1IM4A

Crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
205
Chain Sequence
HHHHHIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DBH
publication title Crystal structure of a DinB lesion bypass DNA polymerase catalytic fragment reveals a classic polymerase catalytic domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 63
structure length 205
sequence length 209
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1im4A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 1im4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1im4A01
4JV0A 3QZ8A 1TQLA 1QSSA 1S76D 3H5YA 3V81A 3TAQA 4YR2A 3H8SA 1C0TA 4MK7A 2BE2B 3T1AA 1ZQVA 4R8UA 1TK0A 4FO6A 4YR0A 3BQ2A 3ZDDA 3N6NA 3M9NB 1JLAA 1TV9A 2KTQA 1S1VB 4B9UA 1S9GB 3MTKA 4NLZA 4DOBA 1HUZA 7ICUA 4O4RA 5J2QA 3THVA 1UWBB 4GC6A 1HNVB 8ICGA 4B3OB 1QUVA 1QAJA 3MEEB 1N48A 4ELTA 2ZUCA 5KFWA 3V81B 1NJZA 1S9EB 1CSJA 1ZQRA 4URQU 3KLFB 4IH5A 4MH8A 5HNKA 4ED2A 4R8UB 3RB0A 4CCHA 1ZQJA 2PI5A 1W25A 2CJQA 4RW8A 3G86A 2FMQA 1NKCA 1JLAB 2HHTA 3QO9A 1RTIA 3I0SB 8ICRA 1RT4A 3RJHA 7ICMA 4EYHB 4Z6DA 4JK1A 4QZAA 2PFPA 4NYZA 4KLDA 1MSWD 4M2YA 3DYAA 7ICIA 1KFDA 4KSEB 3MF5A 3EWAA 5J0QA 3T5KA 1NK9A 2BQRA 3AU2A 1NJXA 2YNFA 3JPNA 5HBMA 2VA3A 2AJQA 4U6PA 2IHNA 1K1SA 3UPQA 1I6JA 2JEFA 4RW7A 3KMQA 1LB2B 4RW8B 2JEGA 2ZUBA 4RQ2A 7ICLA 3QO9B 1KFTA 1RTIB 4RQ3A 1IKXA 4ZPDA 2FPMA 4DLEA 2ZE2B 4WZMA 4KLLA 4F4WA 3HT3A 4K4UA 4PHEA 1SZPA 3MR3A 1RXVA 3C2MA 4KB7A 1T05B 4X5VA 3H5UA 4TQRA 2RKIB 3FQKA 4P4PA 4XPEA 1KLNA 4QWCA 4DQIA 2XWYA 4B9NA 1WCNA 2R8JA 5J1EB 4C8KA 2YNFB 4ZPAA 4YMNA 2RF2A 1S77D 3BSNA 2BANB 1R0AA 5C42A 1HNIB 3ISND 7ICSA 5J2AA 8ICLA 5J0SA 9ICXA 2W8KA 4ECQA 5KFZA 1V9PA 5J2DA 4ID5A 3KLIA 2HNYA 5CR0A 4IQXA 3SFUA 3V6JA 7ICGA 3TQ1A 4KLSA 1ZQMA 3SYZA 4J9NA 4QZHA 2HVIA 1ZTWA 1RT5B 4E0DA 3PJXA 4NXZA 3M9OB 4IH6A 3BJYA 2B5JA 3GIKA 4KO0B 1REVB 3QGIA 1MMLA 1LW0A 2HAIA 2WONA 2E9RX 3ISDA 5BPCA 3OL9A 1UA1A 1NK5A 8ICFA 4MKAA 3D28A 5C42B 4F5RA 3SV3A 3DLKB 1IKWA 1TK8A 4O3OA 3HKWA 3RJKA 1SH2A 1JLGA 4NLPA 3MGHA 7ICQA 3GFKB 5L9XA 4O0IA 9ICWA 1S1TB 4DEZA 3PMLA 4F4KA 4K4IA 5DG8A 5D4BA 4MEXA 4DLGA 4K50A 4ID5B 4IH7A 3CDUA 3LP1A 5IIOA 3H5XA 1XR7A 5KFNA 3MDCA 3JSMB 2WB4A 5KFYA 9ICUA 2YNIA 4IKAA 1ZQGA 2HNZB 5CYMA 8ICQA 1U45A 1RT6A 4RNMA 1TKZA 2B5JB 2AU0A 1FKOA 5KFSA 4TN2A 5KFAA 5DB9A 3AUOA 2WONB 4UAZA 2F1JA 3SZ2A 3UQ0A 4YMEA 3MEGB 5HP4A 5KFRA 3MR5A 1DLOA 2KFZA 4DQRA 4RT2A 4JWMA 5IIKA 4R64A 3BQ0A 1JLGB 4QZ9A 4J9LA 3OSNA 1S6PA 1JLFA 4Z6FA 4C8MA 3LP1B 3MABA 3KLGA 9ICVA 4EEYA 3RH5A 8ICBA 4DSKA 4NLWA 2XCPA 5F8HA 3CVKA 2B6AB 1RT6B 1DTQB 1TKZB 4YP3A 2HMIA 1J5OA 5KT4A 4KV8B 1HARA 3ISCA 4ED8A 4NCGB 2YKNA 8ICVA 3QIPA 2W9CA 2IMWP 8ICJA 4TYAA 1VRUB 3DRPA 3PR4A 1Z3EB 1DLOB 3C21A 4QW9A 4KFBA 3LAMA 4R66A 4ZP9A 4TLRA 2RDIA 4NM1A 1SH3A 4RQ5A 3PW2A 1MC8A 5KG1A 5L1KA 1S6PB 1JLFB 4QWEA 1NK0A 4TQSA 3N97B 5HMLA 1JXEA 2AX0A 1T7PA 3KLGB 1ZQHA 2HHWA 8ICWA 1NNDA 2C2DA 4U7CA 2FMPA 1TL1A 2XO7A 3T5LA 1LWEA 5J2IA 1U4BA 2DPIA 2YKNB 2UUTA 4Q8FA 4NZ0A 9ICIA 1JLCA 4QZFA 5HHIA 3CJ3A 2MUTA 4IOBA 3LP2B 2FLLA 4F4YA 3DRPB 4NLTA 4DL3A 4KFBB 4LQ3A 4NRTA 4KITB 5J0RA 5DKWA 4QZ8A 4YMMA 1ZQYA 1SUQB 3KK3A 5CHGA 3ITHA 5L1JA 4KN4A 3MR2A 4O5EA 1QSYA 8ICSA 1S1WB 3QLHA 4RQ0A 4C8OA 2E9ZA 4NLDA 2OPRA 4XQ8A 2XGQA 1QSLA 3NBPB 2GWSA 3UR0A 4XPCA 4I2FA 5J0PA 3E51A 4IRCA 3QEAZ 4R5PA 3IHQB 4DS5A 1ZYQA 3RB6A 7ICFA 2YNHA 3KHGA 4PWDA 3M8PB 2MUTB 4P4MA 3KLVA 1U47A 7ICJA 1HUOA 2V9WA 2W9MA 5DB8A 5HROB 2NRWA 3ITHB 4YD2A 4YG2A 4B9LA 3GILA 2AGPA 3QLHB 3TFSA 3IN5A 8ICNA 3EW9A 4DL5A 5DBCA 4QWAA 2OPRB 4ED1A 4KAIA 2ZTCA 1KFSA 3RJJA 3KHHA 4KMUA 3V6HA 4R5PB 5J2PB 2ZTDA 3MECA 2YKMA 3H59A 4YR3A 1FKPA 3Q8LA 1EP4A 2BHNA 3I5AA 2CKWA 3BQTA 4TURA 4IR9A 3DLEA 3TARA 2IAJA 4ELVA 4Q45A 4Z6EA 5KFJA 3HPOA 1SL2A 4RQ8A 3HWTA 2ZTEA 3E2EA 3MR6A 4H4OA 3QGGA 5J2MA 9ICRA 5J0WA 7ICEA 4RT3A 4H4MA 3FQLA 4I2GA 2KFNA 2ZJ8A 3ETLA 4XUSA 3PVXA 1SH0A 5KFMA 1ZJMA 7ICPA 3Q8QB 4DFJA 1HQEB 2WK4A 3FRZA 1TAUA 3K4GA 4QWBA 5KFFA 3KK2A 1ZQFA 2ZKUA 5D49A 1ZQBA 2R8KA 3MECB 4ED7A 1FKPB 3MFHA 5K14A 3T19A 3KLHA 1HMVA 3UDLA 2P6RA 3DMJB 3V6KA 2IAJB 3IS9B 2VG7A 2BCRA 3IGNA 2QV6A 7ICRA 5KFVA 3OL7A 1L3TA 5J2MB 4YN4A 3PO5A 5FDLA 4ZP6A 1ZTTA 2V0NA 2F1IA 3SI8A 2IJNA 4H4MB 4ED3A 5DQHA 3UPFA 2OPSA 3DI6A 3C2KA 4R63A 2XCAA 4YVZA 4PGXA 1XS9D 1SL0A 4M9HA 3NL0A 1GX6A 4IQVA 1T03A 3KK2B 3LDAA 3BSOA 4DSFA 3PY8A 4KHMA 4BGDA 5K14B 2ILZA 5J2NB 4Q0BB 1BPDA 4RZRA 1S0NA 1RDRA 4JUZA 2VG7B 4DL4A 4IQWA 1TP7A 1ZQIA 5C25A 1BQMA 3H5SA 4KKOA 4LSNB 5KFHA 4IG3A 1D8YA 2BPFA 1RTHA 2EC0A 2ZD1A 2VANA 5FDLB 2ZUDA 3M8QB 5JXSA 3JYTB 2W7PA 2I1RA 2UVWA 1JLBA 5KG6A 1RT2A 3DOLA 3DI6B 4I28A 1ZJNA 9ICMA 2O5DA 3FFIA 2E9TA 4F5PA 2ZJAA 3GIMA 4QWDA 3RB4A 4PQUA 1TKTA 3HVTA 3IG1A 2XY6A 1A77A 1C0TB 5C25B 3GDXA 1BQMB 4KKOB 4IG3B 4DQQA 1LWFA 5J2KA 1RTHB 2UVVA 2ZD1B 3OLBA 2D3UA 1VRTA 2F1HA 1NKBA 1NK6A 3DM2A 4I7FA 4B9MA 8ICUA 3CDEA 3ZDBA 1JLBB 1RT2B 9ICQA 1N5YA 1JX4A 5J2QB 3DOLB 3NMAA 1U48A 4MF2A 1ZQEA 1ZQXA 5DG7A 4KTQA 4MK8A 4MFAA 5KFBA 5KFGA 3FFIB 3FSIA 4ZPCA 4M47A 4UB1A 4WXOA 5EUHA 9ICTA 3TAMA 4PQUB 1TKTB 3HVTB 3V7LA 1S1XA 4URSA 9ICFA 3IG1B 4DFKA 8ICHA 2FPKA 3GIIA 2GIQA 1MQ3A 2V4QA 2W9BA 2HVHA 2ALZA 4QPXA 2FVRA 5BOLA 2BCSA 4PHPA 1XSNA 3RJGA 4ZPBA 1VRTB 3B0XA 3DM2B 4I2PA 4I7FB 2OPPA 5I42A 1C1BA 3KJVA 1C2PA 3BSCA 1RT4B 1N5YB 4F2RA 1ZQDA 4P4OA 3PX0A 1JKHA 3DYAB 3N4MB 4RW9A 3KTQA 1TVAA 5IIJA 4BWMA 3H98A 4IG0A 1S49A 5IIIA 1QLNA 4M9GA 3I5CA 3N6LA 1ZQOA 1NK4A 5EWFA 4KLHA 1HPZA 4RQ6A 1S1XB 4NLRA 1NJYA 5F8NA 4LSLA 3KNAA 4QZCA 5DBAA 1TV6A 3CJ2A 1RXWA 5HBMB 3KMSA 2HHQA 3DRSA 1DOQA 9ICBA 3ZDAA 5DB7A 9ICEA 3LWMA 4LZGA 4RW7B 3Q8PB 1NKEA 4ZVFA 1LW2A 4IQUA 4I2PB 2XY5A 2OPPB 1EETA 1C1BB 5I42B 4XO0A 3KJVB 1IKXB 4LQ9A 2HHVA 1KSPA 2HW3A 1RTDA 2AQ0A 1N6QA 1C1CA 2AWZA 4NLXA 4WZQA 2PFQA 4RW9B 5J0UA 1XC9A 2NRXA 2J6UA 4NM2A 4ELUA 1IKYA 7ICNA 3BR9A 1KEJA 4LSLB 1KLMA 2RF2B 4F5QA 4JV1A 3C2LA 2BRLA 2UVRA 1R0AB 4PHDA 4K4TA 4TUPA 4I29A 3DRSB 4NLQA 1XR6A 2FJWA 4ED0A 3HW8A 4KLFA 4IDKA 1Z4UA 5CB1A 3BSAA 4UB3A 4TY9A 4RQ7A 4KLTA 1LWCA 1LW2B 2PI4A 1IKVA 1MQ2A 1EETB 4NRUA 4RUCA 1ZQAA 4M94A 3KLIB 2FLNA 2HNYB 1RTDB 1T94A 4J9OA 9ICLA 4Q8EA 3CWJA 4I2EA 2HNDA 3EYZA 1C1CB 9ICOA 3Q8SB 4RW4A 4DFPA 2IM1A 8ICYA 1U09A 4NLUA 5I3UA 2AQ4A 5J2BA 3RJEA 4J9RA 1SKRA 1XSLA 5KFUA 9ICPA 4O3QA 5CA7A 3PJWA 1IKYB 1LW0B 4ZP8A 4Z6CA 4ZVGA 5KG0A 4Y34A 2FVQA 5J2GA 3RTVA 1S0MA 2LYHA 4XA5A 3HVWA 1IKWB 4K4HA 4I2JA 4KLIA 4IDKB 5L1IA 3JPRA 1B43A 1LWCB 3T5JA 4DS4A 4WYWA 4NLVA 2C22A 1RTJA 2DPJA 3RRGA 3V4IA 4C8NA 8ICCA 4F50A 2KZMA 3I5BA 1IM4A 3H2LA 4I2HA 4DWIA 7ICKA 2YNIB 3CIZA 3ZDEA 5CYMB 7ICVA 3DDKA 4F93B 2FMSA 5I3UB 5CJ7A 1KHWA 4NLYA 1T3NA 1FKOB 4H54A 4NY8A 4MEYA 5TZVA 4HKQA 4O9MA 4IFVA 5KTQA 4OL8A 1TL3A 4FS2A 1TAQA 3H4BA 4RW6A 1LV5A 1HQUA 5J0XA 3CJ4A 3RBEA 3NAHA 4KE5A 2UVUA 4RPXA 3V4IB 3BQ1A 1XWLA 1KDHA 3PR5B 5KG7A 4DSIA 2W7OA 3FDSA 3HX0A 5F8MA 4NLKA 4MIAA 3HP6A 4DL2A 2HMIB 3CJ0A 1J5OB 1BPZA 4ECWA 5J0YA 3QIPB 4ECVA 4EBCA 8ICOA 1RT7A 1S0OA 4IFVB 2W9CB 3PX4A 1TL3B 9ICHA 4GXIA 9ICSA 4NLSA 4UBBA 5HP1A 5DGBA 4RW6B 5DBBA 4KLJA 1HQUB 3PW0A 4MFFA 3MGIA 4G1QA 2Y1IA 8ICTA 4F5OA 1S9FA 3C23A 5CYQA 1FK9A 4ICLA 1UT5A 4R65A 4RNNA 2ASJA 8ICIA 2R8IA 2FVCA 5J2CA 4ZP7A 1ZETA 3BGRA 3ZD8A 1BQNA 2P66A 2JEIA 2FVSA 3RJFA 4NLGA 5DLGA 3QEBZ 3RJIA 4TY8A 2HHSA 4DOAA 3LWLA 3DOKA 1TL1B 4UB2A 1LWEB 5KT5A 3VQSA 4ECTA 8ICEA 1RT7B 1JLCB 2R2UA 1S6QA 2BKEA 3M8SA 3PHEA 5J2FA 2WOMA 2ZJ5A 3QE9Y 2YNGA 3BDPA 1JXLA 3KK3B 1L3VA 1JLQA 3TFRA 1TVRA 4ZVHA 5KFPA 4EO8A 2HHXA 4NLOA 7ICOA 5CYQB 1FK9B 1SV5A 5J29A 4FBTA 5EWGA 5KFTA 5F8GA 3EPIA 1Y88A 3OL6A 4YQWA 3QZ7A 4EO6A 3M8RA 5DDMA 2B21A 3RB3A 5KFKA 4GXJA 4KLUA 5JUMA 3EZ5A 2NRTA 4GC7A 1DTTA 4B9TA 1JLEA 2YNHB 4PWDB 1RYRA 1S6QB 5KFLA 4M95A 3UXOA 2IM2A 3H8WA 1D9DA 2WOMB 9ICAA 4TXSA 4Y2CA 4P2HA 1C0UA 4ECYA 1JLQB 4ZVEA 3RRHA 4GXKA 3C5GA 2JC0A 2BCQA 3OHBA 3I0RA 1SV5B 2XI3A 1S10A 4I2IA 5KFXA 2R2RA 3CJ5A 9ICGA 2P6UA 2YKMB 2D7SA 3C6TA 1BVSA 4RNHA 1EP4B 4J9KA 4M0AA 3JPPA 4URGA 3DLEB 3JPSA 1XSPA 1JLEB 4IFYA 3IGVA 1MU2A 4H4OB 4MKBA 1NK7A 3GYNA 3KHLA 4J9QA 1D1UA 3E01A 5DLFA 4O5KA 3LALA 8ICZA 3I0RB 3C5FA 4BWJA 1TKXA 4ZMMA 4WE1A 2BQ3A 3DRRA 1SL1A 4KLOA 2JZBA 5F8JA 3TI0A 4K4WA 4RUAA 2WHOA 1D0EA 1S1VA 3C6TB 1S9GA 3KLHB 3ISNC 1HMVB 3HVAA 2ISPA 1HNVA 4DQPA 4PUOA 2AGQA 1A76A 1MU2B 3MEEA 7ICTA 4ECRA 1CUKA 1N56A 1U49A 4F5NA 3HHKA 4IQTA 5IINA 2WTFA 1C7YA 1S9EA 1CEZA 1TKXB 2OPSB 4K4XA 2FJVA 4WE1B 3DRRB 3KLFA 4I2DA 3C6UA 3B0YA 5L1LA 4NLNA 3PNCA 1S1UA 2JZBB 3K75D 3IM1A 3GQCA 1T03B 4ECSA 4DL7A 3C1ZA 2PFNA 3I0SA 3OGUA 3OJUA 2ATLA 3RBDA 4FBUA 1D8LA 3PW5A 1JIHA 4FS1A 4I2AA 1BPEA 4PUOB 1KHVA 1WCLA 5IIMA 5DQGA 2KZZA 4J9SA 3IRXA 4UBCA 1NOMA 5J2HA 5KFQA 3G6YA 5J0OA 4YCXA 2ASLA 4MFCA 5DDYA 3RAQA 9ICCA 5C24A 3JPOA 2I9GA 3C6UB 1X2IA 2C2EA 1WNEA 1S1UB 5KG3A 3H4DA 2BRKA 4PGQA 1B22A 9ICJA 5HMMA 4KLEA 2ZE2A 3UXNA 4TUQA 5CWRA 3KK1A 1TK5A 1ZQSA 9ICKA 5F8IA 1NHUA 1T05A 2RKIA 1LWFB 3IRXB 1XU4A 2WCXA 4K4YA 5F8LA 4C8LA 1QAIA 5J1EA 4WFXA 4UQGA 2PFOA 3T3FA 2ASDA 4LZDA 4M9LA 2BANA 1SKWA 4M9NA 4M04A 4O5CA 1HNIA 5C24B 4ECXA 4BXOA 4KN7A 1ZQNA 5KFOA 2HWIA 1TFRA 5BOMA 8ICMA 4RPYA 2GC8A 2ISOA 4F4XA 4DSEA 3TAMB 2IA6A 7ICHA 3MBYA 3ISBA 3KK1B 3V72A 2QE5A 2W9BB 2J6TA 1RT5A 4IRDA 3PO4A 1X9MA 4KLGA 4KO0A 3LAKA 1REVA 3OHAA 1RA6A 3LP0A 3CDWA 4QW8A 5KT6A 5EDWA 2F8EX 4Q44A 2BCVA 2D3ZA 4I2BA 4BXOB 3DLKA 4YD1A 1JKHB 1XR5A 3SFGA 4ECZA 4IG0B 4I2CA 1S1TA 3V7KA 4XRHA 3V7JA 2XI2A 4O3PA 1BPXA 4O4GA 5D3GA 4MFBA 1HPZB 2Q0ZX 5J2EA 1NJWA 1TV6B 3JSMA 2R8HA 2VG5A 3DLGA 2HNZA 1ZQUA 5F9NA 3UXPA 4WXWA 1S4FA 4BDPA 1RA7A 3LP0B 3PV8A 3LANA 3KHRA 4DF4A 3MEGA 4JWNA 1OS5A 5C5JA 9ICNA 5KG4A 1S0VA 1ZQPA 1N6QB 1BPBA 4RPZA 4WFYA 5T14A 1S97A 2M9NA 2DFLA 1UT8A 1EXNA 3PMNA 4X2BA 4PPXA 4O4GB 3UQ2A 2IJFA 3TVKA 5D3GB 2FJXA 5KT7A 4MFBB 3G6XA 5DQIA 1S48A 4YMOA 4F91B 2UUWA 1KLMB 4DFMA 4TYBA 2VG5B 4DSLA 2KZ3A 4QZIA 3OJSA 3UQSA 3FYHA 3DLGB 4ZHRA 4Q43A 2R2TA 1JN3A 5KFIA 3PX6A 2BQUA 1PZNA 2I5JA 2B6AA 4DG1A 1DTQA 1QTMA 4KV8A 3QYYA 3V6DA 4O3NA 4NCGA 1RT1A 1IKVB 2JEJA 5KFEA 1RT3A 4UB4A 3MDAA 2H5XA 1DGSA 1VRUA 2VA2A 1X9SA 1H38A 4LVSA 1Z00A 4QZGA 4M9JA 2HNDB 3ZD9A 5D46A 4RW4B 4UAWA 4R0EA 3N6MA 5J2JA 1NK8A 1RAJA 1ZQZA 4ECUA 4RNFA 3NTUA 4YFKA 4F3OA 2I1QA 4ZHRB 2JC1A 4K4ZA 4MIBA 2I5JB 4UB5A 4DG1B 4WYLA 1T4GA 1L5UA 1IXRA 5F9LA 3V6DB 1RT1B 4Y3CA 3RH6A 2HHUA 4DL6A 1RT3B 1RTJB 3LP2A 2IC3A 4KHRA 5EWEA 1Z00B 2VG6A 1L3UA 4F2SA 4F4ZA 1SUQA 4PH5A 5KFCA 4IRKA 4RU9A 2BDPA 4QZEA 1S1WA 4TUSA 4YXMA 2IHMA 1KRPA 5KG5A 2OH2A 2GIRA 3T5HA 3Q8MA 3OLAA 3NBPA 2OWOA 2A1JA 1X9WA 4DQSA 4K4VA 3NKYA 4EBDA 4EZ9A 2FVPA 3Q8RB 4F8RA 2RDJA 3C1YA 5CP2A 1T8EA 2NRVA 1YVFA 1QE1A 4MK9A 2J6SA 8ICXA 4YXJA 4KLQA 4ZH4A 3SV4A 3M8PA 3H8JA 2IC3B 2PXIA 4O3SA 3G6VA 2VG6B 2R8GA 5DB6A 1HJPA 2V4RA 5HROA 2W8LA 3BREA 2BPCA 3H40A 3NGDA 4I27A 4PHAA 1N4LA 4UAYA 3JPTA 5KG2A 2IBKA 4K4GA 4DO9A 2A1JB 3MEDA 4K4SA 2HWHA 5HP1B 3RR8A 2BR0A 2BPGA 4O44A 1NHVA 5HLFA 1RZTA 1RYSA 2XC9A 5J2PA 5DG9A 4DOCA 3RH4A 4G1QB 2Y1JA 3EPGA 1QE1B 4ICLB 1ZQWA 4B9VA 2WRMA 3ICLA 4ED6A 1U9LA 3BGRB 1BQNB 1SKSA 4RNOA 4PGYA 4EBEA 4M6WA 2OPQA 3M9MB 5HHHA 4TY8B 1ZQLA 2NRZA 3DOKB 1AROP 3GV8B 2C28A 2VA8A 2XY7A 3KOAA 3QGHA 1UA0A 1L3SA 5IILA 1HQEA 3MEDB 1HYSA 2XGPA 2FLPA 4KLMA 4O44B 8ICPA 5HLFB 4J9PA 2YNGB 2IM0A 1BGXT 1TVRB 4KBIA 3RAXA 3DMJA 2JLEA 3IS9A 2KN7A 5KT2A 2AGOA 2BGWA 3PW7A 3TAPA 4I2QA 2IM3A 4GLXA 3ZDCA 4IR1A 4WFZA 3QIDA 4M6WB 2OPQB 1D9FA 2W9AA 3GV7B 2MAXA 4JV2A 4B9SA 8ICAA 5KFDA 4RQ4A 1DTTB 1KTQA 4O3RA 3GV5B 4EYIB 3KLEA 2ILYA 3GIJA 2D41A 1XO1A 1RPLA 1HYSB 1BPYA 2B43A 5EOZA 4MF8A 1K1QA 3D5MA 3H7IA 1C0UB 3ORYA 2BCUA 5DGAA 5J2NA 4Q0BA 1COOA 1TKDA 4Y2AA 3RR7A 3NAIA 3CO9A 4G3IA 4F92B 2BE2A 4I2QB 4LSNA 1GX5A 3Q8KA 3LK9A 2C2RA 1ZQKA 4RQ1A 4EZ6A 3PW4A 2R2SA 4DF8A 3MFIA 3M8QA 3OSPA 2FPLA 3AU6A 3JYTA 4HYKA 1UWBA 1ZQCA 1ZQTA 3PZPA 4IFYB 3KLEB 4DSJA 4B3OA 5J0TA 8ICKA 5KT3A 4QZBA 4QZDA 3EZUA 3TANA 1ZQQA 4J9MA 1JMSA 2AX1A 3E01B 3JPQA 3OL8A
chains in the Genus database with same CATH superfamily
1RA0A 3V81A 5HAOA 3CJSA 3AQPA 3WKDA 3GJQB 3L4PA 3NGTA 4MK7A 2BE2B 5IV4A 1UAWA 1ONWA 1F1BB 4R8UA 3RN6A 3K59A 3ZDDA 1A5MC 3M9NB 3N6NA 3WZ0A 4B9UA 3BS5B 2XS2A 4DR7F 2JFKA 1T9WA 4O4RA 3O2IA 3THVA 1HNVB 8ICGA 4HLBA 2YMQA 2RJZA 3AEVA 1H7WA 1HWUA 2XEXA 3P45B 1S7HA 3A4TA 1N48A 2Z8QA 2ZUCA 3QAUA 1CRXA 5GAGU 3US5A 4B3ZA 3W9HA 2FZGB 4A8XA 1SXEA 4CO2A 1L7NA 4NWBA 1HKAA 2CAJA 4CO0A 3KLFB 4IH5A 3BH7B 1VI7A 3RB0A 2PI5A 1W25A 2K06A 3AQEA 4RW8A 5HO4A 1NKCA 2HHTA 3KUEA 3I0SB 4EYHB 4Z6DA 4FVMA 4N41A 4NYZA 1KFDA 4ZS6A 5J0QA 5E3QA 2WVFA 2E8PA 2O01C 2BQRA 3AU2A 1LXJA 2J7UA 3OTOF 1CJKB 4NXNF 4OJ3A 3SDEA 2KT5A 4U6PA 1GK8A 4C2MA 3T1YF 1K0VA 3VAHA 1X8DA 2B4OA 3A3NB 2JEGA 1TL7A 4RQ2A 4OYAA 1UTAA 1IKXA 2JLGA 2KEYA 2FJDB 4DLEA 1OW5A 1V3RA 4AXJA 4WZMA 2PO4A 3CD0A 4K4UA 4PHEA 4C4SA 3MR3A 4CLUA 4DPYA 3C2MA 4NYPA 1RWUA 1C4CA 5F0WA 2YB4A 5A8RA 2RKIB 4C3MA 3I1YA 1AUDA 4B9NA 2XS5A 5J1EB 3QU9A 4KYZA 4C8KA 1S3TC 2YNFB 4CZCA 3BZKA 1A0OB 4RU2A 2BANB 1R0AA 2BE9B 4DHVA 3ISND 7ICSA 2IVFB 4FZLA 1O0PA 8ICLA 5J0SA 2PUZA 9ICXA 4OX7A 5KFZA 5AKZA 5HQMA 4MAKA 1PYOB 2YQ0A 5HVHA 1GTEA 2ZVIA 3KLIA 5CZXA 3W5ZA 2IJRA 1OO0B 4IQXA 3TQ1A 4KLSA 4CNSA 1OIAA 3BZCA 3PSTA 1ZTWA 3LVWA 2F8HA 2ZOGA 2B5JA 3GIKA 4LF6J 1RI7A 1RAKA 4PAAA 1V3SA 4FFDA 2BYCA 2HFVA 2J7WA 5C42B 1A5OC 4B6JA 2Y1RI 3QJPA 2QX0A 2BM1A 2XLKA 1PYSB 2HOIA 5GAEI 2GH1A 1WORA 4CO3A 5B0FA 3HKWA 3RJKA 1SH2A 1JLGA 7ICQA 3GFKB 3AQOA 4CF3A 4F4KA 5DG8A 4DLGA 4ID5B 1UW9A 2QA4G 4IH7A 5IIOA 3H5XA 1VLOA 1R6YA 3OUYB 4K5SA 2WB4A 5KFYA 1G1XA 4BUGA 4IKAA 1ZQGA 1ULRA 8ICQA 2YMPA 1U45A 2KG0A 1RT6A 1O03A 4DZ6A 1SC4B 3BE7A 2F1JA 3UMBA 5HP4A 1E6VA 4OI2A 3WK4A 1IJEB 2KFZA 4QIGA 4DQRA 5C7PA 1AA1B 2DHAA 4R64A 2GQCA 2M0GB 3CYMA 2Y0BB 2F8KA 4DZDA 3Q2TC 3GZFA 3RH5A 2GGPA 2L08A 4DX8H 1I51B 1X4GA 5F8HA 5GADI 1TKZB 2H5JB 5D15A 4OX8A 4KV8B 3ISCA 4ED8A 3BO2A 1Z3EB 2YMMA 2XNRA 4R66A 2B9YA 3CCSS 4ZP9A 3WDOA 1U25A 4NM1A 1TMMA 2KN4A 1V6HA 3DDHA 2KG1A 1MWYA 5KG1A 2YN4A 1OPIA 4YHHJ 1JLFB 1XRFA 3NCRA 3ETOA 1JXEA 2LQ8A 4OHYA 2A1AA 1T7PA 3KLGB 1VC5A 2KJ5A 1HEKA 5F0UA 1UJ6A 2CPZA 4DV4F 2E5GA 2VZ9A 4DR3F 2LECA 2HHWA 8ICWA 2RQCA 1CJVA 1LWEA 1CVJA 1GH8A 3BKFA 4B3TJ 1FO4A 5CA5A 2GZOA 3JQKA 2DNLA 4QZFA 2P6SA 4WIIA 2UUCJ 1NSQA 4IOBA 4KFBB 4LQ3A 4KITB 5J0RA 1A6SA 4QZ8A 3NGSA 1ZQYA 1T3OA 2G2OA 4WJ3B 4KN4A 3MR2A 1S1WB 4RQ0A 4QIEA 5L8RC 3OV7A 4E8UA 4NLDA 3NBPB 2AEMA 4XPCA 4M5LA 3M8ZA 4GRSA 3QEAZ 2JR5A 3M2VB 3S7RA 4DS5A 1ZPWX 5IQ6A 2ROPA 3RB6A 1RSCA 3OD2A 2HQFA 1B0TA 3M8PB 4P4MA 2A6OA 4RDWA 5ETOA 2EKYA 1HUOA 2YY3A 4UTGA 1X0PA 2QT3A 2CPYA 3DCAA 2DR9A 2NYVA 5L1MA 1SJQA 2KM8B 2HZVA 2MKHA 5DO2A 4X66J 1K8AT 4ED1A 4OHZA 3RJJA 3CJKB 3KG1A 4R5PB 2KH9A 2ZTDA 2YKMA 3H59A 4BKNA 1FKPA 2KAUC 4O0NA 2BHNA 4N7TA 3UWTA 1X4DA 2B0CA 3TARA 1E9ZB 3SEIA 2QB1A 4UQTA 1FFUA 2GQ2A 4FZVA 2IVYA 2WAQD 3O8WA 1I94J 4OX9J 1YKWA 5B09A 1UBPC 2FHOB 3BGLA 5J0WA 4C8YA 3ISZA 1Y5LB 2VBYA 3ETLA 2ZJRQ 1UCVA 4HT5A 2DHSA 3O3LA 3ZTRA 5F3TA 4OV6A 2OMOA 3BPDA 2WK4A 4CF4A 4F36A 3HPAA 2L3MA 2I8EA 4CH0S 2FVKA 1VIXA 3CTRA 4NA1A 5GMDA 3PG9A 2IAJB 4KGZB 2EFGA 3HSZA 3FCHA 4TKTA 2F1FA 2BCRA 4UOHA 1IE7C 3PJ9A 4N5SA 1KN5A 3HFVA 4J9VA 1T02A 4OLOA 5KFVA 2YKOA 4C0ZA 4YN4A 1F5BA 1VS3A 4GKJJ 5E41A 2XM3A 3PFEA 4DDFA 2O66A 4ZP6A 2V0NA 2IJNA 4WU3A 4H4MB 4AFFA 3ZC4A 1QQ5A 2XCAA 4YVZA 2QA2A 5HJYA 4M9HA 1JROA 3K8VA 1H98A 1WOPA 1XK8A 1CJUB 2K7JA 2HBKA 3FMWA 2DNQA 2X3DA 2G0IA 4Q0BB 1WTFA 4L72B 2OIHA 1VQ5S 4JUZA 2VG7B 4X4NA 1TP7A 4IQWA 2JV3A 3M4XA 4USVA 1BQMA 1GXTA 1GEHA 2H3VA 4LSNB 4YOEA 1D8YA 2BPFA 2EC0A 2J9DA 1DQ8A 5FDLB 2DXDA 2ZUDA 1O12A 2Q1LA 3M8QB 5DZ6A 1EJTC 5JXSA 2W7PA 3DI6B 1UFLA 5FSDC 2OYYA 5ITHA 4LBPA 2K7KA 1ZXIA 4DN9A 5MLCV 3FFIA 1DQAA 4Y2SA 2V34A 4F5PA 2ZJAA 4DCCA 1HL6A 3RB4A 3TA2A 2SXLA 3HVTA 2EVZA 3LW5C 5E3AA 3IG1A 5IM0A 4O3MA 3MCMA 1U0HB 3FNNA 4LRAA 4FNIA 4KKOB 1W2IA 3DV9A 1LWFA 5J2KA 1RTHB 2D3UA 1NCLA 1VRTA 2C3OA 1O8BA 2HFUA 1ICEB 2YWFA 2F77X 3L7PA 4GY7A 8ICUA 4TLQA 9ICQA 3TX0A 1JX4A 5J2QB 3DOLB 5FJ4A 1ZA2B 1YBTA 3CNQP 7FD1A 3KBBA 3DHWC 4MFAA 5KFGA 3E3XA 5EUHA 3GPAA 4KIAA 4PQUB 4ZPVR 3LA0A 2CVIA 2F76X 4JMUA 1WI8A 4HDHA 3TVZA 3QFHA 4Z7YA 2W9BA 2FVRA 5CHCB 2YX1A 1VDHA 4ZPBA 4BCAA 3B0XA 1C20A 3DM2B 1FWCC 3BSCA 5A6PA 2VFRA 1N5YB 4F2RA 3DXBA 4P4OA 3CPWR 2E5IA 3T81A 3TUPA 1JKHA 3N4MB 3KTQA 4F7VA 1TVAA 4BWMA 4CNTA 1RAIB 4TNOA 1QLNA 2DEJA 3I5CA 3N6LA 1WI6A 3GYXB 1HPZA 1ZAWA 2HHQA 4CO4A 4LREA 2IMRA 3ZDAA 1N36J 4PWUA 1IR0A 1IBLJ 2DNZA 1SKUB 2AT1B 4UZBA 2OPPB 1PUZA 4USMA 1KSPA 4GVBB 2M7SA 2HVDA 4Y65A 2LU1A 5D77A 1IBMJ 3HFKA 2PFQA 4N8NA 5J0UA 2IRXA 3LOUA 3F41A 1YNYA 4ATNA 3WK9A 2J6UA 4NM2A 4F0LA 2NXNA 5E3CA 3BR9A 1N0UA 1KEJA 1A5NC 1KVJA 3FUYA 4JV1A 3MUTP 1TU0B 1IR2A 2CN1A 2CDRB 1DGJA 4OX6A 5LXYA 4KLFA 4GO7X 4IDKA 1KEKA 4TY9A 1PAEX 4RQ7A 2LQ9A 4YHHF 2WW4A 1LW2B 4USHA 2PI4A 1ZQAA 3TNVA 4Y2TA 4M94A 3UO0A 2HNYB 4J9OA 2ODGA 3R7NB 3CWJA 4Y2VA 4I2EA 4I69A 3E0LA 3Q8SB 2E44A 4DFPA 2NSBA 3J7A1 1U09A 4NLUA 5J2BA 3RJEA 4LF9J 1SKRA 5KFUA 1MNEA 2OO4A 2QA1A 4J03A 2IOFK 2R7RA 1TL5A 4B3TF 2DHXA 2HOQA 4ZP8A 1K6WA 4Z6CA 3M1YA 2UUCF 1WG1A 2GCFA 4C5ZA 3NRZA 2YKPA 5ETQA 1JWWA 4FKYA 4JI5F 2I0XA 1RTJA 2DPJA 3GWCA 3M1VB 2GVZB 4C8NA 8ICCA 3A3PB 1IM4A 2MKCA 4DWIA 2YNIB 3SD7A 5CJ7A 1IUJA 2C2ZB 1T3NA 1FKOB 4H54A 3MCOA 4MEYA 3T9NA 4HKQA 3CIMA 4LR8A 5A8KB 4TU8A 3W60A 1M5PC 3H4BA 4RW6A 1LV5A 4ILRA 5D0HA 2Y1LB 3KD3A 1X60A 3RBEA 5IC4B 2UXDJ 4RPXA 4PZOA 4X66F 2DCUB 1XWLA 2V2VA 5A0YB 1KDHA 3K5MA 3PR5B 2X1FA 4DSIA 2A10A 4I6AA 1N5WA 1RACB 1LK7A 2MKYA 3HHDA 3CXCR 3NASA 3D0IE 4MIAA 2P2CB 1WJ9A 3BBFA 1RHMB 1AQ6A 1VRQC 3QIPB 4IFVB 2W9CB 3EDQB 1F44A 3L9ZA 4NLSA 1I94F 4YB6A 5DGBA 5DBBA 4HAIA 4OX9F 1DURA 4AP9A 1VQYA 1B7FA 8ICTA 3RGIA 3MAAA 1S9FA 3QGPA 5CYQA 3GR0A 3GYGA 1NZAA 4JB8B 5FLXY 2FVCA 4ZP7A 4U95A 2ZH6A 1TTHB 1FWBC 2HHPA 1BQNA 3FVYA 4IOAQ 3MI7X 3W5YA 2CWKA 2FJ6A 1EKRA 2ZIXA 2HHSA 4DOAA 3HDSA 2FZKB 3DOKA 1TL1B 2WZ1A 5IZHA 1F9HA 1G2EA 3R2DJ 2AXTU 1RT7B 1X5SA 4LRCA 3HX9A 3A1YG 2HYIB 3GFXA 5J2FA 4GKJF 3QE9Y 2NCKL 3BDPA 2K1RA 1JXLA 3TFRA 2CJXB 2KHDA 1WC5A 3QPIA 4EO8A 1SV5A 3FZBA 2JNJA 1Q7LB 5KFTA 1N60A 3TADA 3D1QA 1Y88A 3W2WB 2P5VA 3F5EA 4DU8A 2GO7A 4OHVA 2WF9A 4EO6A 2B21A 2W3RA 3IRUA 2ZG6A 5KFKA 1MW7A 3MHYA 5JUMA 3OFEA 1RYUA 2YNHB 4JI0J 2YPYA 3NVYA 1VQ6S 3HD2A 1ZOTA 3KFWX 1D9DA 1UQVA 2WOMB 4A8WA 1FWHC 9ICAA 4FF1A 5CQGA 4RBUA 2HLTA 1LOUA 1JLQB 4ZVEA 2PGCA 2XIDA 2JC0A 1R7IA 2XI3A 2JZ5A 3CCQS 5LMNJ 5B0AA 4UARA 2VDIA 4RUBA 9ICGA 3LGNA 3S6JA 4NV0A 4UAVA 3F44A 2LQJA 3JPPA 3WBZA 2ZIVB 3JPSA 4IFYA 1M5KC 1KRAC 2F4VF 2D3OR 4NL5A 3QGKC 1FE0A 4RDVA 2F8LA 1S57A 3LALA 2R7TA 2ZHAA 3C5FA 3RU0A 1TKXA 4WE1A 4M5IA 1HBOB 2FPHX 2NLWA 2JZBA 2ZIUA 1YWXA 5LT5A 3KDNA 1S1VA 3C6TB 1S9GA 3KLHB 2VJVA 2KXFA 5LMUJ 1U2RA 1FI4A 4AC7C 4EFAC 2X1AA 4V19X 3FAHA 3V7PA 3LPYA 4OZJA 3ILJA 1FWEC 1MU2B 1A9NB 4CLTA 2CG4A 4M51A 5HR7A 4W92B 1N56A 3GMGA 5A76A 2JH7A 3K0JA 3UD5A 4U67Q 2WTFA 5I3QA 2QLBB 1S9EA 1T11A 4KIRA 4K4XA 3BKTA 1M7JA 2EFQA 5F3ZA 3ZXWA 3TUJC 4RBTA 3GQCA 1T03B 4ECSA 1D09B 4Z42C 2OAUA 4XIUA 3TYTA 1YI2S 2B7CB 3OJUA 3E8OA 4FBUA 1D8LA 3JQMA 1JIHA 4FS1A 4LR7A 5IT4A 3MM5A 1WCLA 1N36F 3GE9A 2VBWA 1IBLF 1RHQB 4DPXA 5J2HA 3VHQA 1VCTA 3A3OB 4YCXA 1MROB 4C6AA 3DGPB 4ETZA 3RAQA 5DETA 1P9YA 2DKXA 3O0FA 2I9GA 3QU5A 1X2IA 4G1PA 1IBMF 1S1UB 5KG3A 1Q8LA 2BRKA 2IY5B 2RH3A 1E6YB 4C97A 9ICJA 5HMMA 3IXQA 4CM0A 1CC7A 4KLEA 4WP9A 4C8ZA 2OM6A 4JBCA 3V2UC 3VQTA 3TKAA 1ZQSA 9ICKA 1RWMB 4NJ8A 4IUFA 2NV3A 3DLBA 2A19A 3IRXB 3SAHA 3N0VA 2B3TB 1QAIA 1KOOA 2FC8A 3EGVA 3N01A 2ASDA 2ZBRA 4F04B 1SKWA 3H0LB 1HNIA 1M1KT 4ECXA 4BXOA 4KN7A 3K2YA 4A8KA 5KFOA 4OD0A 3ILOA 2GC8A 2H54B 3TAMB 2QTWA 2MQOA 3JS9A 3D54A 4MKVA 3K8WA 2XI9A 3WKEA 1RJJA 2KJWA 2FQQB 3GJRB 1RK5A 4MHVA 4KLGA 2ZWOA 2QS8A 1REVA 2V4JA 4Y2YA 4ILMA 3CGIA 3CDWA 4QW8A 3AMZA 5EDWA 2DGTA 2HAFA 2VKQA 3VAGA 2D3ZA 4GOAA 5ETNA 4CT9A 4YD1A 1WWHA 3ALRA 4ECZA 1YRXA 2KT2A 2XYHB 1Z1ZA 3DU6A 3BGFA 2D1CA 2LFVA 1RM6C 2MHNA 1V4YA 1TV6B 2VG5A 1QM9A 4UB6U 2HNZA 1ZQUA 3JTPA 3Q24A 5J1PA 3LF0A 2ZC3A 2B8QA 2RQ4A 3LP0B 2UXDF 3KHRA 3MEGA 4ES1A 2K2PA 5C5JA 9ICNA 1ZQPA 2FTYA 4AYBF 3R5AA 2HG4A 4ID8A 4D3HA 4CLLA 2K8AA 4ZCMA 3FRYA 3JXOA 1Q3UA 2GJIA 4PPXA 2IJFA 4MIWA 2FJXA 4MFBB 5CCLA 2W2NP 1S48A 1FDDA 1YBQB 4F91B 3Q83A 3DLLQ 4TYBA 2GO8A 3UQSA 3OJSA 1Z1BA 3DLGB 1TFWA 3BGOP 4ZHRA 1YMYA 3PX6A 3N7RC 3CD7A 2B4UA 2AQOA 1QTMA 1COKA 4OJLA 5LJ5Y 4OYZA 2MKJA 3QYYA 4NCGA 1IKVB 2JEJA 3NRBA 3MDAA 1DGSA 2VA2A 1V38A 1UEVA 2C3YA 4UF4A 3MD1A 4NMLA 3N4WA 1DBDA 3KJNB 5B0EA 3VV2B 1YTYA 4C9DA 4KX5A 2QARB 1R9YA 2NSCA 4RNFA 4WWSA 3PFOA 4F3OA 2I1QA 2MDAA 4K4ZA 3FCWA 2MQQA 3H8MA 1YBUA 5AIBA 3H0MB 4US8A 5F9LA 3PRDA 3V6DB 2G3FA 4Y2IA 4Y3CA 4DV1J 2HHUA 4ANDA 1RT3B 2R7WA 3GCWP 1Z00B 2VG6A 4KMOB 4PH5A 4ILLA 4LRFA 2BDPA 4QZEA 1CULB 4YXMA 1KRPA 2PT0A 3T5HA 4JI0F 1LEOA 3M2UA 1X9WA 2CJYB 5J8YA 4W4MA 5K8MA 3O44A 2GJ2A 1T8EA 2UZ9A 4BC9A 2G2YA 4WK3A 8ATCB 3MZIA 2HLUA 4KLQA 2E29A 3SV4A 1M1GA 3H8JA 4CQBA 5ETLA 5LMNF 3G6VA 5HROA 2DR8A 3BREA 1WHVA 3NGDA 1KRCC 4I27A 1Q53A 1RZMA 4KRWA 2A1BA 5KG2A 3MMAA 4I1TA 4LR9A 4KQNA 2A1JB 3IG5A 2RSQA 2HWHA 3ENVA 3RR8A 2NREA 4NEZA 3X3UA 2Y1JA 3EPGA 3D9BA 4ZCKA 3I82A 2XSFA 4MTPA 1FWJC 4IL6U 5K8PA 4IYQA 1C4AA 4ED6A 2Q43A 1TUWA 1B3TA 2J0XA 4TY8B 4DV7J 1UWAA 5LMUF 2R4FA 3GV8B 3K57A 2CPRA 1ZOLA 2VA8A 2M5YA 3QGHA 2O1PA 1UA0A 1L3SA 2ZBQA 1HQEA 3MEDB 4F02A 1QDUB 2XGPA 4KLMA 5HLFB 1NMEB 1KL9A 5I4MA 1TVRB 1Q86T 3PNIA 3DMJA 4J90A 2OMLA 5JU5A 3IS9A 1WSRA 3QRRA 2E66A 1NO8A 4I4BA 2W3SA 2KG5A 4CI0B 3ZDCA 3LUYA 2XNQA 1BQXA 4DR5J 2HCFA 2ZKTA 2W9AA 1HBMA 3NS5A 4V19J 3PRBA 2GHPA 3IAS9 3IG8A 3GIJA 3MEKA 4USUA 1RPLA 3HLUA 2B43A 1WKLA 1K1QA 3CCRS 3H7IA 1C0UB 1L7PA 2MB0B 1RHRB 2C2MB 3VGUA 1DK2A 3TRGA 3NAIA 2AP6A 3QUBA 2BE2A 3ZI4A 1ZZNA 2ZJPQ 3DOMB 3Q8KA 3LK9A 3UD3P 1Z19A 4UATA 5ALFA 1LNQA 2R2SA 5GAHU 2B4PA 5ALKA 4HHJA 1RQ0A 3KLEB 4DSJA 3LSBA 4OZ1A 4CP5A 5KT3A 1SV0A 1YSJA 4BX9C 1B0PA 1JMSA 3AN1A 5K5MA 1SWVA 3SCKE 3OL8A 3M32A 4EI2A 3QZ8A 4B02A 3TAQA 4YR2A 1KS2A 2M52A 2PLMA 1ZQVA 3SQOP 4FO6A 4J37A 4M63A 3DDNA 3ENAA 2KTQA 1MMNA 3PACA 4P0QB 2LQ5A 2O3DA 3GIPA 1QAJA 4KPYA 2QEXS 3MEEB 2HSZA 1G6BA 3JB9k 3HI9A 4ELTA 2KMDA 2QG9B 5KFWA 5JMNA 4FPIA 4C7QA 1CSJA 1ZQRA 3I9ZA 1P9QC 4MH8A 5E2QA 4WKYA 4HHUA 5ALHA 3W7BA 1ZQJA 3JTOA 2F8MA 2CJQA 5AKIA 1JLAB 6AT1B 2VBZA 2L9WA 4I68A 2FY1A 3W64A 3LPEA 4G65A 4RR5A 7ICMA 3CDBA 3QNMA 2PFPA 4KH0B 4M2YA 7ICIA 1NJIT 3EWAA 1NK9A 1NJXA 1ROFA 2HBYB 2YNFA 4BBYA 3JPNA 2Q6CA 5HBMA 3UPQA 3N7PD 2GWNA 1W26A 4P74A 1I6JA 4RW7A 3AY0A 1OUQA 4QU6A 4V1YA 2DGVA 1UVNA 2KRRA 5T41A 7ICLA 1V97A 2QZ8A 4CE6A 1Y4ZB 1KFTA 1RTIB 2V67A 2NXJA 4LF8J 2JH1A 2HBZB 4K2XA 4ANEA 2JXJA 3J7Z5 3WK7A 3HT3A 1HW9A 4CYUB 3UVJA 1T05B 4DPTA 5G4DA 1KLNA 2Z0GA 2NPIA 3IR6B 3B78A 2XWYA 2HZCA 1WCNA 1X0FA 1BXNA 4UOFA 2FGCA 4X4VA 4YMNA 2RF2A 2I6WA 1WG8A 4P10A 5C42A 2DVIA 2YQ3A 5ALOA 1A0PA 3AL0B 1V9PA 1RJRA 9RUBA 1HHTP 1APSA 5IV3A 2MZJA 4ZIVA 2MLYA 2ZOFA 4ID5A 1X5OA 3OUYA 2KVQE 1ZQMA 3SYZA 1XEZA 4QZHA 1IBCB 3L7OA 1RT5B 3M30B 1NZ8A 4IH6A 5T7LB 3AA9A 2YX4A 3SQGA 5KAFU 1SXLA 1MMLA 4DV1F 2KD1A 2Y0SF 2KT3A 5D0RA 1UA1A 1VHIA 1NK5A 8ICFA 1FXDA 4MKAA 1GO3F 3WK8A 3SV3A 1T9YA 3ICXA 1IKWA 2KIVA 1TK8A 3FSXA 1NNLA 2EXUA 3PCOB 1OYEA 4O3OA 2G2ZA 2CPXA 4FYWB 3AJ1A 2YWWA 2QSWA 3GSDA 1SJ3P 1FRJA 3D1OA 3PMLA 1VJQA 3QWPA 2H3EB 5D4BA 2YY6A 1YX2A 1X4HA 3CDUA 1R8BA 3JSMB 1FVSA 3QJJA 3QYPA 4ZLPA 2YH1A 4RL1A 4F0HA 3DFEA 1TKZA 5L9NA 2AU0A 3ET6B 1WUUA 1BMQB 4YY3J 1NUEA 5DB9A 1TELA 1FO1A 3D6NA 1M6YA 2E1AA 2WONB 2YWHA 1QVGR 3SZ2A 4YMEA 3UQ0A 4C80A 2ZITA 2KVIA 1HWKA 2MJNA 3EXCX 5GTIU 4HEA9 4C65A 3PXGa 3C46A 4WP8A 4JWMA 3ONQA 1U1KA 4QZ9A 3I4HX 2RNEA 2RRNA 2NYHA 3OSNA 1JLFA 1O08A 1B4FA 1FEZA 4C8MA 3LP1B 3MABA 3KLGA 4EEYA 1UEUA 2HFSA 4IO1A 1FX4A 1Q81T 1FRXA 3R5DA 2XCPA 1DTQB 3NS7B 4YP3A 1Q95G 2HMIA 1J5OA 3K5PA 4NLCA 3KYLA 3I32A 3HK2A 8ICJA 1VRUB 3PR4A 4Y2XA 4KFBA 5HATA 2X7IA 1L8LA 4TLRA 2ZH1A 1YT3A 3PW2A 1NSPA 2YWKA 2CQCA 1S6PB 3E0FA 1AUSL 4ES2A 4KGMA 2AX0A 4P71A 2JHEA 4A8OA 3R7BB 2QL9B 3NWRA 4F0KA 3ICJA 2C2DA 4U7CA 3M2VA 1M1HA 1ZBTA 4Q5VA 1U4BA 3HKZC 2F3NA 1RK6A 3ETMA 1D8ZA 3HZGA 2UUBJ 3IWNC 1QAXA 1BNPA 4EEKA 5HHIA 3LP2B 4F4YA 3DRPB 4L74A 4DL3A 2BV3A 4DPUA 5IS2A 2VKRA 5DKWA 4Y2PA 1SUQB 4DR5F 3KK3A 5CHGA 3J7ZT 4N47A 1VQSA 4LF1A 4NI2A 2A2CA 4P2FA 1ZAVA 2WB1F 2VFSA 2JH3A 5DM7Q 5IT0A 1OJ4A 4XQ8A 3OVBA 1Q16B 3UR0A 3ZTOA 3CJKA 1A6LA 2IIHA 1JALA 3LS9A 4I2FA 2B56A 2G4BA 4IRCA 4R5PA 3MM9B 2UUAJ 4C5YA 7ICFA 3PEHA 2W11A 5ALUA 2MUTB 2CZ9A 3KLVA 2AZ3A 1U47A 1MWZA 3K89A 2RILA 4QIVA 2NRWA 3G82B 2FY8A 4YD2A 4YG2A 4B9LA 1KQSR 4L76A 4CEXC 1RCOB 4FZMA 3JQJA 5HR6A 1PIEA 4QIWF 2Q4TA 3EW9A 4DL5A 2OPRB 4RUHA 2ZTCA 2K8BB 2LPEA 2ACMA 2WFAA 3Q8LA 3I5AA 2CKWA 3BQTA 4C7YA 4TURA 4IR9A 2IAJA 2LXFA 4KC5A 5AI6A 1LFWA 3VGVA 4Q45A 2ES6A 1FWIC 4Z6EA 4M5HA 3HPOA 1SL2A 3HWTA 3U7JA 2OHDA 4H4OA 2AMCB 9ICRA 2DO4A 5AKYA 4OHXA 2MGZA 2KVCA 1OXJA 4RT3A 4H4MA 3FQLA 4I2GA 2KFNA 4XUSA 2Z7JA 3PVXA 1SH0A 4K5RA 4CO5A 2JMGA 1TAUA 3VGTA 5HVFA 4KGXB 4QWBA 5D49A 1ZQBA 4FYDA 1CJUA 4ED7A 3MFHA 1HMVA 4Y2QA 4P73A 4NZ6A 1X4AA 4CLFA 2VG7A 4HI1A 1EJSC 4F0RA 4Z2XA 3IGNA 2QV6A 2J8SA 4G6VB 7ICRA 1VBZA 4NXMF 2E5JA 5J2MB 2FHJA 3MM6A 2R7QA 5FDLA 3SXLA 1KKXA 5HJXA 2F1IA 2HDOA 3R9LA 3F56A 4ED3A 1EX8A 5B7WA 1FWPA 3UPFA 2OPSA 3LGMA 3Q89A 1CJTB 3DI6A 4R63A 1SPBP 4PGXA 2OXOA 4CLSA 1SL0A 3NL0A 1GX6A 2M8HA 2QRRA 1U7LA 2YH0A 2BB0A 3BSOA 4JI4F 3PY8A 4BGDA 4BHQA 1FCAA 1KD1T 2ILZA 3QQCD 4OMFG 5KAKA 1RADB 1BPDA 4RZRA 3T1HJ 1S0NA 1RDRA 3H20A 1VJ5A 1ZQIA 2MTLA 4KKOA 1RTHA 2VANA 1VQ4S 2YKQA 2MU2A 1FTRA 2ZH2A 3JYTB 4QR1A 1Y10A 5KG6A 1BWVA 3DOLA 4DXLA 4I28A 1SC1B 4ZK7M 3IBFB 1MN8A 3R5CA 2XG8A 2DY9A 4B3MJ 3MMJA 1WC0A 3GIMA 4DX6A 1MN9A 2OFHX 4PQUA 2GS8A 2QA4S 2CQ1A 5AK6A 2CNNB 2BKPA 1XMQJ 2XY6A 5BYQA 1YRRA 5LOQA 2QO3A 5C25B 3OR1A 4RWWA 2QYCA 4IG3B 1OQ3A 2L9DA 2UVVA 3QX7A 2ZD1B 2YWGA 2F1HA 2FJAB 1WOSA 3DM2A 4R85A 1MLAA 3CDEA 3ZDBA 1JLBB 2EFVA 5CABA 1RT2B 1N5YA 2BJ9A 1U48A 4UBPC 5DG7A 1IM6A 3C2PA 4MK8A 1WELA 1X66A 5KFBA 4ZPCA 2CVEA 1GMVA 2J9CA 2Y8YA 1FDAA 4XAKA 3EICA 3TP2A 1S8OA 5BYRA 4URSA 3C3LA 2AYEA 2FPKA 2CZVC 3GIIA 1MQ3A 2V4QA 2IRUA 4QPXA 2HVHA 1YRUA 2E1MC 1F2HA 5BOLA 2BCSA 1EIYB 3NNCA 4PHPA 3RJGA 3CEDA 3WX8A 4I7FB 1J97A 4A47A 2OPPA 3AJ2A 3GTYX 2C3MA 1RBLA 4GVBA 2NS1B 2LYBA 2EBEA 3PX0A 2RT3A 1JRPA 1TFYA 4M9GA 3PKYA 2IRYA 1XNSA 2WVCA 4YY3F 5AKJA 4MMOA 4KLHA 4RQ6A 5F8NA 4QZCA 4PR6A 3SDEB 3OTQA 3KMSA 2I6XA 1TL4A 1P1MA 9ICBA 3H25A 4LZGA 4R0JA 2AHOB 2V63A 2HQ3A 1LW2A 4NPOA 4I2PB 2XY5A 2JRZA 1C1BB 1IKXB 5H2FU 1IG6A 1N6QA 3D66A 1TMJA 5FP0A 1B7YB 3CMAS 5CEHA 2NRXA 1FXLA 2B51A 4ELUA 1ZZFA 1L3KA 7ICNA 3AHPA 4USIA 3UN2A 3DUGA 1VDVA 3ZTQA 3C2LA 1R0AB 2UVRA 3OXLA 4PHDA 1MN7A 4K4TA 5HMYA 3DRSB 4NLQA 2K3KA 2HBQB 4ED0A 3F5AA 5C0YA 3BSAA 4UB3A 3FZ2A 5TISU 2G08A 4KLTA 1CQMA 1YGYA 3GFHA 1UVIA 4NRUA 2YTUA 2GVZA 3KLIB 2FC9A 1JUDA 3T9ZA 4OI0A 1T94A 5FLXU 1C1CB 5CRXA 3ADAC 2IM1A 2EWHA 2RRBA 8ICYA 2Z58B 4ZIWA 3NVVA 5CA7A 2YB1A 3B4DA 3PJWA 1FRIA 2EG2A 1DRZA 2XMJA 5A8KA 2PEBA 4Y34A 2V50A 2LYHA 2J5AA 1M5VC 2DIUA 4I2JA 4KLIA 3UW1A 4M5JA 3W61A 5L1IA 1POJA 4LF4J 5AKKA 4RQNA 3RRGA 2Z00A 2KZMA 3CCWA 3EJMA 2VJ4A 2MHEA 3DRYA 3WC0A 7ICKA 1CS4B 3ZDEA 4LVOP 4LF7J 1URJA 7ICVA 2FMSA 4OLPA 5G4HC 2WAQC 7AT1B 2UUAF 1MG7A 1FFVA 3J81Y 3RYLA 4IFVA 4OL8A 1E6VB 2RU3A 4P72A 5GMEA 5K9FA 2VIXA 2KI2A 4U9RA 2QL7B 3CJ4A 2ZZTA 1WC3A 4JYAJ 4KT0C 3V4IB 1U1RA 1SJRA 1AFIA 4QCLA 1KONA 4LFBJ 3FDSA 3HX0A 2OFGX 3MOZA 2AYBA 2YQ1A 1PVRA 3CJ0A 4Q2MA 4ECWA 1VQ7S 5J0YA 2KSOB 1EJRC 1RT7A 1S0OA 3OTCA 4ZCIA 3Q0AA 3EUNA 1TL3B 9ICSA 2VICA 2VU5A 3WIVA 2VODA 1HQUB 3WK6A 2RHQB 1FTCA 1P6TA 4MFFA 3P49B 2V8HA 2HHHJ 4FZNA 4UY85 3UM9A 3HHEA 3C23A 2MZTA 1UT5A 1Y5NB 2QFJA 1HNWJ 4RNNA 5ALZA 2ASJA 2OKQA 4QR0A 3ZD8A 2G13A 1PK1B 2FVSA 2EW9A 1N5XA 5DLGA 5AXLA 2GV1A 4DFDA 1LWEB 5FIIA 2HGMA 4KQZA 2EZZA 2FLOA 2O67A 2YWEA 3MM8A 4C11B 1LK5A 1KC8T 1TUVA 3AXMA 4Y28C 3W62A 2WOMA 1NZBA 3QNWB 1CG2A 2YNGA 1JLQA 4OYIA 3MM7B 4ZVHA 2HHXA 2GA7A 1VQPS 2KB2A 5J29A 5HI7A 2V8PA 5EWGA 1U1PA 5F8GA 3EPIA 1N5QA 2JRSA 1R0CB 2HVZA 3OOQA 3QZ7A 2CJ9A 3WC2A 3QXGA 2W04A 4ZITA 3RB3A 2JX2A 4ZA1A 3TUZC 2LXUA 4PXEA 2P9CA 3T1HF 2MEWA 4C0HA 2RUSA 4GC7A 1DTTA 1FNXH 1RYRA 1BUXA 2ZJQQ 1U1MA 1JJ4A 3H8WA 3QT8A 4CNUA 4TXSA 4EPBC 4P2HA 2BKNA 4GKKF 4ECYA 3L7UA 2UU9J 1RWVB 2Y3YA 5LM7E 2WSCC 1S59A 2ZUGA 1Q8IA 4G7EB 3KG0A 3MPYA 2R2RA 1HBOA 5J8YC 4EENA 4B3MF 2WF6A 1RLCL 2CPHA 2H4WB 2YKMB 1ZAXA 2D7SA 2LKYA 3C6TA 4J9KA 3AD8C 1XMQF 1RHJB 1JLEB 4L9XA 4CRXA 2R18A 1EARA 3IGVA 4C60A 2ZH5A 2DYAA 1MU2A 1S99A 2DITA 2I38A 1F0XA 2LA6A 1Q8KA 2EBGA 3GYNA 2ZH8A 2K4HA 3E01A 4Q2LA 4UT4A 4O5KA 1WHWA 1S5ZA 8ICZA 3I0RB 2MQMA 4BWJA 2DJWA 1N8RT 2H3FA 2MSSA 3HKZD 3G8SA 4KLOA 2KL8A 1XNQJ 5F8JA 4K4WA 4I56A 1D0EA 2BJ1A 3GCXP 4LJMA 3HM7A 1RG6A 2XO6A 1PC4A 3AOBA 4NA3A 1N88A 1PKUA 3AOAA 1YBAA 4DQPA 4IO9Q 3SMVA 1A76A 3H8YA 7ICTA 2F40A 2DF4B 1UVJA 4ECRA 1J2MA 3NRWA 2JL9A 4J5OA 1NSKL 4EELA 3JAMY 3QBCA 4X64J 3DGPA 4M5KA 1IBKF 3FM9A 1CEZA 1T9VA 2H65B 2LBOA 1R8PA 2FJVA 3OBIA 3OFFA 2Q09A 3RRKA 4NLNA 3PNCA 1S1UA 2V5HG 2XHWA 3K75D 3NNAA 2WHEA 2CRXA 1VBXA 2DNMA 3O6QA 2YX7A 3OGUA 3RBDA 2OLWA 1EKSA 3N5FA 1URNA 1HLWA 3ZZTA 4I2AA 4OYMA 2HK2A 4PUOB 4UY8T 2CQ0A 4J9SA 2CRLA 3IRXA 1F2GA 1X42A 1T3QA 3G6YA 2BJ3A 4DV2F 2ZZNA 2YVSA 3LA4A 3MD3A 1WG4A 3JPOA 3KG4A 5GMKa 1KVIA 1WNEA 3SAFA 3H4DA 1GT8A 4PGQA 4P2XA 1RAOA 2C2NA 2AJ0A 4EK2A 1N33J 2ASYA 3D6FB 3KXDA 3I56S 2ZE2A 3UXNA 3ZNJ1 5HMXA 5IM0B 2Z57B 3I9V9 3WKAA 4OYBA 2HURA 1NHUA 3QUQA 1LWFB 1W2BR 1RJQA 2WCXA 5F8LA 4C8LA 4HACB 2JFDA 5AKHA 4WFXA 1RB0A 2ADCA 4UQGA 2BJ7A 2EK1A 4M9LA 4M04A 4O5CA 5C24B 2GQQA 3MCSA 1SV0C 4FYYB 3HVRA 3F53A 1RAEB 5F3XB 8ICMA 4BJHA 4F4XA 1FIQA 5IFMA 3T8LA 7ICHA 2NYIA 3J81j 1JB0C 3G71S 4QBUA 1UKUA 1UZDA 2QE5A 3IM8A 2BZ2A 2W9BB 5HVGA 3O5TB 4Z37A 3PO4A 3W1YC 4LF4F 2AKWB 4KO0A 3LAKA 1GAOA 1RA6A 2GOKA 3LP0A 4PXBA 2R42A 2ZFHA 2LXIA 2FDRA 4I2BA 3DLKA 1JKHB 4LF7F 2FHMA 3SFGA 1IQZA 2A3VA 1YG0A 2DNRA 1S1TA 3V7KA 3V7JA 2LP4A 4O3PA 1BPXA 2J0WA 3CMQA 4MFBA 1HPZB 1H74A 4YDXA 2Q0ZX 5J2EA 1NJWA 3PDNA 4CO1A 3DLGA 4IS7A 4WGXA 5F9NA 1GMUA 3UXPA 1CI4A 1U6FA 1S4FA 4BDPA 1RA7A 1WD6A 2OJ3A 2D9OA 2H3ZA 5IC6B 4JYAF 1UEKA 3PV8A 4DUYJ 4DF4A 1KOHA 4JWNA 5KG4A 1S0VA 2GMHA 4LFBF 1KQGB 5T14A 2M9NA 2DFLA 1FRKA 2RDDA 4NA2A 2CG8A 1RJPA 4WBFA 1NDLA 3IR7B 2XZDB 5L38A 2J9EA 3PSFA 5AKLA 4DFMA 3CO0P 3TEGA 3FYHA 2MPUA 4U8YA 4LVNP 5KFIA 3IC1A 1PZNA 3ZZOA 2B6AA 2HHHF 1EQ0A 1RP5A 3V6DA 2FGOA 2PD1A 1AB8A 2CQHA 4OJOA 3BO3A 4UB8U 1RT3A 4UB4A 1ZD5A 3CJTA 1HNWF 1WF2A 1VQ8S 2H5XA 4LIWA 4PG6A 3CC4S 5DDQC 4ICAA 1X9SA 4LBIA 1Z00A 4QZGA 1FFSB 3ZD9A 1G7CB 5AM4A 4WCEQ 4OJGA 1YZ6A 4R0EA 3N6MA 1CULA 1EZZB 3FBBA 5AKQA 8RUCA 1ZQZA 4L75A 3C29A 2DUYA 1ACMB 3X1LB 4YFKA 4ZPWR 1XMBA 1WWVA 2HQCA 2I5JB 4UB5A 4DG1B 4QQBA 5B0BA 2RP5A 4WYLA 2EQYA 3RH6A 3GSIA 1RTJB 2B7BB 5EWEA 1WC6A 1X9XA 4ERDA 4IRKA 2KXNB 4RU9A 4TUSA 1WSVA 3GRIA 1FRMA 2GIRA 2LI6A 3OLAA 3MKVA 3CMES 1RBOB 2G0CA 2A1JA 3C19A 4DQSA 3VCBA 2LDYA 2KDOA 3Q8RB 2RDJA 1KBUA 2UU9F 1VFJA 3QWUA 3TQEA 2OI2A 8ICXA 3EM1A 4YXJA 2R7OA 1BLUA 3UCUP 4ZLJA 1IV8A 1ZD3A 2CPEA 4FNHA 4GVLA 4X4RA 5A6TC 2R8GA 3M8YA 5DB6A 2HOFA 5AI4A 2HVEA 1Z4OA 2J0SD 2W8LA 3ZTPA 4JP8A 4ZVPB 4GO5X 1CBKA 4JI5J 3QMQA 5JVHQ 2HS0A 2VJ5A 3IGHX 3HZEA 2OD6A 2OUGA 3MEDA 3OPXA 3R7SB 3FEXB 1YIJS 1NHVA 5HLFA 1RZTA 1RYSA 1N32F 2XC9A 4ZLNA 5J2PA 5DG9A 1HIYA 1POKA 3RH4A 4WU2A 1SV4A 3H90A 1QE1B 1EQMA 3D3BJ 4CNZA 3EX7B 4RPFA 2VM8A 4N56A 5F41A 1U0SA 3BYRA 2ROEA 2W54A 2HBMA 2BJ8A 2HFNA 1BQNB 1XNQF 4Y2KA 4PGYA 3SSQA 1Z1VA 4JI3F 1SCJB 5HHHA 1K5OA 2ZIXB 1VOMA 3DOKB 4OYPA 2A2DA 3NNHA 2J8AA 2CQBA 3ZZPA 4X4QA 1OMSA 2XY7A 3KOAA 4HVZA 2QN6B 3NXZA 1YLXA 4YN3B 4O44B 2C3PA 4LMZA 2K1RB 9ATCB 2N82B 2KIWA 4CTAB 3PYEA 4KBIA 3RFAA 2KU7A 4X64F 2JLEA 3L3CA 2KN7A 1WTBA 3PM9A 3THTA 2W7AA 3LQVA 5U47A 4IR1A 4WFZA 1N54B 1U8WA 5GAEU 5ETVA 5A8WB 4LT6A 3R0DA 2LDIA 4M1KA 3GV7B 2WSFC 3K58A 1U2CA 3GV5B 2DT9A 3KLEA 2E7WA 2ILYA 1NPKA 1K70A 3GU0A 3R1HA 2R7SA 1HYSB 1BPYA 5EOZA 3G8TA 1QUPA 2AH5A 3M2RB 4PYDA 5J2NA 3PSIA 1IVZA 3OW2R 1Q7YT 2R7UA 3QSIA 4OZ0A 2OELA 3RR7A 4G3IA 1P27B 4I2QB 1F5SA 3Q22A 4RQ1A 3C16B 5AJ3F 3J7YI 4E2FB 1HA1A 1N62A 3PW4A 4AL6A 1N33F 3MGJA 5D4NA 2B8PA 4DR6J 3AU6A 1HD0A 4NWIA 2I5HA 3NS1A 3PZPA 4IFYB 5RUBA 4F3QA 1FWFC 4UOCA 4J9UE 3HSJA 5J0TA 5IWAJ 3R5BA 3BGUA 4CQDA 2H3QA 2DWQA 3TANA 3FBCA 3VWSA 1NH7A 2AX1A 3MTJA 5GADU 4CQ1A 2UXBF 4JV0A 4CGZA 3ZZYA 1TQLA 1QSSA 1X5TA 2V8GA 3H5YA 3VAMA 3H8SA 4MT1A 1C0TA 2QB0A 5ALVA 3T1AA 5D8HB 1RGVA 3KKAA 3GIQA 1TK0A 2MKIA 1JMTA 1KVKA 2X1BA 1B99A 2E3TA 2ZIUB 2VUNA 4DV6J 2WSEC 3BQ2A 2PMZC 1F3FA 1JLAA 1TV9A 1S1VB 1S9GB 3MTKA 4XTTA 1Q78A 2CQGA 1UWBB 4Y2MA 4GC6A 4B3OB 4QOTA 4FF4A 4AE5A 1NFGA 2MLXA 3TJ9A 4OYWA 4K0KJ 3D7SB 2DH7A 2GAGC 3UCGA 1S9EB 2F9DA 2QMUB 2CJAA 2WBMA 2F4VJ 4ED2A 4KR0B 3ILIA 3Q8VA 2MQ8A 3ZZ0A 5JJBA 4DYKA 3G86A 3Q2SC 2A3JA 2EFOA 1RTIA 1RHKB 3KNGA 3VVUA 8ICRA 1RT4A 4LH8A 5HSPA 2OGUA 4CLKA 4N8OA 3KJQB 4PRFA 2FE9A 2HWTA 2ZHBA 3DYAA 1J2NA 3MM5B 3FC9A 5K8NA 1FFWB 4DOZA 2KJ9A 2ALYB 2FIUA 4DUYF 1FD2A 3ENQA 2VOOA 2K8CB 2IHNA 3GU3A 3TA1A 3C14A 2RHSB 2JEFA 1YZ7A 1H7XA 2PMHA 2UXCJ 3CD6S 2A6MA 1AZSA 2ZUBA 3AB4B 3QO9B 2FPMA 3ILLA 4KLLA 4F4WA 1SZPA 3HJEA 1RXVA 2EFPA 1F5AA 1Z2ZA 4MJKA 2EAMA 4KB7A 1KP6A 4X5VA 5T7LA 4DQIA 3VZHA 2XZWA 2R8JA 3R8YA 2GX8A 3W66A 5G0RA 4ZPAA 2AZ1A 2BKOA 1S77D 3BYPA 3CJRA 3VALA 3I31A 3FSYA 1HNIB 5J2AA 3SSSA 4C4TA 2W8KA 4ECQA 2V94A 1JJ2R 3VF0B 1RAFB 3CCMS 4OJPA 1I3OB 1X40A 2YKAA 3SFUA 3P5TL 2CNLB 2IYGA 2NPFA 3NG8A 2HVIA 2OTJS 2MYFA 2G0AA 3QJLA 4E0DA 2ATCB 2HGLA 2RIJA 3M9OB 2XMAA 5KNIA 4DR1J 3EZOA 1REVB 2HS4A 2V4JB 1LW0A 3BV8A 2E9RX 2WONA 1VLYA 5M2UA 3OL9A 3UFCX 1SJFA 3D28A 2GW8A 4PG8A 2A0FB 4F5RA 2HSEB 2EKNA 3BS7A 4UW9A 4NLPA 5L9XA 2M8DB 4O0IA 9ICWA 2DNPA 4DEZA 1N61A 4K4IA 4WTOB 4P9SA 3UMGA 4MEXA 2DR7A 4K50A 1UVLA 5AE1A 1FWAC 3LP1A 1Q5YA 3MDCA 3AD7C 9ICUA 2VFTA 4WP3A 3A8IA 2HNZB 5CYMA 2W4DA 4RNMA 2VONA 3HSGA 4FYXB 3B9JA 4OCZA 3AUOA 2RUGA 4UAZA 1FF2A 3MEGB 5THWA 5KFRA 3MR5A 1FWKA 4RT2A 2QLJB 2BOPA 3S6EA 3BQ0A 2QKQA 4J9LA 1S6PA 3KOOA 1RWNB 2AQVA 2A18A 2P35A 3UDCA 2H48B 3R9KA 5EE1A 2EC2A 5IOLA 3B54A 9ICVA 4P75A 2FYXA 3OQ2A 8ICBA 1LKYB 3K1RB 3IDWA 4DSKA 4EX6A 3MPDA 1RAAB 2IA0A 2D9PA 3CE8A 2RQKA 5EX3A 1HARA 4NCGB 3BBBA 8ICVA 1GMWD 2MY8A 3DRPA 2DL0A 1DLOB 5M2PA 3C21A 4QW9A 3I4PA 2ZH9A 5FD1A 1UMJA 2IOHA 3LAMA 4HI2A 3TZWA 1SH3A 2CPIA 4RQ5A 3IV8A 1MC8A 2M3DA 4KHPJ 1R31A 1NK0A 4TQSA 3NEKA 3OTEA 5AK3A 2CQ3A 1NI3A 4X65J 4B3SJ 4CIOA 3UE2A 2CDQA 4F3MA 3D6TB 1XJWB 3OVAA 2XO7A 2DNHA 3FEZA 4JOUA 3T5LA 3PYFA 2ZBPA 2DEIA 2XB2D 3CJ8A 2YKNB 4CH7A 1K0TA 3MC1A 4Q8FA 2LM4A 3UMCA 9ICIA 1R9ZA 1JLCA 3EVMA 3CJ3A 2MUTA 4NEYA 3M6KA 3SSRA 4NRTA 1Q82T 4YMMA 4A8YA 2OOFA 3VZIA 2DCLA 2LMRA 5L1JA 2M0NA 4O5EA 2G9OA 8ICSA 4BJQA 2R3VA 4C8OA 1BHNA 2LEPA 2NXEA 2E9ZA 3CB4A 4I6YA 2G07A 2OPRA 2HBJA 2XGQA 1ITPA 3KDOA 5J0PA 3E51A 1QQ6A 4OJHA 5D0EA 1XMOF 5L39A 3FEYB 4UUXA 1ZYQA 2DGQA 3NVWA 1HNXJ 3TZZA 1HD1A 3KHGA 4PWDA 4B08A 4FXVA 4HHHA 3A13A 4LFAJ 7ICJA 1GKRA 1R8CA 2H4YB 3JSYA 3OT9A 3FJ2A 4K8RA 3KUGA 5HROB 1F9EB 3ITHB 3S1TA 3ZFVA 3Q23A 2MMYA 4DR6F 3GILA 3QLHB 3TFSA 1VJWA 3IN5A 4PXCA 8ICNA 2JVOA 2RLTA 1KWMA 4BLGA 2DXFA 5AM1A 5DBCA 4QWAA 4KAIA 5DDPC 4TU9A 4KMUA 5IWAF 4YR3A 3GONA 1EP4A 1XTZA 4I67A 3DLEA 4ELVA 5KFJA 5IT9Y 3DU5A 3E2EA 2ZTEA 4WJBA 3QGGA 5J2MA 4X4TA 1VMBA 3W8GA 4DV6F 7ICEA 2W2PP 5AI8A 5HMZA 1ZA1B 2ZJ8A 5A6WA 2GFFA 3U27A 2R9LA 4AQLA 3AFGA 5ETTA 5KFMA 7ICPA 4DFJA 1HQEB 3FRZA 3MCNA 3EGWB 3K4GA 1NPPA 2M2BA 5ETMA 2XYGB 2JGAA 1ZQFA 1OPZA 4K0KF 3MECB 4L73A 1HBNB 1N34J 1EF2A 3UDLA 3NS6A 3NCQA 2VDHA 3DMJB 3V6KA 3IS9B 2IOFA 2XTJP 2RMLA 3BDEA 2ZIWA 1KBRA 1FESA 2LM1A 3OL7A 1L3TA 2ZDOA 4QR2A 5AIAA 3PO5A 1TUGB 1RKIA 1ZM9A 4DX5A 3DRXA 3MMBB 1DY3A 5ALYA 1ZTTA 1HBMB 3NUQA 3G77A 3ZNUA 5DQHA 2IDEA 2P8IA 3M6VA 3M6ZA 1Y0HA 2XLJA 3E74A 3TO8A 1JJHA 4USTA 3NCPA 1XS9D 2VBXA 4O23A 1DAXA 3QRQA 3KK2B 4KHMA 5K14B 4KX3A 2KXHA 3HFZB 1H3DA 4NMXA 3K17A 4DL4A 5C25A 3H5SA 1HI8A 5KFHA 4IG3A 2YTCA 3SQIA 4XDDA 2ZD1A 2UXCF 3EGJA 2I1RA 2UVWA 1JLBA 5JVGQ 1RT2A 3S01A 3A0BU 5D4PA 2BM0A 5ADZA 2BE7D 9ICMA 2FJBB 2PKEA 2W01A 1FXRA 2PFDA 1GXUA 3HRDD 3CRXA 2E9TA 1JNRB 1RE1B 1HR0F 1RWOB 2L9NA 4NOHA 3I55S 3M32B 1M5SA 3SR6A 4TU7A 3O7UA 1A77A 3GDXA 1X4EA 3MAHA 4ER8A 4DQQA 1TR0A 1WUDA 2PA8D 4ZVQB 3HO1A 1NKBA 3B4MA 4I7FA 4B9MA 1GXLA 4Z7CA 2QLWA 4YEAA 1RWXB 3IRWP 3NMAA 1O6XA 4MF2A 1ZQEA 1PVQA 5AXMA 4K59A 4KTQA 2XS7A 3MPWA 3C15A 1UETA 4UB1A 1RBAA 5HMEA 4DR1F 4RBVA 1U1LA 4P52A 1TKTB 3V7LA 2ROGA 2DRBA 9ICFA 4DFKA 8ICHA 3VTIA 5HN0A 3AB2B 5AM2A 2ALZA 1BE4A 2DNYA 1JXVA 1HBUB 4HDGA 1V3ZA 2QFIA 3TA0A 3CD5A 4I2PA 2IYIA 1YQHA 1C1BA 1C2PA 2MZQA 2FB0A 4DJBA 5K4LA 1ZQDA 3K5NA 1YJVA 4WKRA 2NZCA 2PAJA 1X7VA 2GMLA 2EAOA 3QAEA 4IG0A 1S49A 4A46A 5IIIA 3IR5B 4IQMA 5ETKA 3MOJB 1ZQOA 1NK4A 2HQGA 1FX2A 2KKHA 4NLRA 1R43A 1S1XB 3J81U 4ZPTR 2ZDPA 3VAIA 2XLIA 3CJ2A 5ALLA 2XQCA 5HBMB 1P1TA 4PL2A 2M88A 3DRSA 1DOQA 5DB7A 9ICEA 3LWMA 4RW7B 1CQNA 1FWLA 3NQBA 3Q8PB 3J80U 1B64A 1NKEA 4ZVFA 3BH6B 2H5IB 1QAYA 4IQUA 4RKUC 2AD9A 5L46A 5I42B 4XO0A 3KJVB 2ZHOA 4P2SA 4LQ9A 3SCJE 4IOCQ 3HSDA 1R6VA 3UVJB 1YJRA 1C1CA 1JI7A 5ALNA 4RW9B 1WWUA 3KZXA 1S72S 5EE9A 4EPDC 3IAM9 5CD4H 2MSTA 4LSLB 5AM0A 2DGOA 4USJC 1KLMA 2CFXA 1ZM4A 3QU4A 2RF2B 5CZVA 4YUDA 2BRLA 2PMZD 1B0XA 4TUPA 4I29A 4NCAA 2F63A 2DH9A 4ED4A 1WACA 3BQ7A 5CB1A 4PXDA 5LJ3Y 4NYOA 2AW0A 4KHPF 1IJFB 1NEEA 1N52B 1EETB 4C48A 2CADA 4RUCA 2PFFB 4L3KA 2QMXA 2MZSA 2FLNA 4CLYA 1RTDB 1VC0A 1FNOA 5EE0A 3WKBA 4X65F 4B3SF 3UN5A 3VAFA 2HNDA 9ICOA 1CS4A 2MSNA 4RW4A 1ZPVA 3RZAA 2AQ4A 1L7MA 2ICSA 4Y6IA 1XSLA 3SQGB 9ICPA 4LF5J 4CLWA 1IKYB 3DKDA 3VGSA 3WK5A 2DY1A 3NGKA 2E8OA 1FJCA 3NGRA 3H0RB 2DR5A 3HVWA 1IKWB 1S6OA 2GNKA 4OQJA 1LWCB 3T5JA 4CNQA 4DS4A 2BACA 1OY9A 4NLVA 5BR8J 3V4IA 2RS2A 1F6TA 2FHJD 4F50A 3H2LA 4I2HA 5DRKA 3VAKA 2JJ4D 4MKYA 3UN3A 4ZDNA 3KWMA 4I0WA 5I3UB 5HMDA 4NLYA 2KHVA 2Y9HA 1KQKA 2PE8A 2E7XA 4NY8A 5TZVA 1HNXF 2W2OP 2E5LJ 2KSOA 4O9MA 3SBMA 4CQCA 2GO9A 2KYZA 2AF6A 1X6JA 3R3TA 1TL3A 1UP1A 2BJEA 4LFAF 1SB3C 1TAQA 4EP8C 2DXEA 1HQUA 1YJ7A 4CRJA 1U1OA 1PBAA 5J0XA 5E3RA 4FXWA 3U02A 3NAHA 4KE5A 2UVUA 1FWGC 2MQLA 1F9FA 4PG4A 3R5GA 3ULHA 2YMLA 5KG7A 1UVMA 4H4KA 2W7OA 1PK1A 4X4PA 2N7CA 2V9KA 2FUG9 2Z30B 3DDIA 3HP6A 3GFYA 1Q8BA 2HMIB 1J5OB 2KHCA 3D3CJ 4OZLA 5JTIA 4ECVA 2Z56B 4C11A 9ICHA 3P3DA 4HH1A 4UBBA 1S12A 5HP1A 1WEYA 4WPAA 4KLJA 1I1GA 3PW0A 1IQTA 4F0MA 4G1QA 2Y1IA 3MM7A 2DIVA 4F5OA 3L95X 3HHLA 4ICLA 1B4SA 2Z2ZA 4P0PB 1YHQS 4LRDA 8ICIA 3EVWA 4PWWA 2EZYA 1ZETA 3BGRA 2E1RA 3GLJA 2JEIA 5KOXA 2PEHA 3RJFA 4NLGA 3QEBZ 3RJIA 5CD4A 4FE3A 1H2TZ 3ZTSA 1N34F 2CQPA 3M05A 1KNZA 4OIXA 2OGJA 4ZN3A 3KFUF 4DBQA 3VQSA 8ICEA 3H7HB 1X4CA 2R2UA 2PC6A 1VK3A 2ZJ5A 4U8VA 4JV5J 3OR2A 2XSJB 2CQ2A 3KK3B 1FVQA 5ALSA 1TAMA 4YS2A 5KFPA 4NI2B 3CDAA 2MXYA 3JAMU 4KGKA 7ICOA 1FK9B 4KY3A 5AKXA 2ZNYA 3D68A 3R6LB 1RDFA 2UV8G 4RQMA 3G8QA 3GIRA 4G7EA 3CNHA 2VFUA 3M8RA 5DDMA 5BXIA 3BN7A 2E1PA 3PIOQ 3U26A 4H9MA 2IFXA 2C2OB 2JVRA 2IVMA 2KE7A 4KLUA 5AM3A 4DN0A 3EZ5A 2ZNZA 1RU1A 4NL9A 4B9TA 1JLEA 4U96A 4ZLLA 3PYGA 2LVWA 3QATA 1S6QB 4AT1B 4M95A 3AOCA 3MPGA 3I28A 5SUHA 3MUVP 3MMCB 4M5GA 4GXKA 3C5GA 3BPSP 2RVJA 1UW4A 3I0RA 1S10A 3BN4A 4I2IA 4PG7A 5KFXA 3JSBA 2HRYA 1OY6A 3CJ5A 2MZ1A 2W25A 4F0SA 2HIYA 4URGA 4FF3A 2GVDA 4H4OB 2OODA 4ZJLA 4P7TA 1N5TA 3KHLA 4J9QA 1D1UA 4EWTA 2MGZB 2OHFA 3Q8UA 2VUGA 4ZMMA 3AODA 3UI3A 2GJFA 4PZVA 2V6AA 2OD4A 2COLA 1SL1A 2QYGA 3IO1A 4WFBQ 1XIQA 3QU7A 3N2CA 3TI0A 1SB6A 4RUAA 2WHOA 3MUMP 3A0HU 4EX7A 4DMZA 3BS5A 4ITSA 1Y3JA 1HMVB 1EJWC 3HM9A 1OSDA 1RTZA 4C4RA 2V2QA 2RAQA 5EX0A 2ISPA 5A2QY 1HNVA 1UZHA 4CH1A 2D8CA 4PUOA 3S8SA 2HRTA 2AJFE 2AGQA 2HPUA 5K20B 1GMWA 3D6MB 1U6ZA 2MRLA 4C0BA 1U49A 1XRTA 3TUIC 3MM6B 1VLBA 3CF5Q 2G1DA 4CNYA 2G06A 1C7YA 1A5LC 2OPSB 5AE2A 3DRRB 2H9ZA 2BXJA 2MQNA 3KLFA 1WEXA 3IFEA 4USKA 1P7DA 5L1LA 1SXDA 4EGLA 2N3LA 3IM1A 2HIQA 3C1ZA 3Q8YA 3I0SA 5AI0A 1NB2A 2VFVA 1VQNS 2KICA 2EEYA 3PW5A 2XYPB 1K9MT 3CSKA 4ZVUB 1BPEA 2XWXA 2J0QD 1KHVA 3TX8A 5DQGA 4JI6J 1Y9OA 3L4BC 4UBCA 2DGSA 4KPCA 3OPKA 5BJRA 5KFQA 4HACA 1SGGA 4N77A 1PVPA 2ASLA 1CJKA 3KZIU 4ZVRB 3GJSB 9ICCA 4JI1J 5C24A 3C6UB 3T79A 4NXMJ 1FERA 2E1CA 4UASA 3TVYA 2AEFA 2YBVA 2W55A 1R8HA 3PSPA 4C98A 2Z2LA 4LF6F 2AIRB 1SC3B 2B9EA 2W2QP 2X3GA 3RBZA 3QGAC 3W2VB 4CT8A 4HTJA 1H73A 3D0HE 2DHHA 3OR1B 2KYXA 1L8OA 2RKIA 3CULA 3ZO7A 1O51A 4JI4J 2IMOA 3R2CJ 4K4YA 2B9XA 3D4JA 1PCAA 5J1EA 2VHLA 2K4EA 2HQDA 2PFOA 3F73A 4ALZA 1FFGB 4Y0FA 2BANA 2FD2A 4M9NA 5AT1B 4DZHA 4CDGA 1SVDA 3N7SC 1FEHA 5AK5A 4OJ1A 2HK3A 2HWIA 1Q3VA 1Y5IB 2ISOA 4DSEA 4LF5F 4OI1A 2Z2YB 2ESEA 3EDRB 2HS3A 2IA6A 3MDUA 3MBYA 2V69A 3KK1B 1KCXA 4ENOA 1KTVA 2P6TA 3KKAC 2J6TA 2ZXHA 4IRDA 4R88A 2VH7A 1TE2A 4ES3A 2HI0