1IM4A

Crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
205
Chain Sequence
HHHHHIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DBH
publication title Crystal structure of a DinB lesion bypass DNA polymerase catalytic fragment reveals a classic polymerase catalytic domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 63
structure length 205
sequence length 209
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1im4A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 1im4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1im4A01
3RB3A 1S0VA 4HKQA 3KTQA 4JK1A 7ICJA 3H8SA 5KT7A 3UPFA 3MGIA 3KHRA 4M2YA 1S48A 2XCPA 2MUTB 3UXPA 2W9MA 4M6WA 3V6KA 2ISPA 4NLDA 2GWSA 3RR8A 4NLZA 3KK3A 1HYSB 4G1QB 3T3FA 1Z4UA 4TQRA 1T05B 4Z6DA 5DG7A 1QSSA 1ZQDA 1ZQSA 1JLEB 4ZP6A 1RT2B 2PFQA 1KFDA 4IR9A 1KLMB 1S0OA 4P4OA 3ZDAA 2C2EA 3JPPA 3PX6A 4KHMA 1ZQCA 3MDAA 4ED2A 2AX1A 1MU2A 1WCLA 1C0UB 2UVUA 1UT5A 2WOMA 3GILA 2UUTA 3CDEA 2YKMA 3LALA 8ICEA 2R8KA 3QGGA 3CWJA 2BHNA 4RW8B 5HNKA 5KT2A 4UAYA 1NJZA 1S97A 9ICAA 3BSCA 1RT5A 4ECTA 2JEGA 1RTJB 4XO0A 1RT1A 5KT4A 4DSEA 3KK1A 4B3OA 1RT6A 3SFGA 3V4IB 5EUHA 3KJVB 5C24B 3Q8QB 2FVCA 4ECXA 2D41A 3PR4A 4RPZA 4KLHA 5KFKA 4M9HA 5D4BA 3MEEB 4I2FA 4I2JA 4DWIA 1N6QA 3KLIA 4MEYA 3LP2B 1XSPA 2W8LA 4KLQA 1TV6B 1JXEA 4PHDA 2IA6A 4DSFA 1A76A 3PV8A 3UDLA 4MIAA 4NLPA 1RT3B 1KHVA 4RW4A 5KFRA 3DRRB 1N5YA 3LP0A 5J2NA 2IAJB 4KN4A 4QZ9A 2JZBB 3H4BA 4KITB 4ECSA 3KLFB 1RT4A 1FKOA 9ICRA 4WE1B 1HQUA 1CEZA 5C25B 2VG7A 4MFAA 3KLGB 3MFHA 8ICFA 4DS5A 4Y34A 2CJQA 2O5DA 2AGOA 1NHUA 3V6DB 3KMSA 4YMEA 2JEIA 3PW5A 3DLKB 1KSPA 4X5VA 1S1VB 1DTTA 1UA0A 4R65A 4M9GA 9ICPA 2HNDB 5KT3A 3N97B 3CDWA 8ICXA 4RNFA 4G3IA 4K4IA 4TYBA 2OWOA 1RDRA 3KHGA 4ECVA 1RA6A 5DGBA 5KFZA 4YXJA 5K14A 2FPKA 5DBBA 4RQ1A 2XC9A 4UQGA 3PO5A 1TK5A 2W9CA 1TKXA 9ICGA 3H8WA 5F8LA 2BRLA 2YNGB 3UQ2A 4Q8FA 3PVXA 1Z00A 4H4OA 3E2EA 2OPPB 2VG6B 2CKWA 5EDWA 4HYKA 2HNYB 2KFNA 2FMSA 1GX5A 2OPQA 4R0EA 7ICRA 2WHOA 7ICTA 3PX0A 9ICEA 5J1EA 2DFLA 9ICXA 4BGDA 1NKCA 2BQ3A 1SKSA 4Q45A 4RQ2A 3DLEA 3FFIA 5DQIA 1VRTA 4I2PB 3B0XA 5KFLA 1S1WB 3IHQB 1UT8A 4ZHRB 5KG4A 5J0UA 3KLHA 3NTUA 2ASJA 4ICLA 3DRPB 1KRPA 5J0YA 1A77A 3BSAA 2IM1A 3AU6A 1NK6A 3ITHA 4QWEA 1IKWB 4ZPDA 3EYZA 1S1UA 3B0YA 1SL1A 4IH7A 3KK2B 4P2HA 1EP4B 1HMVB 3KMQA 3H7IA 4DO9A 2B43A 3ISDA 4M95A 3IM1A 2F1HA 1VRUB 1T03B 2MUTA 4K4XA 1BPEA 4XUSA 2AU0A 3IS9B 4K4UA 1HYSA 2ASDA 1JN3A 1T05A 3HVTA 2HHXA 1JLEA 3TFSA 4EO6A 1RT2A 5I42B 3DYAB 3LP1B 3BREA 5IIMA 3RJFA 1RXVA 3C2LA 2R2SA 4F8RA 2ZTEA 1N4LA 3DOKB 1C0UA 4K4YA 5D46A 1S0NA 4RT2A 3V6HA 5J0SA 1NJXA 1XR7A 3NL0A 2YKNB 4LZDA 4KLOA 2W8KA 3IRXB 3MR3A 4DSJA 4RW8A 4I29A 4O3OA 2R8JA 5DQGA 5HHIA 1LB2B 4O4RA 1LWEB 4I2EA 4FBTA 1KEJA 2C2DA 2E9RX 1LWCB 1RTJA 4LZGA 2MAXA 1XS9D 2WONB 3PR5B 1R0AB 2XI3A 3V4IA 1CUKA 9ICLA 2W7OA 5C24A 3KJVA 1W25A 1LV5A 3MEEA 4IRDA 4DSKA 2W7PA 4KLTA 4YD2A 3C1YA 1TK8A 3LP2A 1NK0A 3GIIA 4YVZA 1ZQYA 1NK8A 1RTHB 5DB7A 1TV6A 5DDMA 3HP6A 2VG5B 4NLUA 3RAQA 1C1CB 4O3NA 3I5CA 1IXRA 1L3TA 2BANB 1RT3A 1ZJMA 4O9MA 2HWIA 4XPCA 2A1JB 4RNMA 3DRRA 4ID5B 9ICWA 5EWGA 2IAJA 2JZBA 3KLFA 3SFUA 4Y2CA 4WE1A 8ICQA 5C25A 1SKWA 4O3QA 4IFVB 2V4QA 7ICOA 5HMLA 3BJYA 2NRZA 4U6PA 4Z6EA 3V6DA 7ICVA 1ZQUA 1NJYA 1S0MA 4ECRA 3DLKA 2NRWA 1S1VA 1JIHA 1S76D 3H40A 4XA5A 2HNDA 2RKIB 3RRHA 4QZ8A 2LYHA 4K4GA 1QAJA 3QGHA 4ED6A 3D28A 1JLBB 4DQPA 1JLFB 1TL3B 3SYZA 3EWAA 4B9UA 3OL9A 1XU4A 5KFVA 1ZQGA 1C1BB 4TQSA 8ICVA 3N6NA 3DDKA 5DLFA 3QLHB 1MC8A 4RQ8A 4ZPBA 4MEXA 1HNVB 1COOA 4IG0B 4IH6A 2OPPA 2VG6A 4I7FB 1B22A 5J2MB 3SI8A 2IC3A 4WZQA 3GIMA 1N48A 2FVQA 5KFOA 5D3GB 2FPLA 2IHMA 5JXSA 1T3NA 4EBDA 1ZQOA 2FVSA 5CYMB 5J2FA 2YNIB 2ATLA 8ICMA 2HWHA 4NLVA 5DBCA 3QIPB 1T8EA 5L1IA 1ZQHA 1S1WA 1HQEB 4F5RA 1S77D 3DRPA 5L1LA 4H4MB 4XQ8A 4IQWA 1IKWA 4IKAA 7ICPA 4Q43A 5CR0A 3LANA 2BKEA 2RF2B 3EW9A 4FS2A 2BCRA 3RB6A 4NLSA 3H98A 3C6TB 3DLGB 3KK2A 4B9MA 1EP4A 1HMVA 3PO4A 4RQ3A 4K50A 5EWFA 5J0XA 2ZJAA 4IDKB 1VRUA 4DLEA 3PMNA 1RTIB 9ICCA 5KFAA 4J9NA 3IS9A 1LW2B 8ICBA 3MGHA 4I2AA 3K4GA 4UB2A 5TZVA 4C8MA 1Z3EB 5J0RA 3NAHA 3RRGA 3NGDA 4B9LA 4NLTA 3TAQA 5I42A 9ICFA 5KFEA 3DYAA 3LP1A 5F8IA 3E01B 3RJJA 1TKDA 3ORYA 4DS4A 1ZJNA 2IM3A 2D3ZA 4C8KA 1SKRA 2BCUA 4F4XA 7ICHA 3CJ3A 3DOKA 1K1QA 7ICNA 4KO0A 5J2KA 2AGPA 2BPCA 4ECYA 4ZVGA 2F8EX 3CJ4A 3BQ0A 2YKNA 3H5XA 8ICOA 3G86A 1ZQQA 5DB8A 1UA1A 4ED1A 1LWEA 1I6JA 2B5JB 4QZHA 3RTVA 4O3PA 3ISCA 3TFRA 1JKHB 4NLKA 4KLSA 1LWCA 4PQUB 3JSMB 3MR6A 1NK7A 4F93B 2IJFA 4TUSA 3HKWA 1R0AA 1QTMA 2ZJ5A 5IIIA 4QZAA 1ZQIA 3N4MB 1QUVA 2V0NA 5DDYA 4MFBB 1NK9A 4Z6CA 3CIZA 1QE1A 4NCGB 4F4KA 1FK9B 1TQLA 3BSOA 1KHWA 4KSEB 2ZTDA 9ICVA 2IM2A 3JPNA 5J2HA 1SZPA 4IRCA 4EYIB 4KLUA 4QWDA 1RTHA 4PGYA 3ETLA 4IQVA 5J2CA 2V4RA 3ZDCA 4YXMA 2HNZB 2VG5A 4F5OA 4I27A 1C1CA 4MF2A 2PXIA 1RXWA 3QYYA 5DG9A 2BANA 4I2DA 3CO9A 4I2QB 1WNEA 3KLVA 5F8MA 4ID5A 3QE9Y 3ZDDA 2XO7A 2YNHB 5HHHA 4UB1A 4ED7A 4UBCA 3MR2A 1UWBB 4ELVA 4IFVA 1NKEA 5J2BA 1C7YA 3H8JA 4LSLB 4EYHB 2PFNA 3NKYA 1QAIA 4O4GB 4NM2A 3TAMB 4UB3A 1TK0A 3H4DA 1TAQA 2BPGA 5KG7A 1S1XB 1HUOA 3ICLA 4GXIA 9ICOA 4RW7B 1SV5B 2RKIA 4BWMA 3T5JA 2W9AA 1CSJA 5J2QB 2BCSA 3OLAA 4YG2A 2YNFB 3PX4A 4ZVHA 1JLBA 3C1ZA 1JLFA 7ICSA 4F2RA 4RNOA 1ZQLA 1TL3A 4RZRA 1C1BA 4P4MA 1D8YA 8ICUA 4O5KA 8ICKA 3MDCA 3QLHA 5F8GA 2D7SA 5DLGA 1HNVA 2F1IA 4IG0A 1MQ3A 2FLPA 4ELTA 2VA3A 1RTDB 1BPZA 4I7FA 2WRMA 1BQMA 5J2MA 5CYMA 5KFCA 2D3UA 4TLRA 5KFTA 1N56A 4TY9A 3IN5A 4GC6A 4QZFA 4IR1A 4DLGA 1XWLA 3BGRB 2B6AB 1JLQB 1HQEA 4RW9B 1JLCB 4RW6B 4F5NA 4H4MA 1MSWD 3OGUA 3RB4A 4RT3A 1S10A 5KT5A 3NBPB 5KFQA 2RF2A 4QZGA 2FMPA 2HMIB 1LWFB 3ZDBA 2BGWA 3C6TA 3GYNA 1NK4A 3DLGA 4TUQA 3HVAA 3SZ2A 2GIRA 5DB6A 4QWBA 3I0SB 5CHGA 4IDKA 4KAIA 4Z6FA 3H2LA 3HX0A 4PH5A 1RTIA 2Y1JA 2RDIA 1JMSA 1LW2A 4KV8B 3MEDB 1DGSA 4ECZA 4M9NA 3TI0A 5KFNA 5KFPA 5KG5A 2IMWP 3T1AA 1SH3A 3E01A 5C5JA 2E9TA 4WXOA 4YR0A 4B9VA 3JPOA 3JPSA 3TANA 1K1SA 3FYHA 3DM2B 4H54A 4R8UB 2UUWA 3M9OB 1BPYA 1MMLA 4FS1A 4MFFA 4Y3CA 3QZ7A 4TY8B 4MF8A 4YR2A 4KN7A 7ICKA 4DFKA 3RBEA 5DQHA 2B5JA 1S4FA 2FLNA 5CP2A 1JKHA 5KT6A 4C8OA 4EO8A 3BSNA 1L3VA 1RZTA 4PQUA 3JSMA 8ICWA 2R2TA 1ZQMA 4KTQA 4G1QA 4JV1A 4IQUA 4DL4A 2PI4A 4P4PA 5F8HA 1T7PA 4WYWA 1XR6A 4KBIA 4MFBA 3K75D 3PNCA 1KLMA 4NCGA 1U49A 2Y1IA 4BXOB 4EZ9A 4TN2A 4YMNA 5J29A 1FK9A 2JLEA 3BQ1A 4QWAA 3V7KA 3SV3A 1REVB 2R8IA 1BGXT 2R8HA 3GQCA 2UVRA 3JYTB 2R2RA 4I2CA 5HLFB 4I2GA 5KFMA 3QO9B 2FVPA 2GIQA 3FDSA 4WFZA 1SL0A 8ICSA 4NLXA 3OJSA 2HNZA 3OLBA 5F8NA 4IQTA 2BPFA 2PFOA 2WTFA 4J9MA 4KMUA 7ICGA 2W9BB 3RJHA 4YFKA 5KFGA 4Q0BB 3LAKA 2HHWA 1H38A 2AGQA 1YVFA 1BPBA 1BQNB 2BCQA 2YNHA 3KNAA 4WYLA 3UPQA 4GC7A 1X9SA 3N6MA 1UWBA 4WFXA 2HHTA 3HT3A 2NRVA 9ICNA 2QE5A 2XI2A 4LSLA 2I1QA 4URQU 3TARA 4J9QA 5KG3A 4F91B 4X2BA 4ZVEA 1U45A 4QWCA 4O4GA 3TAMA 1DLOB 3SV4A 1S1XA 4DSLA 2AWZA 4DF8A 4YR3A 4MIBA 3HW8A 4KLMA 4QW8A 1KDHA 1HPZB 1SV5A 1ZQFA 3BQ2A 4MH8A 4C8NA 9ICJA 1FKPB 4RNNA 5J2QA 2ZD1B 2YNFA 1S1TB 5KTQA 4Y2AA 1IKYB 4ZVFA 3C2MA 2KFZA 1TVRB 1D1UA 4DFJA 2H5XA 3DRSB 4UAWA 5CYQB 4QPXA 4NLOA 4LSNB 4B9TA 3KLGA 3LK9A 2FPMA 1RT1B 3H59A 1KFTA 4NLRA 1RTDA 2KTQA 1QLNA 1S9EB 4Q44A 1C2PA 5KFHA 4DOCA 4TURA 1ZQEA 2P6UA 1RT6B 1U4BA 5FDLB 5HP1B 1ZQWA 4JV2A 3C6UB 1TVAA 3I0RB 1GX6A 2B6AA 1JLQA 2XCAA 3LWLA 3UQSA 4YQWA 1BPXA 3C5GA 3C2KA 1B43A 2OPSB 3T19A 4I28A 4DL7A 4RW9A 1JLCA 4RPYA 4RW6A 5C42B 1N6QB 1S6PB 2P6RA 1EXNA 4QZEA 4NLYA 5KG0A 3G6XA 4NZ0A 3NBPA 3E51A 5BOMA 1RPLA 3ZD9A 5CJ7A 2HMIA 1LWFA 1JX4A 2YNGA 3IG1B 3DOLB 5CA7A 5KG2A 3RJGA 4EZ6A 3M8PB 8ICLA 4K4SA 4RW4B 5J0TA 3I0SA 2HNYA 4PGXA 1RT7B 1IKVB 3RJKA 3AU2A 1TV9A 4RQ5A 2AQ0A 3KHHA 1XR5A 3H5SA 3PJWA 2VG7B 4ELUA 4KV8A 4DEZA 2FLLA 3MEDA 5EOZA 4I2PA 3C5FA 3MTKA 3Q8LA 4ZHRA 5EWEA 4U7CA 4DL5A 2JEJA 1XC9A 3TVKA 1NJWA 3KLEB 4KLFA 2OPRB 3THVA 2WB4A 3D5MA 7ICFA 3DM2A 2XGQA 4M0AA 4KLEA 3H5UA 4R8UA 2P66A 3BQTA 4IFYB 2XY5A 4F50A 2HVIA 1U47A 4TUPA 2FMQA 4QZBA 4TY8A 2AQ4A 1JLAB 1V9PA 3OSNA 7ICQA 4F2SA 4F4WA 4M04A 4NLNA 4RQ4A 1T03A 4KB7A 3MEGB 3QZ8A 1JXLA 2ZTCA 3FQLA 4J9KA 5J2JA 4F5PA 4IH5A 2XY7A 2IBKA 2AX0A 4RUAA 4F92B 1EETB 4ZP7A 4KLLA 2UVWA 4B9SA 4DG1B 4ZMMA 4PPXA 4BXOA 2OPQB 1WCNA 5DB9A 4EBCA 1REVA 2DPJA 2GC8A 4NXZA 1ZQAA 4KHRA 5I3UB 5HLFA 3QO9A 4M9LA 1C0TB 5J0WA 1LW0B 3GFKB 3JPRA 2BR0A 1NK5A 1XO1A 4ECUA 3IRXA 3DI6B 1ZQRA 3RB0A 2V9WA 3PY8A 3M8SA 4JUZA 3PMLA 2W9BA 5CB1A 1S1UB 1ZETA 4Q0BA 4QZDA 2WONA 5J2IA 3GDXA 4LVSA 3OL8A 1L3UA 5J2GA 1BQNA 3EZUA 2ZJ8A 1S9GB 2WK4A 5KG1A 3UQ0A 3OHBA 2J6SA 3GV8B 7ICUA 1OS5A 2FVRA 4K4HA 4DQQA 2HHUA 1Y88A 4NY8A 4BDPA 1HUZA 4KLJA 3HVTB 1DLOA 4EBEA 3T5HA 4TYAA 3GV5B 1NHVA 4DQSA 4DQIA 3PHEA 1HPZA 5IIJA 2BE2B 4RNHA 4JWMA 4M94A 3EZ5A 1TKTB 3M9MB 4PHAA 1FKPA 2E9ZA 1TP7A 3OJUA 3MR5A 2ZD1A 1S1TA 4UB5A 1TKZB 1ZQXA 2A1JA 4MFCA 1IKYA 4NRTA 2F1JA 3UXOA 1RYSA 1TVRA 1RYRA 8ICGA 3Q8PB 3DRSA 5J2PB 5CYQA 3V6JA 2FJWA 2BQUA 4DL2A 4LSNA 4RQ7A 4O5EA 3RJEA 1KLNA 3Q8RB 1RA7A 4RU9A 1TL1B 1S9EA 2PFPA 4I2BA 2UVVA 4PUOB 1D9DA 5KFUA 4JV0A 5FDLA 5HP1A 1HNIB 2J6TA 3C6UA 3I0RA 2ZE2B 3C23A 4ZPAA 5IILA 5L1KA 2XGPA 7ICMA 3TAPA 2NRTA 2I9GA 2OPSA 4J9RA 2KZ3A 5C42A 2AJQA 9ICBA 3HPOA 3DMJB 1S6PA 8ICTA 5DBAA 2OH2A 2KZMA 5J0OA 1RAJA 5KFJA 9ICUA 1T4GA 9ICHA 4ZP9A 1U9LA 5IIKA 3T5LA 3BR9A 3IG1A 3DOLA 4YD1A 4I2IA 3M9NB 3M8PA 1X2IA 1ZTWA 5J0QA 4NLQA 3AUOA 4BWJA 4IG3B 2QV6A 5D3GA 3MFIA 4WZMA 1RT7A 2NRXA 1IKVA 4ED8A 2YNIA 3MECB 4C8LA 1NKBA 1DTQB 3QIPA 4O44B 8ICJA 3QEBZ 3CVKA 5DG8A 4KLDA 3C21A 3IGVA 4LQ9A 3PW4A 4KFBB 4F4YA 3EPGA 4MK8A 2BRKA 3KLEA 2OPRA 4O3RA 3M8QB 3OHAA 4IQXA 4O0IA 4FO6A 4PWDB 3V72A 4KLGA 4F5QA 3RH6A 2BCVA 4IFYA 9ICTA 7ICLA 5HROB 3VQSA 1JLAA 3LAMA 1T94A 9ICIA 1MQ2A 9ICKA 4WFYA 2FJVA 3BDPA 2XY6A 4DFMA 3MEGA 1ZQZA 8ICZA 8ICIA 4K4ZA 3G6VA 1JLGB 3IGNA 8ICHA 3JPTA 3PJXA 5KFXA 7ICIA 3OL6A 1SUQB 4NLGA 1S49A 2IHNA 1HARA 4PGQA 4NLWA 1EETA 1J5OB 2B21A 3JPQA 2R8GA 2IC3B 3RR7A 2R2UA 4DG1A 3CDUA 5DKWA 4ZH4A 5IINA 5BOLA 3V7LA 3FSIA 4QZIA 4UB4A 5I3UA 1IKXB 3Q8SB 4E0DA 1C0TA 1LW0A 2JC0A 3QIDA 2IJNA 4I2HA 4ED0A 5HMMA 1HJPA 5CWRA 4Q8EA 8ICAA 2VA2A 3DI6A 5HBMB 5J2DA 2C2RA 9ICMA 3Q8MA 4NYZA 2M9NA 4OL8A 4DQRA 5KG6A 2I5JB 2ZKUA 2KZZA 2WCXA 3PZPA 3GIKA 3M8RA 3KHLA 3ZD8A 5KFBA 1D8LA 4IRKA 4KE5A 1BPDA 5BPCA 1S9GA 4R63A 4R5PB 3ISBA 4PHPA 4NRUA 4KKOB 3ZDEA 4RQ6A 2BQRA 4ZPCA 4DSIA 1S6QB 5KFWA 4YCXA 2RDJA 3UXNA 8ICYA 4ECQA 5KFFA 3HHKA 3V81B 1D9FA 2VANA 4GLXA 4YP3A 2BE2A 1NNDA 1IM4A 3V7JA 3MF5A 1ZQKA 3ISNC 4QW9A 5HP4A 2HHQA 3CJ2A 1TKTA 1L5UA 5F9LA 1TKZA 4KO0B 4URGA 4GXKA 3CJ0A 4MK9A 4I2QA 4O5CA 5KFYA 5IIOA 3RH5A 4R66A 4YN4A 1ZQJA 3GIJA 4QZCA 4IOBA 5J2PA 2HHVA 3KOAA 1DOQA 1AROP 1SH2A 3RH4A 4MKAA 4M6WB 2HVHA 2EC0A 1L3SA 1TL1A 3KK3B 4UAZA 3OL7A 1ZQVA 5J0PA 4PUOA 1XSNA 1ZQPA 5L9XA 2HW3A 1HNIA 3PW2A 1ZQTA 1QE1B 4J9PA 2ZE2A 1KFSA 4RW7A 1D0EA 3H5YA 3N6LA 4J9OA 3Q8KA 1U48A 1MU2B 2BDPA 3DMJA 3T5KA 2ISOA 2J6UA 1PZNA 4K4VA 5JUMA 4RPXA 2WOMB 5D49A 2YKMB 4K4WA 3HWTA 3PW0A 9ICSA 8ICPA 4J9SA 1U09A 2JEFA 4XPEA 1XSLA 4DL6A 1RT5B 4J9LA 3G6YA 4DOAA 4LQ3A 5F8JA 4IG3A 3KK1B 4YMMA 4B3OB 8ICRA 4GXJA 4RQ0A 1ZQNA 4DF4A 3RAXA 1SH0A 3MECA 4K4TA 1ZYQA 1DTQA 4O44A 3BGRA 3EPIA 1QSYA 4KFBA 3NAIA 2KN7A 1KTQA 4M9JA 3KLIB 1SL2A 4F3OA 4TXSA 3M8QA 5L1JA 4NM1A 4PWDA 4R64A 4DFPA 2ILZA 2HHSA 3OSPA 5HROA 4O3SA 2ASLA 8ICCA 1S9FA 4RUCA 5DGAA 1N5YB 4URSA 4ZP8A 3LP0B 5J2NB 5J2EA 4DL3A 2DPIA 1JLGA 1RT4B 1FKOB 1HQUB 2IM0A 1SUQA 1X9MA 4YMOA 4UBBA 4MK7A 4FBUA 1J5OA 1BVSA 1BQMB 4DOBA 4M47A 3QGIA 2ILYA 4CCHA 3TQ1A 1NOMA 3I5AA 5KFIA 2PI5A 5KFSA 2ALZA 1DTTB 1X9WA 2Q0ZX 1IKXA 2VA8A 3I5BA 3FRZA 7ICEA 2XWYA 1TAUA 1ZQBA 3HVWA 3MBYA 5J2AA 5HBMA 5K14B 2HAIA 2JC1A 3RJIA 2W9CB 3PW7A 1TKXB 2I1RA 2I5JA 4F4ZA 4KLIA 4WXWA 4EEYA 1QSLA 3LDAA 1Z00B 4H4OB 4B9NA 3CJ5A 4R5PA 4MKBA 3RBDA 5F9NA 4KKOA 3NMAA 5J1EB 2C22A 2ZUCA 8ICNA 1S6QA 3JYTA 1TFRA 3MABA 3DLEB 1VRTB 3FFIB 2C28A 4JWNA 4XRHA 3V81A 3KLHB 4ED3A 4ICLB 3ISND 3UR0A 3FQKA 4ECWA 3QEAZ 9ICQA 2ZUDA 5T14A 4PHEA 3GV7B 3ITHB 2FJXA 3LWMA 5KFDA 2ZUBA 1ZTTA
chains in the Genus database with same CATH superfamily
2HHHF 2JGAA 2UXCF 1UPMB 5HVHA 2C42A 1BQXA 4JK1A 3AY0A 4X4QA 1KRBC 5KT7A 4FYWB 4DPXA 4M5JA 3CPWR 3SCKE 2X51A 3V6KA 4I6YA 1U26A 3MM8B 4DR4J 3KK3A 4OJOA 1YBUA 4FYYB 4P2FA 3T3FA 1Z4UA 3K1RB 4TQRA 4Z6DA 4RKUC 2SXLA 4IR9A 3DU6A 5CABA 3MUMP 1EJWC 1S0OA 1H7WA 5AKIA 3JPPA 4KHPF 2AZ1A 3GJQB 4ZPWR 1N5XA 2QFIA 3Q2TC 1C0UB 1YWXA 1KQSR 4LF5J 3GILA 3T41A 2UUTA 3CDEA 1KCXA 2JXJA 3LALA 2WB1C 4E2FB 5HNKA 4A8MP 2QT7A 3JSBA 4UAYA 2NUHA 4EWTA 4ACOA 1S97A 4OJGA 2QL7B 1NZ8A 2RRAA 1MNEA 2V4JA 5B0AA 4CLKA 2OEHA 3VAKA 1FWHC 2W03A 5K20B 4C0BA 1RT6A 2H5JB 3SFGA 2RT3A 4RZBA 4ZCMA 5EUHA 4Q2LA 3ELHA 3L7UA 1X5PA 4JV5F 4KLHA 5KFKA 1H3DA 1SIJA 1Z1ZA 1ZH5A 4NWIA 2RUGA 2GJIA 3C3LA 2F8MA 2CA9A 2ZIXB 2W8LA 1UHUA 2IA6A 2MGZB 2AQOA 5DZ7A 1FXLA 2NXEA 3SQIA 1RWVB 1NB7A 1F0XA 3HPAA 4X4OA 3A1YG 2IY5B 2DF4B 5THWA 2P9GA 2ZH8A 4KN4A 4QZ9A 3H4BA 3KLFB 4CM2A 4A8XA 1HQUA 1CEZA 2G06A 3KLGB 4OJ5A 3MFHA 2HK2A 2CPXA 4AXIA 2CJQA 4C5ZA 4CO0A 5HK4A 2HBLA 1NHUA 3KMSA 4YMEA 3H2UB 4FXVA 3P4UB 3PW5A 3A12A 2F76X 2G4BA 4KQNA 2UV8A 3SMZA 3K2YA 3R9KA 4UZBA 4M9GA 1S5ZA 1E6YA 5J1NA 4FKYA 3BR8A 4G3IA 4K4IA 2CNKB 1RDRA 3GFHA 5DGBA 2VOOA 2GHVC 2VUNA 4C4TA 5K14A 4W98A 3H20A 3MURP 4IC9A 2DBYA 2W9CA 1TKXA 9ICGA 2MQNA 1RQLA 2FZKB 1GMVA 1FTCA 5F8LA 3CC4S 2BRLA 3KDNA 1QDUB 3TQEA 5HMXA 4CQCA 3IC1A 3PVXA 1SXDA 2OPPB 2CKWA 4HYKA 1GX5A 1IBMF 3HO1A 2VV5A 2EZYA 2WHOA 3PX0A 1MW7A 1AYEA 5J1EA 9ICXA 2UV8G 3AB4B 2WAQC 4Q45A 3CD7A 2HBMA 3FFIA 4I2PB 2KNJA 1VR6A 1S1WB 4C3LA 1N63A 4AD6A 5KG4A 1K70A 2RB7A 3KLHA 1FFGB 5J0YA 1HHSA 1NDCA 4DR3F 3ITHA 2MLZA 4NXNJ 5ALHA 2V68A 1REGX 1E9YB 4P7TA 1QAYA 2CWKA 1ZD5A 3I9V9 4KGMA 2CDRB 2MQ8A 5B0CA 3KK2B 4P2HA 1EP4B 1NM2A 3OV7A 3OT9A 2BYCA 2ZVIA 1T3OA 4PRFA 1BPEA 1RWNB 1JN3A 3THTA 3CC7S 3HVTA 5T7LB 5F3ZA 4UZCA 1HW9A 1MMDA 3I55S 5JU5A 3HJFA 4AYBC 1YRRA 3RJFA 1RXVA 5ETSA 1C0UA 1S0NA 1Y5LB 2KT5A 3CCES 5J0SA 3MR3A 4PYAA 4DSJA 4I29A 1P9YA 4Z7CA 3AMZA 2R8JA 4KH0B 1LWEB 2QZ8A 3PG9A 1QY7A 1UEUA 2KHVA 1LWCB 1UAWA 1VK3A 2YB1A 2MAXA 1FEEA 3LGMA 3CIMA 4X62F 4PCQA 2HPUA 1V3ZA 3UCZP 3KJFB 1WG5A 5LMUJ 4ZITA 5K8NA 4F02A 1RK5A 2VC1A 2QLJB 4BC9A 3J7Z5 1EQMA 3TUJC 2CJXB 1NK0A 3DU5A 1NK8A 2ZIXA 1RTHB 3QQCD 2UXBJ 1KEKA 1VQKS 1H2UX 2MGZA 3JTOA 3LVVA 3I5CA 1IXRA 3EDQB 1L3TA 4PAAA 1ZJMA 3NGKA 3TVYA 2MHEA 4RNMA 4NEYA 3CW2C 5EWGA 1RHQB 3KLFA 4Y2CA 1R9XA 8ICQA 2ZOGA 1KOOA 4IFVB 1OY6A 7ICOA 1P9QC 4P9SA 4U6PA 1FFUA 1O8BA 3NGUA 4GMKA 2QMWA 1ZQUA 3HJVA 4ECRA 3KNGA 1YNYA 1JIHA 2C2ZB 1R8PA 3P5TL 3FZBA 3IGHX 3H40A 2DXDA 4F0RA 3CJSA 2XBPA 4CLWA 4K0KJ 2GMHA 4DX7A 4CRXA 3UDCA 1PBAA 2IDLA 3QGHA 4ED6A 4UTGA 5L38A 3I76A 1JLBB 5AKZA 2K7KA 4OJ3A 1CVJA 3F53A 1M1HA 4ED4A 1ZQGA 4TQSA 4UF4A 3N6NA 1M1GA 1FIQA 3MPYA 3DDKA 5DLFA 2WF9A 1FVQA 4MEXA 2V94A 5BXIA 1COOA 2QS8A 4IH6A 2OPPA 2Q6CA 2AJ1A 2EKYA 2XMJA 4CM0A 3T6BA 1B22A 3JSYA 1RAIB 2FVQA 1FWBC 3ENVA 1T3NA 3WK5A 2VDIA 3QWUA 2FVSA 4CLTA 2K8AA 4PZVA 1IQTA 8ICMA 2HWHA 3GMGA 3M32B 1T8EA 1ZQHA 3WK8A 3QSIA 1S1WA 3OXFA 3RF9A 2E7XA 2E66A 1S77D 4QNLA 2LFVA 5L1LA 4FZVA 2FGCA 2FTYA 3FEQA 1VFJA 4WPAA 2HWTA 4IQWA 1H98A 6FD1A 3B9JA 4Q43A 1Q1KA 2EC2A 1ELOA 1W7WA 2RF2B 3EW9A 4K2JA 3BQ7A 4X4SA 3MPGA 4JMUA 2VFVA 5B0DA 3KK2A 3TEHB 4NLBA 1EP4A 2CRXA 5B0GA 3LPEA 4M5MA 5J0XA 3AQEA 1ITPA 1RTIB 2HQ3A 2EFGA 4G7EB 1RYUA 2IRXA 5GVQA 8ICBA 1NAQA 4F04B 3HD2A 5KL8B 3LSCA 2E5JA 5J0RA 1S59A 1T9XA 3QWPA 5F8IA 4C2MA 3SIPB 1TKDA 4DS4A 2D3ZA 1ZBTA 1SKRA 2A2DA 3MI7X 3BO3A 1S99A 3D0GE 3EGWB 4HACB 1K1QA 3AOCA 4DCOB 4IO9Q 4DN9A 2DUYA 2CXEA 4KO0A 5J2KA 2D8CA 5J8YA 4C8ZA 4ZVGA 3CJ4A 2MXYA 2CIMA 3BQ0A 4JBCA 3QJJA 3CCLS 4RBUA 1UA1A 1X4FA 2G1DA 1LWEA 2DNYA 4QZHA 4N5SA 4U7UD 1IQZA 4NLKA 1LWCA 3JSMB 1NK7A 4JI6J 2I2YA 1A5KC 3ZTSA 2ZJ5A 5IIIA 1ZQIA 3N4MB 1K5OA 1QUVA 2V0NA 5DDYA 4MFBB 1NK9A 4JI7J 3BSOA 3FC9A 4LMZA 2KICA 2K4HA 1K47A 4EYIB 1RTHA 1WTBA 4QOTA 3ZDCA 2HNZB 3UMCA 1LXNA 1X0PA 1COKA 1A7GE 3QYYA 5DG9A 5HO4A 2F8HA 3CC2S 4WP9A 1KKXA 1WEZA 3PXGa 2VPYB 4I2QB 4K5SA 3CDBA 2LEAA 2XO7A 5AIBA 5HHHA 2DHAA 4UB1A 4ED7A 4UBCA 3MR2A 1V3RA 4LF9J 4MYTA 2VPWB 2RDDA 4IFVA 3AOAA 3H8JA 1GMWD 1P6TA 2BEFA 5AHXA 2GIFA 3NKYA 2Z8QA 1F60B 3IR7B 3P96A 4O4GB 3TAMB 1TK0A 3IV8A 4PJ0U 3IG8A 3LA4A 1RADB 1RQ0A 3BZQA 4CLSA 2H48B 4USHA 1SV5B 1WYGA 2K4EA 3LUYA 3S6EA 3KJQB 5DM7Q 2X1AA 5J2QB 4YDXA 5GTHU 3SQOP 2P9BA 1JLBA 4F2RA 3Q89A 1F9EB 4DR2F 4P4MA 8ICKA 5F8GA 3EGVA 1VLYA 1MQ3A 5EE0A 2FLPA 1SJFA 1DQ8A 2J9CA 2VA3A 1RTDB 3MPDA 1BQMA 4CLUA 5H9EK 4K59A 2HGLA 3OTQA 1HD0A 5AK6A 1N56A 1B4SA 3ONNA 1XIQA 4GKJF 4TY9A 3M32A 1NLKL 3HZEA 4GC6A 3BGRB 2IYIA 4DUYJ 4UAVA 2G5IB 1VMBA 3D1OA 1WKJA 1CQNA 4Y2SA 2CPJA 1S10A 2EPIA 5IV3A 2R7XA 4NL5A 1LVHA 2RF2A 4QZGA 3QAUA 3ZDBA 5FJ4A 1P8GA 2BGWA 5IWAF 4DX5A 1YHQS 3UBPC 1NK4A 5IM0B 5DB6A 3ETRA 2E44A 3I0SB 3VALA 3J80U 4KAIA 3H0LB 4Z6FA 1EJSC 3H2LA 3N0VA 3HX0A 4PH5A 1RTIA 1YMYA 3I82A 4P6QA 4PKDB 4G7EA 4DZ6A 4KV8B 1IN0A 2KVQE 5CCMA 1DGSA 4M9NA 4C0OC 5GTIU 3TI0A 3OUYB 1H72C 3R6GB 3L09A 4OLPA 3JB9k 1SH3A 2WBRA 2VPXB 1SXLA 2XLJA 5C5JA 3IP4B 1TUWA 4B9VA 1JRPA 3TANA 3DV9A 4OZ0A 4HACA 3UD4P 1X6IA 2H1YA 3LTOA 1BPYA 4FS1A 3QZ7A 2HFOA 4IOAQ 3WHIA 4ED5A 4YR2A 2YX7A 3GLJA 2IOHA 3HJEA 3NNHA 1U2CA 5KT6A 4EO8A 3JSMA 4P52A 2R2TA 3M8WA 1FJGF 1UFKA 4ZLLA 2BZFA 4JI0F 2X1FA 4P4PA 2CWXA 2EDUA 4MFBA 1ROFA 1ZRNA 3EGNA 1U49A 2AYGA 4EZ9A 2OEKA 3VAIA 2XQCA 4A8YA 1Z1BA 1REVB 3JYTB 2V8HA 1EIYB 3MGVA 5HLFB 3BN4A 2DEJA 3ISZA 1M5OC 3UN3A 1XBWA 2YPYA 2HNZA 1WF2A 2DHHA 1PK3A 2HKEA 4DR1F 4KMUA 2KG1A 4F72A 3ENAA 3RJHA 2GVZA 5CHCB 1QQ6A 5KFGA 2ZITA 3LAKA 2CZ4A 1RAKA 1NPPA 5B5EU 2F7VA 4DX6A 1X9SA 1SJ3P 3N6MA 4CLZA 2DHXA 4DCJB 4NJ8A 4URQU 4QR1A 4I6WA 3EICA 4O4GA 3TAMA 2UU9J 3H90A 4DSLA 4WIIA 4YR3A 4OYMA 4KLMA 1U1RA 4ES3A 1SV5A 2PN6A 1ZQFA 3CCRS 2HMXA 4RNNA 5J2QA 3QGAC 4P72A 4ILRA 5KTQA 1Y3KA 1JI7A 3N7RC 4LFAF 1D1UA 1L3KA 5J8YC 3D3BJ 4QR2A 3PEJA 1XERA 3DRSB 2FD2A 5CYQB 4QPXA 3EUNA 3LK9A 2D3OR 2R3VA 3NEKA 3H59A 1KFTA 4NLRA 1RTDA 1HWIA 1N5VA 1Q8LA 1M6YA 3P8BB 3O6QA 4ZIVA 2DTJA 1JALA 3E74A 5FDLB 5HATA 2CAJA 5ETKA 1ZQWA 4JV2A 2PC6A 3C6UB 3KUEA 1TVAA 1R9ZA 1T9WA 3GWCA 1BNOA 5KNIA 4OYBA 3TKAA 4GKKF 3VCDA 1OJ4A 1X5OA 3UQSA 4YQWA 3C5GA 1B43A 2OPSB 3T19A 1NDKA 2RHSB 1S6PB 2AH5A 4WU3A 2BJEA 2HFUA 5KG0A 3M05A 4HH0A 2JLGA 2XMWA 4TU9A 1YLXA 3VGUA 2YNGA 4ZVSB 3MTJA 5KG2A 1L8OA 5IM0A 1H0HB 8ICLA 4ANCA 5J0TA 3I0SA 5BR8F 1DHMA 5ETPA 2HNYA 5ALDA 1LNQA 2MDAA 4PEOA 3RJKA 2ZC4A 1TV9A 2AQ0A 3KHHA 1EARA 2XLIA 4ELUA 4KV8A 3CD5A 3OUYA 2AT1B 2OSRA 4LH8A 3TVKA 1NJWA 3THVA 4NASA 2WB4A 3D5MA 2KFYA 3HKZD 5CD4H 1B7YB 4X66F 1XNSA 3BQTA 2HVIA 2ODGA 1U47A 2UXDJ 4QIWF 2H51B 2AQ4A 4ANDA 5LMNJ 7ICQA 4F4WA 2IA0A 1Q8KA 4RQ4A 5F0WA 2ZBCA 1OMSA 1T03A 2LXIA 1HHTP 2DISA 1K73T 2IBKA 5A6WA 1TR0A 3R1HA 4RUAA 5H9FJ 4KLLA 2UVWA 3MC1A 3Q8UA 3TADA 1WCNA 3M6VA 4EBCA 1REVA 4UATA 2F3JA 2KRRA 2IDEA 1RU1A 4B3SJ 2BDUA 5G5HA 3RFAA 2C3OA 5HLFA 4M9LA 3GFKB 3JPRA 3IRXA 4N47A 3DI6B 3SQGB 4Z7YA 3RB0A 2V9WA 4G1IA 4JUZA 4AQYF 2BW7A 2O67A 3CJ8A 1S1UB 1ZETA 3T6JA 3BGOP 4PWUA 4ERDA 5ALWA 5CD4A 4LVSA 3KUHA 3EZUA 1FFSB 1YJWS 2MZQA 1Q16B 1YTYA 2XZWA 2FHOB 2YWEA 4CO2A 3N79A 1HUZA 3AAWB 2YXLA 4DQSA 2QA2A 1T9YA 1IBLF 3NMRA 4RNHA 3MPVA 1FVSA 1AT1B 4M94A 4PHAA 1TFYA 1TP7A 3OJUA 2HFSA 4TKTA 1VQ8S 4UB5A 1TKZB 2MQOA 1ZQXA 4ATNA 4OQJA 2VICA 2R7WA 2F1JA 5LXRA 1RYRA 3ILJA 1ECWA 1OXJA 2ZWPA 4FN5A 3DRSA 4RQNA 1O03A 2FB0A 2CPFA 1KVKA 5CYQA 3V6JA 2FJWA 4DL2A 1RUSA 4OX6A 4DV1J 4EUVA 1RA7A 1YQHA 2LLZA 2PFPA 2UVVA 1TL5A 2QB1A 1RM6C 4JV0A 5FDLA 4LBPA 4YUDA 4C65A 2LVWA 3C6UA 2ZVSA 1HFEL 1V3SA 4I1TA 4DV4J 4PL2A 1JJHA 2OPSA 2P9CA 1S6PA 2F1FA 5J0OA 1M90T 2J7KA 5LL6d 1G2EA 4FVMA 4ZCLA 2QYCA 4DV0F 3T5LA 2NPIA 3TACB 2JH1A 4WTOB 2Y9TA 3M9NB 1ZTWA 4NLQA 2HBKA 1QJHA 5AM3A 3EVOA 2EQYA 1KWMA 3E8OA 1GO3F 1NKBA 5JJBA 2A1AA 4O44B 8ICJA 4KLDA 3WBZA 4M5IA 1Y9OA 2C2MB 4F4YA 2DGSA 1U6FA 2RRBA 1FWAC 2B7CB 5LXXA 2POKA 2N1RA 3M8QB 4M1KA 2ZUAA 4YIWA 4IQXA 1ICEB 2ZEJA 4O0IA 4FO6A 3QU2A 3DHWC 2MLXA 4RUBA 1ZS6A 2GFFA 2ZFHA 1NJIT 5DJBA 2X3DA 2XY6A 2XI9A 2F63A 3M7DA 2ESEA 3B4MA 4CEUC 8ICHA 1FRIA 2ZDOA 1F2GA 1LK7A 3TVZA 1S49A 4DJBA 2IHNA 2ZOFA 1T0TV 2M8DB 2CQ4A 2XM3A 2B21A 2IC3B 3IWNC 3CDUA 2OELA 2YWWA 3R1LA 2C2KB 2MRLA 4GO5X 4KIRA 4CLPA 2KT3A 3V7PA 3OXLA 1RCOB 3IXQA 2FPHX 3FSIA 3M2VB 2ZXHA 5CH7B 1IKXB 2JRZA 1NXIA 3C29A 1SCJB 3QIDA 3QX7A 2GHPA 4C5YA 3W9JA 3DI6A 2CVEA 3D6JA 3SQGA 1YBQB 2H4YB 2WW4A 1GFWB 1SQFA 2I5JB 2ZKUA 1EAYC 2AXTU 1WC3A 2W04A 3GIQA 1TL4A 1KRAC 3KHLA 1D8LA 5AI6A 4KE5A 2OCEA 1SB6A 3MR7A 1BPDA 4R63A 4NRUA 1JQGA 4A8SA 4ZPCA 3GFXA 3ZZYA 1S7IA 4EFAC 4J03A 4NA2A 3GIRA 3HHKA 4C4WA 2VQEF 2VANA 1WHVA 4JI1F 3AHPA 3ISNC 2H3IA 4Q7AA 4QW9A 2HHQA 5JVGQ 1FRJA 3A3OB 1S12A 1AUSL 1TZ0A 3QBCA 1H6KX 2VONA 1TKZA 4URGA 4QPTA 3UW1A 1VJWA 3C28A 5KFYA 1OYDA 2AIRB 1LKYB 2IVFB 3KOAA 1RZMA 5LSOA 1MWZA 3HSZA 1RHKB 5ALMA 2EC0A 1Y11A 2IOFK 1IBCB 3G8SA 2RQCA 3OL7A 1ZQVA 2HGMA 2OTLS 3AA9A 1ZQPA 4DUTA 4E98A 2RS8A 3K1ZA 2NXUA 3W8PA 5EN1A 5GAEU 1MWQA 3K7RA 4J9OA 4CF5A 1HA1A 2J6UA 1NSKL 3F41A 4K4VA 5JUMA 5EE9A 3PW0A 1XRTA 4KH1B 3C46A 3RBXA 5AXMA 4USWA 4XPEA 3Q0AA 1XSLA 5E3PA 4DL6A 1RT5B 4DZDA 4DOAA 8ICRA 5A0YB 3BF4A 1FERA 1SH0A 5A6PA 5K8PA 4O44A 1F9HA 1QSYA 2BX6A 2KOBA 4C60A 2KN7A 4M9JA 2DNNA 2PD1A 2YN4A 5CYJA 4PG4A 4F3OA 2ZBRA 4TXSA 3IWXA 1YI2S 3UWTA 3M8QA 2DITA 4X65J 2LM1A 1B0XA 3M6WA 4R64A 4DFPA 1VC5A 3H2VE 4ZVQB 2HRYA 3R5AA 4OCZA 2E5IA 1Q0NA 3GB0A 4QBUA 3MWBA 2KM8B 2LHTA 2RRNA 1RISA 5F3XB 1KP6A 4HHJA 1RT4B 3HHEA 1FKOB 1KBRA 3W2WB 1R89A 4KX5A 1X9MA 4YMOA 4FBUA 1YG0A 4UW2A 5ALOA 4GVLA 1WUDA 3O3LA 3J7A1 2Y1LB 2ROPA 4Y2KA 2E1PA 2BXJA 5KFSA 2ALZA 3M2VA 3AODA 1IKXA 5AJ3F 2W2NP 1ZQBA 2XYPB 2ES6A 1P7DA 2DO0A 1YBQA 3ZZOA 1AUDA 3H8MA 1CQMA 2UP1A 2I1RA 2I5JA 2DCUB 4WXWA 3US5A 4RBTA 1WDTA 3NS1A 5FLXU 1VQSA 3RBDA 1Q7YT 5F9NA 1RJJA 3ICXA 2ZUCA 3CJQA 1I1GA 1VRTB 2N7CA 2ZJQQ 2YX4A 4HTJA 2CPHA 4USTA 2LA6A 4FXDA 4ECWA 3QEAZ 1KW4A 4DPOA 1DBDA 4LR9A 2IMOA 5KFDA 1S0VA 1YKWA 1PJ5A 4HKQA 1VIOA 2FZCB 3WX4A 1FXRA 1S5LU 3I87A 4CIOA 2BABA 2WVFA 5LSLA 1J2MA 3KHRA 4AE5A 1M5HA 1S48A 2MUTB 3UXPA 3HI9A 2PMZD 3FM9A 2GWSA 3RR8A 1Q53A 1HYSB 4QIGA 1SC1B 3CJTA 1FDNA 5DG7A 1M5PC 3FZ2A 2KSOA 4WTYA 4CGZA 5ALSA 1RT2B 2F4VJ 1KFDA 1ZZFA 3FUYA 2Y0SF 1HNWF 4P4OA 3U1MA 2XSFA 3QGPA 3ZDAA 2C2EA 4TLQA 3DNCA 4KHMA 5AKEA 4ED2A 2AX1A 4QU7A 1WCLA 2YWKA 1P27B 4TU7A 2A2CA 2UVUA 3D2NA 1NO8A 1UT5A 4ITSA 5AM2A 3WC0A 3GG1A 2R8KA 1O6XA 2K4IA 2Z2YB 4I67A 4ZJQA 5EX0A 2PIIA 5JVHQ 1RJQA 1NJZA 4YDDB 2W2QP 4LBHA 1PYOB 2H3VA 1RT5A 4NE9C 3HHDA 1RTJB 1RT1A 4P7VA 2XO6A 5EE1A 4UW9A 1S7HA 5A0YA 3I6PA 2KEYA 1V97A 1FI4A 3DXSX 3V4IB 2VHGA 4BJQA 3KJVB 2F8KA 5C24B 4N41A 3Q8QB 2FVCA 1V6HA 2D41A 4RPZA 3D6HB 4M9HA 1Y5IB 3OQ2A 1N6QA 2ADBA 4PWWA 5HR7A 1NHKL 1R27B 4MIWA 4M5LA 4C80A 3R2DJ 4KLQA 1TV6B 1JXEA 2LU1A 4AL5A 2BM1A 3A3NB 1B64A 2RILA 2JHDA 4FKXA 1LK5A 3M6ZA 2VD3A 4UOFA 2GWNA 4LRDA 1R3NA 4MIAA 2CXYA 3D0IE 4LBIA 3LW5C 3DRRB 2XMTA 2KYZA 1RT4A 1FKOA 9ICRA 3W2WA 2IRUA 2VG7A 2DBBA 2MQLA 4DS5A 1ZM4A 3HFVA 3K89A 2AGOA 4PG5A 1N32J 1LWXA 4DV2F 2XS7A 3PNIA 3ZZRA 4ZLPA 1S1VB 3K8WA 3R5BA 2LECA 5GAEI 3ILOA 3QJPA 3DC2A 3MTWA 2HNDB 5KT3A 3N97B 3CDWA 8ICXA 4RNFA 3UD3P 5E33A 1IJEB 2JR5A 4C7ZA 3CCMS 4ECVA 3H0MB 2KO1A 4YXJA 4R88A 1QAXA 1XMOJ 5DBBA 4RQ1A 2ZZNA 2QLTA 3AFGA 2YMQA 1KOHA 2JL9A 2IHR1 2B56A 2D3DA 2JZ5A 3AQFA 3SBMA 5HMEA 4NA3A 2FHJA 3PYDA 1FDAA 1K8AT 4NZ6A 1WI6A 2OPQA 3JQMA 4R0EA 2DGOA 4KC5A 4BGDA 2HVEA 1SKSA 4RQ2A 2W01A 1VRTA 4J90A 2LEBA 5KFLA 4B3TF 1RWPB 2E7VA 2YWHA 1KRPA 1A77A 1RACB 2IM1A 2DNGA 4QJVA 3AD7C 3QYPA 3R5DA 1UL3A 3JTNA 2VQFJ 3GZ7A 2E1EA 1D9AA 3CD0A 2DNMA 3AH6A 3H7IA 2CRLA 1VOMA 1SJQA 3Q2SC 1VRUB 4USMA 4RJVA 2MUTA 4K4XA 2ZBPA 4FF4A 1FE4A 2DRDA 3IS9B 3K5OA 3DOMA 1UWAA 4FYVB 1HYSA 3G4SS 2WF8A 1X4BA 1JWWA 1RT2A 2KP7A 4JI5J 1F6TA 3LP1B 3BREA 3DGPB 2V9KA 2E5LF 3GCXP 2OP5A 3DDHA 2CPYA 2KHQA 4F8RA 1N4LA 3PRVA 2HOIA 3T1YJ 4RT2A 4K8RA 3V6HA 1J6PA 2YKNB 3EMTA 2GAGC 3MZIA 4O3OA 5DQGA 3M6UA 3CCUS 1YZ7A 2LM4A 4KGKA 4HDHA 4FBTA 4ETZA 3D6NA 3TX0A 2C2DA 2ACMA 5J1PA 1RTJA 4LZGA 1WUUA 1Y3JA 2E1FA 2WONB 4L74A 5IT9Y 4XIUA 1Y7PA 4JI8J 1R0AB 2HBJA 1WOOA 2XI3A 4HHHA 2XICA 3KKAA 3V4IA 4B3RF 9ICLA 3KJVA 5C24A 3GIPA 2ZXIA 1LXJA 1W25A 2Y9UA 4IRDA 4DSKA 4KLTA 4YD2A 1XN9A 2Z30B 3MDFA 1N5QA 3OW2R 5AI0A 1UVLA 1SPBP 3JQKA 5DB7A 4BUGA 1TV6A 5DDMA 2GSEA 4UB9A 3WIVA 3HSJA 1C1CB 3OFGA 3HMJG 2ALYB 4PXEA 2DXEA 7FD1A 4O9MA 2NS1B 4XPCA 4AUKA 4JI3F 4NXMF 2A1JB 3DRRA 3DUGA 4ZKAA 1RB0A 1R31A 2LA4A 1BY9A 3SFUA 4LFBJ 2K3IA 5D0GA 1QQ7A 1VQOS 4O3QA 2NXCA 5IC6B 4J9UE 5HMLA 3BJYA 2NRZA 3NVYA 4OYOA 2GA7A 3EE3A 4QU6A 2WVEA 2QA1A 1XMBA 2KG0A 1S1VA 1L8LA 2YMMA 2RU9A 3MMAB 3OTOF 3W9IA 3G2XA 2HNDA 4OJLA 1KDNA 3RRHA 1N34J 4QZ8A 2RNEA 4LF7F 3CCTA 4TVAB 4B3MJ 1TL3B 1F2HA 2LDYA 3EWAA 1XQIA 3BDEA 3OL9A 5KFVA 4YHHJ 4JI4J 3GYXB 3QLHB 4ZPBA 4RQ8A 1A5OC 4D3GA 3HCXA 3HVRA 3I32A 4S0MA 2PFFB 5L9NA 3SI8A 5KFOA 1IM6A 4QYRA 3QUBA 3U27A 1ZQOA 2I6WA 3SCIE 2YNIB 5EGYA 3N4WA 1HW8A 3QIPB 2CG4A 3G82B 5HMDA 1HQEB 4F5RA 1TMMA 3RBZA 2C3UA 2DNOA 3QT6A 5C2GA 2YQ3A 5MLCV 2M8HA 3T8LA 3DLHA 4CNYA 3B4DA 2VB6A 2CJKA 2I6XA 7ICPA 1HNZF 5CR0A 1VGYA 2DO4A 3AJDA 3BB5A 2GHWA 4FS2A 3DGVA 2BCRA 3H98A 2GS8A 3C6TB 2HYIB 3DLGB 3PO4A 1VRUA 2X3GA 4DLEA 3RN6A 5KFAA 1Q79A 5K8MA 1SKUB 3IS9A 1GXTA 4US9A 4NL9A 1LW2B 3MGHA 3K4GA 4C7YA 1O5JA 2HK3A 2NZCA 4NLTA 2HSZA 9ICFA 5KFEA 3DGPA 3LP1A 1U8WA 3ORYA 1ZJNA 1IBKF 2BCUA 1CI4A 7ICHA 1WG4A 2VIHA 4LRAA 1WWUA 7ICNA 5F41A 4LF6J 2JFKA 1H73A 1Q95G 2BPCA 2HQCA 2F8EX 4DR7F 2YKNA 2UUCF 3CCJS 3G86A 2OHFA 1ZQQA 4MHVA 3AN1A 1NH7A 2B5JB 4CF3A 3F0NA 2HRTA 4CO3A 1R43A 1N36F 4EP8C 4PQUB 3MR6A 3TUZC 1P1LA 2MQQA 4F93B 3SXLA 3HKWA 1R0AA 4QZAA 2VFSA 1QE1A 3KBBA 3I56S 4DPWA 1FK9B 2VJVA 5ALEA 1WD6A 4M8LA 2RAQA 4LSZB 4LF1A 3T9ZA 3JPNA 3QT5A 1WTFA 3AXMA 4Y2VA 4PGYA 3ETLA 2JFDA 4CNZA 5HSPA 4L3KA 3DRYA 2WW8A 3NRBA 4I27A 1C1CA 2HOQA 3TR5A 2Q43A 1V4YA 4W90B 3CCZA 3IAM9 2UUBF 2W24A 3L3CA 3CO9A 4CRJA 5G4HC 5ALKA 5A76A 1UW9A 2R7OA 2B9EA 5ALGA 1A6LA 4FXWA 3HULA 1WNEA 5F8MA 4BJHA 3O2IA 3QE9Y 3ZDDA 3MEKA 3CCSS 1SI9A 3N7SC 4ELVA 3ZTPA 2CQ1A 2Y0SC 3R97A 1MN8A 1HKAA 3ZTQA 1QAIA 3SR6A 1FJCA 1SIZA 1RA5A 3H4DA 5CZVA 4KPCA 1S1XB 1HUOA 1ZAWA 3MMAA 2CPDA 1XNQF 4BWMA 2W9AA 2RU3A 2EK1A 2BCSA 3BE7A 1VC0A 2YNFB 3PX4A 1CJTB 4RNOA 1TL3A 1DY3A 1KD1T 5U47A 3MD1A 2LKYA 2QC3A 2QL5B 4WKYA 2KT2A 1VQNS 2QRRA 4L75A 2AV5A 4O5KA 1EJRC 1VQLS 3QLHA 2X1BA 5E5NA 2ZIUB 2D7SA 2GW8A 6AT1B 3U1NA 3F2CA 2HI0A 3GCWP 1BPZA 3W7BA 3OTEA 1IXKA 3FAHA 5KFCA 4RPFA 3SEIA 4QCLA 3C66A 2R7RA 2G2ZA 1YJUA 1HQEA 2XMKA 2Z7JA 3MCNA 2N3OA 1MMNA 2AP6A 2G0IA 1N33F 3W5XA 1T11A 2ZH1A 3C6TA 3DLGA 3SZ2A 3VQTA 3D6MB 4GVBB 4XAKA 1UVNA 2CQ3A 3PHTA 2YVSA 3ETMA 1DJ0A 1JMSA 1LW2A 2Z2ZA 3E3XA 2N3LA 2D9OA 3MEDB 5IQ6A 1WKLA 3AQOA 3A0BU 4WK1A 4QIWD 5KG5A 2HVDA 3KXDA 3PIOQ 2D74B 2E9TA 3MMBB 4WHBA 4EPBC 2HHHJ 1J2VA 2UXCJ 4H54A 4R8UB 2FYXA 4F0HA 2UUWA 1UZDA 2H65B 3HSDA 3M9OB 1HQ2A 1UW4A 4HI1A 2P6SA 2MZSA 1ZAVA 4A47A 5A2QU 4TY8B 3AM9A 1U0HB 3ENQA 4KN7A 7ICKA 5M2PA 4DN0A 5DQHA 2B5JA 5CP2A 2EANA 3RG6A 1L3VA 1RZTA 4PQUA 8ICWA 3AJ1A 1F0MA 4G1QA 4C0ZA 4DL4A 4DV3F 1NMEB 5F8HA 4WYWA 2PEHA 1WJ9A 1KLMA 2P53A 4KMOB 2Y1IA 4F67A 5J29A 1FK9A 2OMLA 4ZK7M 4V1Ak 4KHPJ 3KDOA 3WU2U 3M2RA 4LUBA 2P9EA 4QWAA 3SV3A 2R8IA 1GQEA 4C3MA 3W66A 4I2CA 4JI2F 3NOGA 4I2GA 2MZRA 4M5DB 5KFMA 3JAMY 3FDSA 4WFZA 1SL0A 3TYTA 3OLBA 2KV2A 1Z2LA 4I4BA 2JRSA 2AJ0A 2VFUA 3NGRA 2BPFA 2JWNA 1E9ZB 2WTFA 2EAOA 4BC7A 2FJAB 3A3PB 4YFKA 5AK4A 2KJ8A 2HS3A 2HBYB 3TP2A 1K44A 1OY8A 1BPBA 1BQNB 3UPQA 3B78A 1CC7A 2PO4A 3TJ8A 1WHYA 3HT3A 9ICNA 1RBLA 4JV5J 4DUZF 1SXEA 4C7QA 2BJ8A 2I1QA 5KG3A 4F91B 3ZFVA 2QA4G 1VBZA 4RBVA 1HBMB 1S1XA 2Q4TA 2Q79A 4DF8A 4MIBA 3HW8A 1FF2A 1KDHA 2YTCA 3D66A 2PUZA 3BQ2A 1IR0A 4C8NA 9ICJA 1X6JA 4ZVOB 4WBFA 3K5NA 1SJ1A 2ZD1B 3QRPA 4LFCF 2YNFA 3LNPA 1CJTA 5ETTA 4ZVFA 2KFZA 2H4WB 1TVRB 2O1PA 2VFRA 4UAWA 1O12A 4LSNB 2B6GA 4OHZA 1CPZA 4RLEA 4OYWA 2F8LA 2K8CB 5IC4B 2PLMA 1RK8A 1RT6B 1U4BA 2DGZA 2V8PA 3A0HU 1H2VZ 1HHQA 5G0RA 1POJA 1PVQA 2N4DA 2XCAA 3LWLA 1RHRB 2W4DA 1BPXA 2MZTA 4ZS6A 4DL7A 3VR1A 1FWPA 5C42B 2ADCA 2CNOB 2P6RA 4EEKA 1OWXA 4NLYA 4NZ0A 2DGTA 3A8EA 3E51A 5FSDC 1RPLA 5CJ7A 4UASA 1V85A 3T9NA 3I31A 2RRDA 4EZ6A 3AA8A 4O23A 4MKVA 4GVBA 1RQNA 1IBMJ 3I9ZA 3DHXA 4LR8A 2XSJB 3AU2A 3VAHA 4RQ5A 1XR5A 5IV4A 4Y2JA 4DEZA 3MEDA 1OPZA 3NP5A 4ZHRA 5EWEA 2W3RA 5SZTA 2JEJA 1HBUB 3MMBA 4DR3J 7ICFA 5E3AA 1FJ7A 3ET6A 2ZUGA 3J81Y 2X7IA 4R8UA 4PPZA 4IFYB 2XY5A 4TUPA 1U6BA 3SMVA 4TY8A 2FMQA 3IDWA 2PT0A 2ZNYA 2FVMA 2ZNZA 1V9PA 3OSNA 3Q24A 1SJRA 2VL1A 4KB7A 2W1BA 4UUXA 2AD9A 2J0XA 4Y2TA 2MZJA 4KIAA 4X4NA 3WC2A 2Z2MA 1Q8BA 2QLBB 4ALZA 2HIYA 4F92B 1EETB 3X3UA 5HL7Q 1E6VB 3EXCX 4DG1B 4ZMMA 3QUQA 3LPYA 2G1HA 1M0SA 5C2CA 1YX2A 4FZMA 4FDFA 4V1XA 4Q5VA 4NXZA 3I4HX 4M5DA 2K1RB 1LW0B 1KQGB 2BR0A 1NK5A 4ECUA 4OI6A 5LXYA 2HFVA 3VTIA 1ZQRA 1W2BR 3PKYA 5JRTA 4WJBA 4CNUA 5CB1A 4DHVA 3CEDA 1HIYA 4YS2A 1U02A 4X62J 3W5ZA 2B9YA 3GDXA 1L3UA 1Z19A 1BQNA 2ZJ8A 3UQ0A 3PRDA 1ZQ1C 3K0JA 5K8OA 2AJ2A 3GV8B 7ICUA 2ZIWB 2FVRA 4K4HA 4DQQA 3M6XA 1ZPWX 4KLJA 4GY7A 3HVTB 4QZVB 4OV6A 2DIVA 4EBEA 1HBMA 1MA7A 4XDCA 5A2QY 3GV5B 1NHVA 5HANA 5BJRA 5KAKA 2LMIA 1TU0B 3RUBL 2BB0A 1TKTB 2E9ZA 4LVOP 3FEXB 2ZD1A 3IR5B 2OJ3A 4C48A 2HAFA 4MFCA 2WFAA 4A8EA 3D0HE 1TVRA 1I94F 2MEWA 3L7PA 3SSSA 3Q8PB 4C8YA 4P2SA 2W55A 2ZHOA 2VJ4A 2UUAF 1UJ5A 3ZZ0A 4LSNA 3W60A 1CJKB 5E0OA 4DV5F 4DR6F 4O5EA 3RJEA 2QN6B 1UVJA 1N8RT 2L9NA 3CT9A 3BEGB 4M51A 2DY9A 3R27A 1EJTC 3WK7A 3DEEA 3D7SB 2RUSA 4Y2RA 2ZE2B 5H1SV 2VODA 3CULA 3DDNA 2D3O1 5IILA 2XGPA 3TAPA 3UDVA 4J9RA 3U26A 1QD1A 5C42A 2XB2D 1KL9A 2OH2A 1YGYA 3IM9A 1FDDA 2MKHA 1RAJA 4CH1A 2GO7A 2IPOB 1WG8A 4ZP9A 9ICHA 3W65A 3V2UC 4DBQA 3EM1A 2UBPC 4OHWA 3BR9A 4PYDA 1I51B 1VISA 4I2IA 3HHLC 5J0QA 1Z4OA 3PFOA 4IG3B 4AFFA 5D3GA 2AEJA 1UBPC 3W1YC 2OKQA 3MFIA 4FNIA 2NRXA 2XSJA 4G1PA 3ED5A 3MECB 4KRWA 3X1LB 1LFPA 1DTQB 2L41A 4KYZA 4RL1A 3IGVA 5AKHA 2AQVA 4OYXA 2JVOA 1FO1A 3BN7A 2P8IA 1HBUA 1GTHA 3BZCA 2BRKA 1EQ0A 1N2XA 1V5VA 3ZTOA 1VBYA 2Z57B 4F5QA 3RH6A 4IFYA 1GNKA 2H9ZA 9ICTA 2JLFA 4P73A 3FJ2A 3T79A 5HROB 1GXLA 2FC8A 1T94A 1SWVA 3R7SB 3BDPA 3UMGA 1UMJA 2NO5A 8ICIA 4K4ZA 2F40A 4FYXB 3IGNA 3I96A 3OL6A 5KFXA 7ICIA 1SUQB 3RU0A 4EX6A 1BNPA 4PGQA 1EETA 2ZOMA 1E6VA 4DG1A 2NQPA 2C2OB 3UO0A 3TW0A 5ALRA 2Z0GA 3V7LA 5FD1A 1KRCC 1F9FA 2K1RA 3Q8SB 2VPZB 2JVRA 1LW0A 2JC0A 4OLOA 2DGVA 2FC9A 1CJVB 3W63A 1HJPA 2VA2A 5HBMB 2WF5A 2L5YA 3K57A 2Z00A 2M9NA 5KG6A 2FJBB 4J9VA 2NSCA 3IRUA 3PZPA 3GIKA 1VIXA 3M8RA 3A4TA 3NGSA 3SDEB 4Z2XA 2A19A 5KFBA 2ZZTA 2M7SA 2NR0A 3AQPA 4DPYA 3S1TA 5BPCA 3FGVA 2F65A 1DFDA 4OZ3A 1HI1A 1N52B 2BA9A 3H8YA 4U96A 2D6FC 2ZIWA 4DSIA 3IMQJ 3O44A 1S6UA 5LM7E 4OZ5A 2Q1LA 3UXNA 5M2UA 5KFFA 2LQJA 2B8PA 3MM5B 3WK9A 2F9DA 3AB2B 1NNDA 3LVWA 1X4AA 1M1KT 1A0PA 1TKTA 1L5UA 2L9WA 3CJRA 4X64F 1P1TA 5F9LA 2KHCA 2GCFA 1BWEA 4KO0B 5JTIA 3IV6A 3AJ2A 1GXUA 4C0HA 4ZVUB 3RH5A 4R66A 4YN4A 1RDFA 1SGGA 4QZCA 4IOBA 3T1HF 1YZ6A 3HT0A 2JV3A 1CJKA 1U1MA 2Y8WA 1AROP 3RH4A 2FLOA 2M88A 4M6WB 3K8VA 1EJVC 1L3SA 2V5HG 4US8A 1BE4A 4UAZA 2WF6A 2LI6A 5J0PA 2PMWA 1VLOA 2YY6A 3G96A 1XSNA 2XMUA 1PC5A 5AKLA 3OR2A 5L9XA 2HW3A 3PW2A 2AEFA 1ZQTA 5DDPC 3CP8A 3UCGA 3QU9A 2ZE2A 3G71S 4RW7A 4M5NA 3H5YA 3N6LA 1F44A 2M3DA 4CTAB 1ZA2B 3M8YA 3IA0A 1PZNA 3G9CA 2WOMB 3JS9A 4K4WA 4DR2J 3HWTA 4A8FA 3FKBA 1NSAA 1IWAA 8ICPA 4J9SA 2GMJA 1U09A 3KD3A 3NOCA 3C14B 5HMYA 2N4CA 2DIUA 2RH3A 3OPXA 4GO7X 1XO0A 4J9LA 4UARA 8AT1B 4IG3A 1NZBA 1QVGR 4B3OB 1U2RA 3BS7A 4RQ0A 1M5KC 1ZQNA 4DF4A 1X31C 3MECA 2V2ZA 4K4TA 3M1YA 4Y2IA 4GKJJ 1Y00A 1WSRA 3NGTA 5ALUA 1DTQA 1FE0A 3ICJA 3ILLA 2LQ8A 1KTQA 3KLIB 4RR5A 4H4KC 3ZZTA 2MKKA 3VC8A 3CMAS 5ETNA 4LF8F 5GMEA 4AC7C 1TL7B 4DCCA 2P50A 1WC5A 2ILZA 2HHSA 5IWAJ 2G0JA 2J7WA 2RIJA 5HROA 1GAOA 2DL0A 2ASLA 1NZPA 4FZLA 1N5YB 4ZP8A 3W5YA 2Y3YA 2DR9A 4MJKA 2XG8A 1SUQA 4X4TA 2FQQB 4EELA 4MK7A 2LCWA 1BVSA 1BQMB 3PYGA 4DOBA 4M47A 1F3VA 4HLBA 4CCHA 2DNZA 2DT9A 1X9WA 2Q0ZX 5AK5A 3MPWA 5HQLA 2XWYA 2W25A 1TAUA 3HVWA 2GLEA 1CJVA 2DEIA 2ZH2A 1XNRF 5HBMA 2A6OA 3W61A 1W2IA 3GJRB 4GRSA 3PW7A 2DR5A 3UN2A 3NASA 2V34A 4F4ZA 2K4PA 1FJGJ 3ENWA 3SDEA 1JMTA 4JI0J 3LDAA 4B9NA 3CJ5A 1RAEB 5K5MA 3BH7B 4OHXA 4MKBA 3NS7B 1O08A 3OFEA 2WVCA 1VI7A 2EAPA 4CO4A 4Y2MA 1HD1A 3SSRA 2Y1RI 2QARB 3ADAC 2K8GA 3LYSA 4JWNA 4ZDNA 3MM5A 4ED3A 1F1BB 1EB0A 5F3TA 4DR1J 2I38A 3AL0B 2GGPB 3N28A 2ZUBA 3RB3A 4Y2PA 1Z4NA 3Q8VA 1T02A 3LO3A 2FZGB 3KTQA 1L7NA 7ICJA 3ZTRA 3K5LA 1NPRA 3UPFA 3MGIA 3VWSA 5I3PA 1YDLA 2AMCB 1OW5A 4M6WA 3PKMA 4NLZA 3QMQA 3W9HA 5I3QA 3OTBA 3R3TA 1ZQDA 1JLEB 4ZP6A 2PFQA 3TX8A 3WKCA 2VJ5A 2LKZA 4CE6A 5BYRA 3GGMA 2MQMA 1U1QA 4CTAA 4OX9F 1TE2A 2XVTA 3A8JA 3MAQA 2WOMA 4LFAJ 1T3QA 1R6YA 3CWJA 5AXLA 3SAGA 3C14A 9ICAA 3P5BP 2GVZB 5AXNA 4ECTA 3NLCA 2JEGA 2MY7A 1UPPA 2OMOA 5KT4A 3M30B 4B3OA 5L1MA 3GG0A 3BO4A 2XNQA 5K4LA 1FT8A 1GKRA 1S57A 2M9KA 4GKKJ 4ECXA 1PVPA 1WEXA 3MEEB 4I2FA 1L7PA 1O51A 4I2JA 3PYFA 4DWIA 1V5IB 3ZNJ1 3KLIA 5K9FA 3EVMA 3LP2B 3M4XA 2U1AA 4DPTA 3ZC4A 1TL7A 1A76A 5AKGA 4GBDA 1RJPA 2BJ3A 3UDLA 4NLPA 3HILA 1RT3B 4P2XA 4ZVTB 3ULHA 4I69A 5BR8J 4RW4A 5KFRA 5IOLA 2FDNA 1N5YA 2KHDA 4WFAQ 2JZBB 4KITB 1IJFB 4ECSA 2M5YA 3R7NB 2DQNB 5C25B 4NYPA 4AL7A 3O7UA 8ICFA 5HR6A 4Y34A 3F73A 4ETXA 3V6DB 2KH9A 4X5VA 3CO0P 4FF1A 4X66J 1UA0A 2J9DA 5HJXA 4DV7F 3MM7B 3R5CA 3SEOA 4TYBA 2KKVA 1RA6A 2ZKTA 3I1YA 1FFWB 3P45B 4I56A 2ROEA 2LMRA 3HKZF 3PO5A 4TU8A 5HMZA 5AT1B 2YKQA 2ZHBA 2R9LA 2CVIA 3UDEA 2YNGB 1YJ7A 3D2SA 2G09A 3EXYA 3UQ2A 2OODA 4CQDA 3E2EA 2K8BB 1RAFB 4CLYA 1J27A 2ZH9A 1LFWA 2HNYB 2RHQB 3KWMA 2KVCA 2AYMA 1IE7C 7ICRA 9ICEA 2UZ9A 5GAHI 3MCOA 2DFLA 2VBYA 2F9JA 2MLYA 2EI5A 2PA8D 2QARA 1CG2A 4YFUA 3IHQB 1FTRA 1X7VA 1UT8A 3VAFA 2ASJA 1WC0A 3IP0A 3O0FA 2GGPA 2ICSA 3BSAA 2ZM6F 1NK6A 1RBOB 2XHWA 4AQYJ 1IKWB 1DK3A 4UBPC 1XK8A 3FNNA 4CH0S 4DI6A 1C4CA 3CNQP 3B0YA 4FE3A 1SL1A 1BLUA 3GR1A 2JNJA 4CDIA 3QU4A 4IYQA 4PG6A 1HMVB 1XRFA 4DO9A 1KN5A 3ISDA 3QU7A 2KU7A 3IM1A 2YMPA 2F1HA 2JH7A 1T03B 2AYBA 3JXOA 5IXUA 4HVZA 8ATCB 1PJ7A 2HHXA 1JLEA 3MMCA 4Y2XA 5I42B 4F0LA 1IBLJ 2HSEB 4NWBA 3DYAB 1RHJB 5AICA 3DRXA 3W3SA 2GOLA 5E3QA 3C2LA 2R2SA 5JMNA 2ZTEA 2MY8A 2WB1D 2W2MP 3PCOB 2KE7A 1XR7A 1A5LC 3WKAA 4KLOA 2W8KA 3IRXB 3QU5A 3IBWA 3VVUA 5HHIA 1LB2B 4UOGA 4I2EA 1GT8A 3T81A 2QLWA 2VDHA 2HG4A 2E9RX 2MSNA 1WWHA 3R5GA 2BBEA 1EKSA 2J9EA 4OFZA 3M30A 2YBVA 1Q78A 4F25A 1G4CA 5F0UA 1WI8A 1CUKA 2W7OA 2DGWA 1LV5A 3MEEA 2W7PA 3OD2A 1FA0A 4F71A 3LP2A 3GIIA 1AQ6A 4N76A 4Y2UA 1ZQYA 1XMQF 1DK2A 4PR6A 4DV0J 3HP6A 1YBAA 4NLUA 3RAQA 1WSVA 3MXHP 1UQVA 4O3NA 1RT3A 2DR6A 2BJ1A 3LA0A 2HWIA 3WKDA 4ID5B 1WEYA 9ICWA 1FJEB 2J0WA 3CCVS 2JZBA 3OFFA 5C25A 3EWGA 2A1BA 3WDOA 1F5SA 4C4SA 3CUNA 4DU8A 5AM1A 3V6DA 7ICVA 2J5AA 3WKEA 1NJYA 2V67A 1S0MA 5LJ3Y 2FE9A 2NRWA 2WHEA 4F7VA 4YY3F 1PCAA 5ETMA 3UN5A 4UY8T 3MM7A 5H2FU 2LYHA 1DQAA 2DNHA 3C15B 1B0PA 1QAJA 2ZZMA 3D28A 4OJPA 1JLFB 4PXDA 3SYZA 2LP4A 3MCSA 4B9UA 1C1BB 2VBXA 1ZPVA 3BKFA 4CNQA 2DH7A 4R0JA 2QX0A 3VHQA 1HNVB 3AXKA 4C3KA 3L95X 4LR7A 4NI2B 2KMDA 4LF4F 1N48A 1Q82T 2FPLA 2IHMA 1JB0C 5JXSA 2WAQD 2ATLA 1QTNB 3K17A 4NLVA 5DBCA 4UB8U 2QFJA 5L1IA 1AFJA 2LBOA 1Q81T 4WGXA 5AKQA 4WJ3B 2B0CA 3WKBA 4X4RA 1JK9B 4H4MB 1IKWA 2CQPA 3LANA 2MPUA 1F5BA 1RABB 2R7SA 3RRKA 3RB6A 4JB8B 5AI4A 4XDDA 2JX2A 4MMOA 4X4VA 4B9MA 3RW6A 4KJIA 1HMVA 2AJ4A 2OYYA 1B0TA 2ZJAA 1PILA 2MSTA 3PMNA 3UVJB 3B6BA 4J9NA 1WDDA 2QA4S 1N54B 4C8MA 1Z3EB 2F3NA 2KYXA 2W2OP 2VQEJ 3RRGA 3NGDA 3TAQA 2G2OA 3D2QA 5I42A 1B99A 4AYBD 3DYAA 2J0QD 3E01B 4JI1J 4OI2A 2IM3A 2WSEC 5ETLA 4C8KA 3MM9B 4F4XA 3CJ3A 2NSBA 2WVDA 4OYAA 3PYEA 4LT6A 3A8IA 2AGPA 4OX8A 4JP8A 4CH7A 3H5XA 2CZ9A 2EG2A 3MHYA 3J80Y 3FBEA 4DR5F 3U1LA 3F5AA 1B7FA 4X84A 2QT3A 4B6JA 3SAFA 1JKHB 4KLSA 2B4OA 2IJFA 3QJLA 3MOZA 3N9UC 3FBCA 2RVJA 4LREA 2NYHA 4F0KA 4J91A 3CIZA 2YWGA 1J5EF 4F4KA 3CCWA 3RZAA 4JYAF 1TQLA 4FZNA 4WFNQ 1KHWA 3QFWA 9ICVA 3BZKA 2L9DA 5ALLA 1HBNB 2MTLA 3D4JA 3TJ9A 5J2HA 3QPIA 3BBCA 1SZPA 4IRCA 3FMBA 5BYQA 5J2CA 2V4RA 1G6BA 4NCAA 4MF2A 2PXIA 1EZZB 4F26A 2WSFC 4EK2A 4YB7A 1HIWA 4EU0A 4I2DA 2FI1A 1PO9A 2E29A 2EFQA 2YB4A 1R0CB 4ID5A 3NCPA 1L7MA 1HLWA 2H5EA 1J97A 2IBOA 1MROB 3GSIA 5A8WA 3S7RA 3ZZZA 4LSLB 1DQ9A 1HNXF 2KIVA 2YQEA 4NM2A 4UB3A 3GE9A 1TAQA 2BPGA 1U0SA 5KG7A 1GKPA 4GXIA 9ICOA 4Y2YA 2FUG9 4CT9A 1KKHA 1CSJA 1I3OB 3C15A 1SQEA 1ZOTA 4LF2A 3C1ZA 1JLFA 2VASA 2G9OA 1Q8IA 1Q3VA 1UEKA 1C1BA 2ZIVB 2DWQA 2CADA 8ICUA 2MKIA 3MDCA 3GZFA 2RJZA 1HWLA 1VS3A 1ZD4A 2DNRA 1HNVA 2V8GA 2EXUA 5LJ5Y 4NI2A 2CQ2A 2COLA 3KKFA 4CEXC 3OTDA 5E7OB 1RLCL 4TLRA 4Y2QA 4OHVA 1NB2A 4IR1A 1XWLA 4YN3B 4OX7A 5AJ3J 2B6AB 1JLQB 2QLXA 1ZAXA 3BS5A 1VJ5A 2DKZA 1JLCB 2RS2A 1CJUB 4F5NA 4H4MA 2NPFA 2DCLA 5HVGA 2HLUA 3BH6B 2XHCA 3RB4A 4RT3A 3BGFA 4ILMA 2R7VA 1YITS 5KFQA 2OOFA 4PG8A 5ALNA 1LWFB 5E3RA 5D0RA 2OAUA 4OJ1A 1UP1A 2GIRA 3SD7A 1PSDA 2O6KA 3TEGA 3UMBA 3TO8A 3UVJA 2CPIA 1HR0F 2LPEA 4WP3A 1MG7A 2YY3A 5ALTA 3LQVA 2A6MA 1Q7LB 5CXTA 5KFPA 2IMWP 3H25A 5EE3A 3E01A 3CB4A 2Q6BA 3FVYA 4HI2A 2GZOA 3MM9A 4WXOA 4YR0A 3BYRA 3Q22A 3JPOA 2DRBA 1FESA 3FYHA 1NDLA 5CZXA 3DM2B 2AEMA 2E1MC 3HKZC 2AZ3A 2HZCA 1XTZA 2QGFB 4WWSA 2OEJA 1X40A 2K60A 2GH1A 1UFLA 4MF8A 4DL0C 4CF4A 3LS9A 4DFKA 4IS7A 1S4FA 2R18A 2FLNA 5EX3A 1S79A 2HZVA 1JKHA 4C8OA 3BSNA 3MM8A 2M2BA 2DD8S 2HCFA 3PACA 4G65A 1N5WA 4IQUA 1V51A 2Q3PA 3FK4A 3L4BC 2PI4A 2E1CA 1NDPA 4IQMA 1XR6A 3K75D 3PNCA 4DV6F 1HNWJ 4RDVA 4BXOB 3GRIA 4LJMA 4YMNA 2JLEA 3D1QA 3BQ1A 3V7KA 2PMZF 2K7JA 3W2VB 1OIAA 2R8HA 1N5TA 1HBNA 3GJSB 2ZH5A 3QO9B 2G08A 2H3FA 2GIQA 2OGJA 2NYIA 8ICSA 4NLXA 3OJSA 1K0VA 1Q3UA 4IQTA 1LQ9A 2PFOA 3AD8C 4J9MA 5LT5A 1N88A 2KJ5A 3BBFA 3RAMA 7ICGA 2E8OA 2R4FA 2L08A 4Q0BB 3NRWA 3H42A 3UM9A 3ZI4A 1H38A 3NY0A 3ALRA 2BCQA 3KNAA 3O1LA 4GC7A 4LRCA 1MROA 4WFXA 2HHTA 1IG6A 3FCHA 3D1HA 3SENA 2NRVA 2QE5A 1TELA 1DRGA 2XI2A 2FDRA 1JNRB 4LSLA 3TARA 4J9QA 3V5RA 1ONXA 4DR4F 1RHMB 2HHPA 4X2BA 2Q09A 1H2TZ 4P2MA 2KDOA 2KSOB 3SV4A 4UT4A 2RMLA 4QW8A 4FPRA 1HPZB 1DZ5A 1BC6A 1IVZA 3LSBA 3PJ9A 1FKPB 3VV2B 2XMVA 4QIFA 2FGOA 2H54B 4LF5F 1IKYB 1M7JA 3C2MA 1GMUA 2DYAA 2ZIVA 3EVWA 4DFJA 3TJAA 2H5XA 3M7VA 2VM8A 3KLGA 2QMXA 4ZIWA 4DOZA 2YQ1A 1RT1B 1U1LA 2KTQA 1QLNA 4Q44A 4DV2J 5E3CA 4TURA 2YMLA 4DMZA 5HP1B 3I0RB 2ZJPQ 5D78A 2B6AA 1JLQA 3WK4A 1S6OA 2OGUA 2O3DA 1N6QB 1JLCA 1CJUA 4NYOA 1EXNA 4QZEA 2I5HA 3CJKB 6FDRA 5T41A 2QG9B 3ZD9A 1LWFA 1JX4A 5DO2A 1SC4B 1FXDA 5CA7A 1X4HA 3MPUB 4PQAA 2OFHX 3GSDA 3M8PB 4K4SA 4M5HA 4EPEC 4YEAA 3QNWB 2OLWA 1IKVB 1AZSB 4K2XA 4HT5A 1RBAA 3H5SA 3PJWA 2VG7B 5KOXA 4CNSA 5EOZA 3R6LB 4I2PA 3C5FA 1FWDC 4B3TJ 4N7TA 1SV0A 4DL5A 3OVAA 1XC9A 4FFDA 2OPRB 3HFKA 3U7JA 1YRTA 2MKSA 1AA1B 3DM2A 2XGQA 4M0AA 4ENOA 4C97A 2P66A 1D09B 3SCLE 3O5TB 1VYAA 4QZBA 2BZ2A 4KY3A 1P1MA 1JLAB 1PBUA 2BMBA 4P75A 3TZXA 1HEKA 4M04A 2GNKA 1U1PA 2NV3A 2ZTCA 4X4PA 3B82A 1WC6A 1R0BG 3AOBA 3FQLA 1HWKA 4F5PA 2E8MA 1FEZA 4IH5A 5CA5A 1TUGB 3S01A 3UD5A 5T7LA 2AX0A 3O8WA 2VKQA 4B9SA 3CCQS 1TAMA 2RD5C 4A8WA 1PIEA 4PPXA 4BXOA 2OPQB 2E5LJ 3FSXA 2JMGA 5DB9A 3NVZA 3W2VA 1FRXA 2WSCC 2HQGA 2DPJA 1C20A 1ZQAA 5I3UB 1EHWA 3QO9A 4L76A 5B7WA 1C0TB 3C2PA 1VK8A 3LGNA 2BVZA 1FNMA 2C3PA 2CQHA 1WC4A 3CMQA 1M5SA 3M8SA 4NXNF 3PMLA 1HL6A 2XS2A 2V2VA 3QNMA 4Q0BA 5KOWA 3BKUA 4OI0A 1X5TA 5J2IA 1NH8A 2DJWA 2C3YA 5J2GA 1NCLA 4B3RJ 2WK4A 1YJVA 1RA0A 1H7XA 5AE2A 2EFPA 2HOFA 3DOMB 2G13A 2HHUA 3CDAA 1Y88A 1UVMA 4NY8A 3JQJA 3IR6B 4K7QA 5DRKA 1VQ6S 3T5HA 4OD0A 4TYAA 5C7PA 4DQIA 3PHEA 4F3QA 1HPZA 3PSPA 5IIJA 2BE2B 1AB8A 4JWMA 4U8VA 2D9PA 4NZ7A 4ICAA 3M9MB 1FKPA 5D15A 1FRKA 3MOJB 4JI3J 3MR5A 4NXMJ 4P10A 5L39A 3JTPA 1IKYA 4RU2A 3PTWA 4NEZA 3UXOA 2QO3A 3HZGA 2LU2A 1N0VC 4OI4A 2BQUA 3CGIA 1SVDA 3H0PA 2XTJP 4UOHA 4HEA9 4RU9A 1AXQA 5CQGA 1KQQA 1TL1B 1EF2A 4W92B 4I2BA 4PUOB 5KFUA 4OZ1A 4KT0C 1CC8A 5A6TC 1K0TA 5HP1A 1HNIB 4ZA1A 3OTOJ 1DURA 2YH1A 3I0RA 9ATCB 3HSGA 1KS2A 5LMUF 3LH2S 2EAMA 3C23A 2KKHA 4ZPAA 4I6AA 1UEVA 7ICMA 1JUDA 2G0AA 2CPEA 4LF7J 1UPHA 2NRTA 2I9GA 2NXJA 2AJQA 9ICBA 5DBAA 3NS6A 3KJNB 5KFJA 2VBWA 2BKOA 4HH1A 3CJKA 4MT1A 2UXBF 1T4GA 2KN4A 4E8UA 5IIKA 4YD1A 3PRBA 2DY1A 3M8PA 1X2IA 3FRYA 1PKUA 5AE1A 4P74A 2DRAA 1B4FA 3SSQA 3TRGA 4WZMA 1IKVA 4F0SA 4ED8A 1AZSA 4C8LA 4UB6U 1SJ4P 1ULRA 4LJXA 3QEBZ 2F77X 5DG8A 2OI2A 4KFBB 1VQPS 4DZHA 3EPGA 4QYZJ 2MKCA 4ZPTR 3GU0A 2OPRA 2OD6A 3D67A 5KAIU 1HNZJ 4F0MA 4ZOHC 3OHAA 1VBKA 3GTYX 1RKJA 1PC4A 4PWDB 3V72A 4DFDA 2BCVA 5HI7A 3IO1A 1FWJC 4K0KF 1UZHA 1JLAA 3LAMA 2CQBA 2IFXA 2U2FA 2YX8A 1MQ2A 2EKNA 4WFYA 3Q86A 3UFCX 3RJMB 1ZQZA 8ICZA 4JB3A 3JPTA 1A5MC 3PJXA 4NLGA 3GJTB 2ZJRQ 2GQ2A 2LXFA 1U1OA 3RR7A 2R2UA 1IBKJ 3IG5A 5DKWA 4PXCA 4DYKA 3WQPA 5IINA 2YKOA 1MN7A 3CMES 3DXBA 4QZIA 4UB4A 1EJUC 5I3UA 1HI8A 1VQ4S 2I9SA 2I9UA 4E0DA 4DR7J 1C0TA 2UUCJ 3IM8A 2PE8A 1CBKA 4I2HA 2VOPA 1SWWA 5HMMA 2FIUA 4Q8EA 8ICAA 3L3FX 3D54