXA 4C7QA 3KLFB 3UPQA 2RHSB 5AIBA 3G6XA 2BKPA 4DX6A 1R6VA 2NV3A 1WHXA 3G4SS 4RQ8A 2H5XA 3KG4A 1KQKA 1QTNB 3CT9A 3GB0A 2ZXHA 1IBKJ 4KLUA 2PFOA 3NVYA 7ICPA 3ITHA 4I7FA 2F40A 4QQBA 3CULA 1PVPA 3THVA 2ZTEA 1BHNA 5F8GA 4AE5A 4F0RA 5CCMA 2Z2LA 5HVHA 5LJ3Y 4GXIA 2DO4A 4WFNQ 2CPZA 3L4PA 3DFEA 4QIWC 5J1PA 3JYTB 4C6AA 3C14B 4USHA 4WKYA 5EWGA 1U02A