1IM4A

Crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
205
Chain Sequence
b'HHHHHIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DBH
publication title Crystal structure of a DinB lesion bypass DNA polymerase catalytic fragment reveals a classic polymerase catalytic domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 63
structure length 205
sequence length 209
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1im4A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 1im4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1im4A01
5EWFA 2WTFA 2YNIB 3OLAA 1NK9A 7ICRA 1LWEA 1PZNA 5J2NB 1TQLA 4GLXA 7ICIA 3LAMA 3H8SA 3DLGA 3H7IA 4M04A 9ICCA 1L3SA 3FFIA 2GWSA 3ZDAA 1TV6B 1IKYB 1RYRA 2FJWA 2I5JB 3H4DA 1C0UA 4O3SA 4O44A 4DOBA 2ASLA 3LWMA 2RDIA 5L1JA 2JLEA 4YN4A 4UBBA 3DOLA 4DLGA 8ICOA 2YKMB 5KFZA 4LSLA 2ZD1A 3BJYA 9ICQA 2CJQA 2YNGB 4R65A 1B43A 4DQSA 4ID5B 2FPKA 4QPXA 4NLZA 2OPPA 1BPDA 1QSSA 3PMLA 3CJ2A 1JLQB 5F9NA 1BQMA 2OPSA 1T94A 3M8PA 9ICBA 3MR3A 4YG2A 3GV5B 4FBTA 4WFYA 3N4MB 1TL3B 3NBPA 1SKRA 1ZQMA 3KHGA 1ZJNA 5L9XA 1TL1A 4G1QA 4I28A 5BOLA 3EPGA 5HHHA 4YMMA 3TANA 1TK8A 1S9EB 4BWJA 4ZMMA 3GV7B 3C1ZA 3SI8A 5CYMB 3SV3A 3C21A 1NJZA 3KMSA 3DOKA 8ICPA 4F3OA 3ZDEA 5DG8A 2BHNA 3HVTB 9ICRA 4WZQA 2R8IA 4QZIA 4ED1A 3FDSA 2R8KA 5J2MB 3KK3A 5DB8A 5BOMA 4Y2AA 3BQ1A 2MAXA 4WYLA 4KO0B 3I5BA 2C2DA 3QEAZ 2Y1JA 1NK6A 3I0SA 4NLQA 1T03A 4B9TA 1S1WA 3Q8SB 4JV2A 1ZTTA 4O3NA 3RB0A 1XC9A 1N48A 7ICEA 3QO9B 4ZPBA 3PW7A 3BQTA 4JUZA 4F8RA 1ZQYA 1NK8A 4MK8A 4KFBB 4WFXA 4ED7A 3CWJA 3IS9B 3T5KA 2ZE2A 3KLVA 2P66A 5EDWA 4R0EA 1BPBA 5HBMB 2JEFA 4B9SA 3JSMA 1GX5A 3CDEA 4I2HA 3BREA 1C1BB 3BR9A 4DFPA 5DDMA 4IG0B 2UVWA 3QIPB 4HYKA 1RT5B 4M95A 3RB3A 2C2EA 2YNFB 5F8NA 1ZETA 1DOQA 1D0EA 4LSNA 5EWGA 3V4IB 4MF8A 3QYYA 1C7YA 4NRUA 2RKIA 7ICOA 1TAUA 4K4XA 4UAZA 4DOAA 4DS4A 3BQ2A 3BSNA 4FS1A 4KLTA 3MFHA 3DDKA 4RW9A 1S1UB 1C2PA 1MQ3A 2WB4A 3V7JA 4NLDA 1ZQKA 5FDLA 5K14A 8ICSA 4ICLB 2YNHA 1U09A 1HMVB 3M8QA 8ICQA 5CYQA 2ZUDA 5KFNA 1QE1B 1N5YB 3DRRA 4I2GA 3LP0B 4XUSA 2FVPA 3JPQA 3Q8MA 5L1KA 4YR2A 5KFLA 2M9NA 4Q0BA 4NLGA 4QWCA 3KK1A 4I2BA 1ZQPA 4MF2A 3MEDA 2HWIA 3IM1A 2WONB 5I42B 3MECA 4QZ8A 4J9OA 3UXNA 1HQEB 3PJWA 4DSEA 5C24A 1S1XB 3SFGA 5DKWA 2BGWA 4RNHA 3AU2A 5J0PA 2ZTDA 4JWNA 3JYTA 3OL8A 1JX4A 4H4OA 4DFMA 4F5OA 1TKTB 2IHNA 4XA5A 3OJSA 3V72A 1NOMA 3HW8A 1Y88A 3RRGA 3TVKA 3IG1A 5J2GA 1BPXA 5KG2A 1U9LA 4FBUA 4DSIA 4EEYA 3CJ4A 4NRTA 3SYZA 1TKDA 1RT1A 2I1QA 1T05B 4WYWA 1R0AA 3KLHB 3KK2B 5KFSA 1JKHB 4DL2A 5BPCA 3K75D 1LB2B 3BQ0A 2IM0A 4IDKB 4U7CA 3MGHA 1LW0B 2Q0ZX 3FSIA 3KTQA 3T5HA 1FKOB 3MTKA 5KFKA 5KG0A 3GIMA 3MR5A 7ICNA 1CUKA 4B9MA 5KT2A 5HLFB 2R2UA 4Z6DA 2P6UA 3N6NA 2NRXA 2A1JB 1T4GA 4ZHRA 8ICMA 3DRPA 2B6AA 5D46A 1NHVA 3MEEB 4IQXA 1IKVA 5J2PA 4RW6B 9ICSA 2PFQA 4R5PA 3UQ2A 1S6QA 1U48A 3DM2B 3PR5B 3V6HA 1L3UA 2YNIA 2KFNA 3HHKA 7ICKA 2HHUA 3RJGA 2R8HA 5J29A 2XY7A 4ZVFA 2BCVA 3ZDBA 3PHEA 4X2BA 3RR8A 5JUMA 1TV6A 2ASJA 3MABA 2D41A 1IKYA 3RJFA 3UQ0A 4X5VA 1S1TA 3RAQA 4M9NA 2KTQA 1KFSA 5J2CA 5KTQA 2JC1A 5HROB 1HJPA 5KFMA 3C2LA 4MEXA 4WXOA 3BGRB 3H4BA 4JK1A 3C2MA 4TUQA 2XCPA 2KFZA 2W9CB 4ELVA 4ECSA 4B9VA 2FVSA 5J2IA 4ED6A 3PW0A 1U49A 4KN4A 1TKZB 2DFLA 1KRPA 2HHTA 2V4QA 5KG4A 1IKWB 4ED3A 2PI5A 4F4YA 4NLKA 1A76A 1JLQA 3LP2A 1XU4A 2ZJ5A 4YMNA 4KLJA 1SL0A 2ZJ8A 1VRUB 2KZMA 1RYSA 2KN7A 4K4GA 1ZQAA 5KFCA 3Q8LA 1SUQA 1VRTB 1KTQA 3FRZA 1TL3A 2V9WA 4QZBA 1SL1A 4O5KA 5KFUA 3T5JA 5IINA 1ZQIA 2HNZB 4K4YA 3H8WA 2F1IA 1D8LA 4NM2A 4EZ6A 3AUOA 3C6UB 4WE1A 7ICPA 4MH8A 1HNIB 3AU6A 2D7SA 4E0DA 5CYMA 2C22A 1JLFB 5KG3A 2PI4A 1ZJMA 9ICJA 2AU0A 4EBDA 4ZVGA 4ECVA 4IH7A 4F93B 5DQIA 4TURA 5J2MA 1W25A 5D3GA 2R8JA 1IKXB 3RJKA 4KLSA 1LWFB 1JLAA 4KTQA 4KO0A 4RT3A 2FLPA 4KMUA 1LW2A 3IGNA 4NLVA 5KT5A 1RZTA 2HNDB 7ICMA 3CIZA 2NRTA 4IQWA 4KN7A 4ELTA 5DQGA 8ICHA 1JLEB 1KLMB 3QO9A 2W7OA 1U47A 4TYBA 4XPCA 3GYNA 5DBBA 4NLSA 4IQUA 3V81B 1K1SA 5KG5A 4KFBA 1IM4A 3JPRA 4TY9A 1TVRB 2HWHA 4LZGA 3M8RA 4RW8B 3KJVA 3HWTA 4ZH4A 3PX6A 2AJQA 2NRZA 4B9LA 2KZ3A 3TAQA 5J0SA 4QZDA 5J0WA 3E2EA 3EZUA 2C28A 4LZDA 4I2QA 1BQNB 4JWMA 4UB1A 4M9LA 9ICEA 1RT5A 2W9AA 5KFPA 1S0MA 1EP4B 2YNFA 4DOCA 1DTTA 4C8MA 2XGQA 4F5RA 4Q8FA 3DRSB 4H54A 3I0RB 4F5NA 3EWAA 1L3VA 5F8LA 1SV5B 4ECUA 5DG7A 4I2IA 1S1UA 4YXMA 1HYSB 4I2EA 5J2JA 3OHAA 4RQ2A 4ICLA 5IIIA 1JXEA 1HMVA 3RB6A 4F5QA 4PUOB 4NZ0A 5L1IA 2BR0A 2ASDA 1RPLA 2DPIA 4EO8A 3DI6B 1ZQBA 1QE1A 3LAKA 4RQ3A 4RW7B 3LP0A 3Q8KA 4KLOA 4I27A 4DL4A 3IHQB 2W9BB 2FPLA 4P4MA 1S1VB 3DYAA 4URGA 1NKEA 2P6RA 2NRVA 2WONA 5I42A 1BVSA 3UPQA 4KLQA 4IH5A 4M9GA 1S1XA 3CDUA 4BXOA 3FQLA 4KLGA 1SH0A 2FPMA 2V4RA 3T19A 4RQ5A 4TN2A 5KFGA 1TKTA 4XO0A 1N6QA 4DL7A 1XO1A 3JPOA 1RT6B 1C1CB 1RT3A 2FMQA 4YD2A 1QUVA 5CHGA 3HVAA 4HKQA 1T05A 3KLHA 4I7FA 1JKHA 4MFFA 3H8JA 5DB7A 1ZQLA 4F4WA 3DLKB 4WFZA 4NLPA 5DB6A 2J6SA 4DS5A 5F8MA 1LW0A 4TY8B 4NLRA 3GILA 4IFYB 3KLEB 3QIDA 4GXJA 3G6XA 1KDHA 3THVA 1Z4UA 1QTMA 3MEGB 2BE2A 3RJEA 4M9HA 2HMIB 2A1JA 8ICGA 3C6TB 4ECXA 4I2PB 1FK9B 2BQ3A 4QZHA 1RAJA 4EYHB 4K4VA 4P4PA 3K4GA 1SKSA 4GC6A 4RW6A 3KOAA 3MF5A 3ETLA 4MFAA 4KLLA 1S0VA 1ZQDA 5J0QA 5L1LA 2IAJB 1S10A 3CJ0A 3KLFA 3ZD9A 3ISCA 3DM2A 4QWDA 1D9DA 1ZQCA 2B21A 2IJNA 1ZQQA 1OS5A 4F5PA 1HNVA 2B5JB 2R2RA 1NKBA 5F8HA 3EYZA 3ITHB 4PGYA 5KG1A 7ICLA 5TZVA 1IXRA 1S77D 1V9PA 2E9TA 1HPZA 2XO7A 3IRXA 5J2KA 1NJXA 5HP1B 2FLNA 4NLNA 2V0NA 2VA2A 1X9WA 8ICAA 2O5DA 4KITB 2W9CA 1ZQNA 1HQUB 2VG7B 4F4ZA 1RT4A 5KFOA 1ZQOA 4OL8A 2HNYB 1FKPB 4UB5A 4MIAA 5DBCA 1S0OA 5DG9A 2FMSA 5IILA 1RT7A 2BQUA 2Y1IA 2IM1A 4ZP9A 4RQ4A 4DQQA 4ECRA 4MKBA 4DFJA 2ZTCA 1VRUA 1RA6A 2AGPA 2XI3A 2FVCA 4PGXA 1JIHA 9ICAA 3N6LA 1T7PA 2BKEA 4UB3A 4PPXA 1RTDB 1QSLA 3HT3A 2BQRA 4RNOA 3C6UA 5KFDA 4ED2A 4IRKA 3PR4A 1TK5A 1SZPA 1H38A 4O5CA 1JLFA 3H5XA 4IG3B 1MSWD 2OPQB 3TAMB 1RT2B 3OGUA 7ICSA 4F92B 2AGQA 3CVKA 1TKXB 4Q43A 2GC8A 4KV8B 4G3IA 4M47A 1LWFA 4KAIA 2HHSA 2IM3A 3KLIA 2PFPA 5HMLA 3DLEB 3T5LA 1JXLA 1MU2B 5F8JA 5HMMA 1S76D 3PNCA 5J0OA 4I2DA 1C0TB 5C42A 4O4GB 4J9NA 2MUTA 5IIJA 3HVWA 2VG6B 3ISND 4O0IA 2XY6A 1JLEA 1RTHA 4C8OA 3FFIB 2HVHA 3KHLA 2ILZA 3RJJA 1UA0A 4ZVHA 2BDPA 2IA6A 4K4SA 4LVSA 2ZKUA 4O44B 4QWBA 5KFYA 2RF2B 3H59A 4DLEA 3TAPA 1X2IA 2EC0A 1S9GB 2UUTA 5KT3A 5F8GA 3MR2A 4K4HA 4RW4B 1BQNA 7ICTA 1EETB 5J0TA 5DDYA 4EBCA 1EP4A 1ZQEA 4C8KA 4RNFA 2ISOA 2R8GA 2F1HA 1REVA 2GIRA 2BPGA 9ICIA 1HUOA 3ISDA 3DRSA 2WOMB 2WK4A 3I0RA 3PMNA 7ICJA 1SV5A 2R2TA 2FJXA 3OLBA 4UB4A 1BQMB 2YKNA 1SKWA 2OPSB 9ICXA 1HYSA 3M8PB 4RNNA 4ECTA 4EO6A 3BSOA 1XS9D 2FLLA 1MC8A 1S49A 4NLUA 1XSNA 2IM2A 2UUWA 4PUOA 4B9NA 3NBPB 4O3QA 3QE9Y 9ICKA 3DI6A 3M9OB 5J2NA 5J2HA 1TL1B 4IQVA 4DF8A 2HHQA 3RAXA 5DB9A 4QW9A 2W8LA 2J6UA 2LYHA 4LQ3A 5DLFA 1RXWA 2OPRB 5J0YA 2BANB 3DOKB 8ICBA 4R8UB 3OL9A 3MFIA 2I5JA 4UQGA 2HW3A 4K4TA 4NLYA 9ICLA 1WCLA 3KK3B 4M6WB 1QSYA 9ICGA 1JLGB 2YKMA 3KNAA 3N97B 3PZPA 4NYZA 3ORYA 5KFEA 4LQ9A 2HHWA 8ICRA 3E01B 2YNGA 1RT6A 1C1CA 4ID5A 3SFUA 1JLBB 3JPSA 4DWIA 4RUAA 4DSLA 1TV9A 4ED0A 2FJVA 4Y34A 3DLKA 4ECQA 5J2EA 2HVIA 4DG1B 1SH3A 1EXNA 1TP7A 1Z3EB 5J1EB 5KFIA 4IFYA 1ZQHA 2OH2A 4PHPA 4I2FA 5KFAA 3Q8PB 3MEGA 2ZUBA 4Q44A 2HMIA 4YR0A 5J2QB 1ZYQA 3C6TA 4ZVEA 1XR5A 4I2PA 1FK9A 4NM1A 4KHRA 1S9EA 4J9QA 4KB7A 1S6PB 4RT2A 4RQ1A 4K50A 5CP2A 9ICPA 3BSAA 2ILYA 5JXSA 1TVAA 4M9JA 2RKIB 4RPYA 2IAJA 3BSCA 5F9LA 9ICNA 4QWEA 2VANA 3GIKA 3HVTA 4DSKA 4FS2A 4DSJA 1S4FA 3OHBA 3PO5A 8ICFA 8ICUA 3TI0A 3OSNA 2B5JA 1RTIB 3ISBA 5EUHA 4MK9A 3ITHA 2YNHB 1DLOB 3M8QB 2PFOA 3NMAA 4RQ8A 3H2LA 1KHVA 3KLGB 4K4WA 3DRRB 4ZP6A 4J9RA 3NAIA 4TUSA 4ZP8A 3LWLA 4UBCA 7ICGA 3KHRA 2IHMA 4IR1A 1HQUA 2VG7A 3KK1B 3EZ5A 3IS9A 2W8KA 4Q8EA 2FMPA 2E9RX 1FKPA 4RQ7A 4PHDA 1RXVA 3M8SA 2JEGA 4DQIA 3M9NB 5HBMA 4GXKA 3V6KA 1BPZA 3ISNC 4QZEA 3OL7A 3JPTA 4M94A 4Z6EA 1BPYA 5DBAA 1XR7A 4QZFA 2IMWP 4IFVB 1C1BA 3NKYA 3C5FA 4IG0A 4DEZA 3PJXA 3QIPA 3G6VA 3KMQA 3C1YA 7ICQA 4GXIA 3V4IA 4U6PA 1ZQFA 4R64A 3BDPA 2JEIA 1RT1B 8ICNA 1XSPA 4B3OB 1S97A 1XWLA 2HHVA 1RTDA 1S48A 3ZDDA 3NL0A 3MBYA 2IJFA 1Z00B 4KLFA 7ICHA 3MGIA 3D5MA 3N6MA 1T3NA 4UAYA 3RJIA 2IC3B 4QWAA 1ZQJA 2QE5A 3DMJB 1J5OB 3TAMA 3DRPB 3PX4A 3V6DB 1N5YA 3T1AA 3LDAA 4O9MA 3HKWA 1NK7A 4R66A 5J2PB 3QGGA 3FYHA 3DLEA 2W9MA 3RR7A 1BGXT 3LALA 4M2YA 8ICJA 2AQ0A 3C5GA 1XSLA 4PH5A 5EWEA 1C0TA 1UWBB 4O4GA 2VG6A 1HQEA 3RRHA 4KLMA 4KHMA 3V7KA 2VG5B 4NY8A 3VQSA 8ICLA 3UDLA 2ZUCA 4QZAA 1S1TB 3RJHA 2KZZA 8ICVA 2RF2A 4RQ6A 1RA7A 4O3OA 1S9GA 3PW5A 4K4IA 2BPCA 2I9GA 4KKOB 4DQRA 4RW4A 3ZD8A 3KK2A 8ICIA 1QLNA 1ZQZA 1EETA 1UT8A 3OSPA 4XRHA 2UVUA 4IDKA 1RTJB 4KSEB 5CJ7A 3TARA 2AQ4A 3T3FA 3NAHA 4MEYA 1TAQA 1FKOA 1KFDA 5D49A 2D3UA 3E51A 2WOMA 4Y2CA 1CEZA 5C25B 5HLFA 4QZGA 3ZDCA 4TQRA 3LP2B 3LK9A 9ICMA 3MEEA 4YD1A 1GX6A 3UPFA 3UXPA 5F8IA 4YCXA 2OWOA 4R63A 1U45A 1SUQB 1WNEA 4YMEA 3RB4A 3IN5A 4TUPA 4UB2A 4PHEA 9ICVA 2FVRA 4BWMA 5D4BA 1MQ2A 1XR6A 4YFKA 3JPPA 4C8LA 4WE1B 4FO6A 1LV5A 5J2DA 3LP1B 4M0AA 3KHHA 3D28A 2OPRA 2BANA 4PQUB 4R8UA 5J2FA 3RH5A 1HUZA 5DGAA 4H4MB 5KFXA 4ECZA 5HROA 4ZPCA 5EOZA 1ZQSA 3BGRA 1NK4A 9ICTA 4BGDA 5D3GB 4M6WA 5KFWA 3NTUA 5J2BA 1JLAB 1JLGA 4KE5A 1WCNA 5T14A 1LW2B 9ICHA 2JZBB 4BDPA 4QZCA 4Y3CA 1CSJA 4O3RA 1UT5A 2BRLA 3E01A 4IH6A 4I2CA 4RQ0A 1TKZA 2BCUA 4F2SA 1JLBA 3CO9A 4NLWA 4K4UA 4WZMA 5KFHA 3QLHB 4PWDB 1IKWA 3MDAA 4DG1A 2J6TA 1LWCB 5J1EA 3KJVB 1JMSA 4EBEA 4I2AA 4K4ZA 2BCSA 3UQSA 4J9KA 4MFCA 1VRTA 1KLNA 3OJUA 3CJ5A 5J0RA 4C8NA 4I2QB 5J2QA 3TQ1A 4RPXA 4UAWA 2HNZA 3PO4A 3RBEA 4DFKA 1NNDA 4RNMA 1S6PA 3QGIA 2AGOA 1DTTB 1X9MA 1HNIA 3PW4A 5I3UB 1TK0A 4NXZA 1S9FA 2IBKA 4ED8A 1JLCB 3Q8RB 3PX0A 4NCGB 4ZPAA 8ICEA 3UR0A 2D3ZA 4QW8A 4JV1A 2QV6A 4TQSA 4MFBB 4P2HA 1DTQB 3RH4A 1IKXA 4O5EA 4KLIA 4YR3A 1RTIA 3QZ8A 2WRMA 2B43A 5KFFA 3PW2A 1DLOA 3H98A 2HNDA 3QGHA 3PV8A 1T8EA 4B9UA 4ZP7A 2BCQA 1LWEB 1YVFA 3KLGA 4J9SA 5KT6A 3DLGB 1KLMA 3B0XA 4XPEA 2XGPA 3G6YA 2H5XA 2ZJAA 3V81A 4QZ9A 3DYAB 1TVRA 4RW8A 1S0NA 3GV8B 9ICUA 1C0UB 4MK7A 5CB1A 1B22A 8ICXA 4DQPA 4IRDA 4YXJA 2GIQA 4DL5A 1ZQXA 2BRKA 3GQCA 3DOLB 4BXOB 3GIJA 4LSLB 5HNKA 2ZD1B 5HP4A 4PGQA 2VA8A 4CCHA 5IIMA 1HARA 4IFVA 1N6QB 3PY8A 5DQHA 2ISPA 2XI2A 1RT3B 3M9MB 5DGBA 3H5SA 5KFVA 2OPPB 4GC7A 2AWZA 1SH2A 2I1RA 4I7FB 4B3OA 5IIOA 9ICOA 3H5YA 3V7LA 4MIBA 4MKAA 1Z00A 2XWYA 1A77A 5KFTA 4DL3A 4Z6FA 3ICLA 4F2RA 1U4BA 2IC3A 4EZ9A 1NK0A 4IRCA 4NLXA 3DMJA 5DLGA 2BE2B 4EYIB 1J5OA 1I6JA 3GIIA 4G1QB 3V6DA 1ZTWA 5KG6A 3QZ7A 2NRWA 4RW7A 4DF4A 2JC0A 3I5AA 2W7PA 1N4LA 2WHOA 5CA7A 2W9BA 1S1VA 4J9MA 3KLFB 3MDCA 4NLTA 3G86A 1UWBA 5C5JA 5HHIA 4TLRA 4F91B 5J0UA 5J2AA 1NHUA 2XCAA 1NK5A 1ZQTA 3EPIA 1HNVB 5KFQA 2VG5A 1N56A 3SV4A 5KG7A 3I0SB 1T03B 3UXOA 2C2RA 2E9ZA 1S1WB 3Q8QB 2ATLA 4KLEA 1HPZB 5KFJA 1K1QA 4DL6A 3IRXB 4RUCA 2F1JA 4O3PA 3H5UA 4KKOA 2F8EX 8ICKA 3QEBZ 4I29A 1NJWA 4TYAA 1RT4B 1RTJA 8ICYA 3RH6A 3JPNA 1QAIA 4TY8A 2ZE2B 3KLEA 2CKWA 4F50A 2BPFA 4URSA 1D9FA 1RT7B 2R2SA 8ICTA 3JSMB 1TFRA 4JV0A 4Z6CA 5C25A 3RBDA 4ECWA 5CR0A 3C2KA 3TFSA 1KFTA 1ZQUA 2XC9A 2JEJA 2DPJA 1L5UA 4IR9A 3V6JA 4LSNB 1X9SA 8ICCA 4NLOA 3GFKB 1BPEA 2FVQA 3OL6A 2PXIA 4F4KA 2AX1A 4RW9B 4KLUA 3CDWA 3MR6A 5FDLB 3LP1A 5K14B 4PQUA 4DO9A 3TFRA 2XY5A 4O4RA 4IKAA 7ICVA 3IGVA 5KT4A 4URQU 5CYQB 4H4MA 1ZQVA 4F4XA 1NJYA 5KT7A 1RDRA 1COOA 2HHXA 2ZTEA 5HP1A 4ZPDA 5IIKA 4YP3A 3KLIB 5J0XA 8ICWA 7ICFA 1L3TA 2JZBA 3HX0A 1UA1A 5CWRA 1KEJA 1KHWA 4Q0BB 3PVXA 4YMOA 2UVRA 2HNYA 3MEDB 2RDJA 2HAIA 5C42B 3MECB 4J9LA 2ALZA 2MUTB 4I2JA 3FQKA 3NGDA 5C24B 1NKCA 1RTHB 2UVVA 3GDXA 3QLHA 4ELUA 4PWDA 1D8YA 4TXSA 4YVZA 3JYTB 4RPZA 4H4OB 1LWCA 1MMLA 1AROP 4RU9A 3IG1B 4PHAA 3I5CA 4XQ8A 1JN3A 4J9PA 1ZQWA 1QAJA 5KFBA 1R0AB 4KLDA 3LANA 4KBIA 4ECYA 4WXWA 9ICFA 1SL2A 3B0YA 5KFRA 1KSPA 4KLHA 4P4OA 4RZRA 4DSFA 1REVB 5I3UA 3SZ2A 3CJ3A 1ZQRA 1JLCA 3HP6A 8ICZA 4NCGA 2PFNA 2BCRA 4IG3A 2OPQA 1ZQGA 1RT2A 1DGSA 4ZHRB 4YQWA 9ICWA 2B6AB 4MFBA 2WCXA 4IOBA 1TKXA 4KV8A 1DTQA 2YKNB 1IKVB 4Q45A 7ICUA 3H40A 2AX0A 4R5PB 3EW9A 3C23A 3RTVA 3HPOA 1D1UA 1MU2A 1S6QB 2VA3A 4IQTA
chains in the Genus database with same CATH superfamily
5EWFA 1RLDA 1BWEA 1VQSA 2H5IB 3OLAA 1NK9A 5J2NB 2KVCA 2IRXA 7ICIA 1SQFA 1PK3A 1RJPA 2YX7A 1ZM2A 3DLGA 1VR6A 2EEYA 5DZ6A 4M04A 9ICCA 3MR7A 1KD1T 2GWSA 2OEKA 3N4WA 3V5RA 3ZDAA 1JQGA 3G77A 3JS9A 1RYRA 2VFVA 1BHNA 5F3ZA 3LWMA 2RDIA 2IPOB 4C8ZA 2FY8A 2ZIXA 2BW2A 2YQ3A 8ICOA 2IMRA 3FZBA 1FXLA 1TMJA 2JH3A 2VOPA 2B0CA 2B8QA 5J1NA 9ICQA 2GAHC 1GT8A 1CJUA 2HBJA 3TUZC 4WFNQ 2BACA 2CJQA 3MM6A 4IC9A 3SEOA 4R65A 3FCVA 4JI7F 1P7DA 4QPXA 4LFCF 1FWLA 4C4WA 2J8SA 5DDPC 1REGX 2VDHA 4LRAA 2GOKA 1T94A 3M7DA 2W2OP 3TJAA 3GV5B 2CNLB 2DHSA 3KHGA 1ZJNA 1V4YA 3Q86A 4C3KA 2NR0A 2ZZMA 4AL6A 1N0UA 1F9HA 2H4YB 2RUSA 5DG8A 2BHNA 5IWAJ 1PYSB 4WZQA 5GMDA 2WF7A 1OY9A 3ET6B 2V34A 4ED1A 3FDSA 1OY8A 1UJ4A 4FPIA 5AJ3J 2LMIA 2M70A 2AMCB 1BWVA 4Y2AA 1YJNS 4QOTA 1KQKA 4KO0B 3CCQS 3QEAZ 4U95A 2JFDA 4HL9A 2EK1A 1H2VZ 4O3NA 3HXMA 5KAFU 3OTOJ 1N48A 4ZPBA 3PW7A 3J7Z5 4JUZA 1WHWA 4PEOA 4KFBB 1BQXA 4J37A 3IS9B 4F0MA 3OD2A 3KLVA 5AK5A 1BPBA 1VC5A 4B9SA 3ZNUA 1UVMA 1SB6A 1PO9A 1GX5A 1K9MT 3NGKA 3AD8C 2YTCA 5ETQA 3J7YI 2OD4A 3BR9A 3FUYA 3WKDA 5DDMA 1URRA 2F77X 3GZ7A 4HYKA 1RT5B 1RHKB 1UL3A 4M95A 2C2EA 1DOQA 1D0EA 2F44A 4NRUA 7ICOA 2I0XA 4K4XA 4DR5J 3CMES 1BUXA 4DS4A 2F8HA 4W98A 3C46A 4Y2KA 3CRXA 3ETOA 4NWIA 3I32A 2H3FA 2ZUDA 4C7YA 3RG6A 4OI0A 3TZWA 4CT9A 5L1KA 3J81U 2CAJA 2M9NA 3M2UB 4QWCA 2RSQA 2EANA 2AW0A 2YX4A 1RZMA 1VQ9S 2QS8A 2ZH8A 3OUYB 4JYAF 2LA4A 2CXEA 1JX4A 4H4OA 4QIWD 2A0FB 5HMYA 1WYGA 1UW9A 1NOMA 3BE7A 3TVKA 3LQVA 2V8PA 1BPXA 3ZZ0A 2RUGA 4FBUA 1TFYA 4CLLA 3SYZA 2LEAA 1R0AA 3KLHB 5KFSA 2MKIA 4DL2A 3K75D 4X4SA 2HHHF 3HD1A 1B4SA 3MM9A 1XQIA 4ZS6A 4I69A 3MGHA 2Q0ZX 2NSCA 2QKQA 2R7VA 3MTKA 5KFKA 5KG0A 3PDNA 1N32J 1WOSA 2LEBA 1CUKA 3T1YJ 5HLFB 2R2UA 1X4AA 3MTWA 3N6NA 1DJ0A 1KRBC 3ZFVA 2B6AA 5D46A 4A47A 4RU2A 3MDUA 1ITPA 4IQXA 1IKVA 2Y9UA 5J2PA 4C0BA 2PC6A 1Y7PA 3NS5A 2XULA 3HLUA 2PFQA 2JH7A 5BR8J 1L3UA 3RJGA 2P35A 1X4CA 3MD1A 4X2BA 3RR8A 4PQAA 2D41A 3P5BP 4CQDA 4M9NA 5KTQA 2JC1A 2UUBF 3QAUA 4MEXA 4WK3A 1PJ5A 2DRDA 4K59A 3LTOA 3F56A 5A8WB 1K47A 3V4MA 4JK1A 2XCPA 3TACB 2BABA 4ELVA 4ECSA 1RA5A 1HR0J 2FVSA 4WP3A 3PW0A 5CAAA 3PEHA 2BDUA 1OYDA 1L6NA 3KXDA 5AM4A 5ITHA 4OYAA 1IKWB 4ED3A 4LF5J 2UXDJ 2LKYA 1SQGA 1P9QC 2MGZA 5JTIA 1PYTA 1XU4A 2LBOA 5E3CA 2ZJ5A 4PKDB 4WTYA 4YMNA 4KLJA 1UFLA 3Q0AA 2EKNA 2NO4A 3WX4A 2KN7A 4OV6A 3Q8LA 1SUQA 1CC8A 3FRZA 4FYVB 2QEXS 4QZBA 2V9WA 3T5JA 5AKHA 4CLFA 4K4YA 2F1IA 1Z1ZA 4NM2A 3ZXWA 4ZVSB 3S1TA 3AUOA 7ICPA 1B0XA 1HNIB 3R5AA 2D7SA 4BCAA 3MKVA 4BHQA 2OIHA 3O2IA 4ZVGA 4ECVA 1B4FA 3LYSA 2AEFA 5DQIA 1WSVA 1W25A 1IKXB 2XZWA 1FX2A 3L9ZA 1QVFR 1LW2A 1U1LA 4PYAA 1VQMS 1Q0NA 2NRTA 4DOZA 4ELTA 3SD7A 5DQGA 8ICHA 3OR2B 3VAGA 4JI3J 1VLBA 4USAA 5DBBA 3H25A 4IQUA 2FUG9 2DBBA 4MKYA 5KG5A 2UXBF 4TY9A 4CH7A 2OCEA 3JQKA 2ZKTA 3M8RA 1YIJS 4RW8B 1SJ1A 5AXLA 1TUGB 3AHPA 4ALZA 4V1XA 4KPYA 3VR1A 3CJRA 2XVTA 5J0WA 1FJEB 2V5HG 5SZTA 2YMLA 3ZNJ1 4QIWC 2W9AA 5KFPA 1SQEA 4UUXA 2YNFA 1B0VA 2XGQA 1NO8A 4F3MA 4Y65A 3DRSB 2F3NA 4B3TJ 5HJXA 4FNIA 1L3VA 1SV5B 2NUHA 3K59A 4ECUA 5DG7A 4YXMA 1POJA 5F3XB 3LS9A 4LF1A 3M7VA 1HYSB 3OHAA 5AKIA 4RQ2A 4ICLA 5IIIA 1JXEA 2UUAJ 2H54B 4PUOB 1J5EJ 2RRDA 3DXBA 5J8YC 2DPIA 1QE1A 3DGVA 4RQ3A 3LP0A 1UETA 2UV8G 2BJ9A 1WOPA 2WW4A 2OFGX 4RWWA 1V3SA 4JI8J 2W2NP 1F3FA 4DMZA 3AODA 3CC7S 1RWXB 4AQYJ 3GTYX 1NKEA 4EMDA 3GRIA 4CDIA 4URGA 2GFFA 3DC2A 3KG0A 3W64A 5I42A 1BVSA 2ZOGA 5LJ5Y 2E5LJ 1X42A 3CJ8A 3SFWA 4KLGA 3N7SC 1SH0A 3EWGA 3P96A 2V4RA 1I94J 3I31A 4QR0A 4RQ5A 3GJTB 4TN2A 2KO1A 2ZVIA 4XO0A 1TAMA 1CRXA 3DFEA 1N6QA 3EGVA 2CDRB 1FESA 1C1CB 2FMQA 2V8DA 4CIOA 5CHGA 3A3NB 4HKQA 1T05A 4W92B 1Q5VA 4MFFA 3H8JA 3IDWA 2FGCA 2IOFK 2LKZA 1IJFB 5DB6A 2XMMA 3MMCB 1LW0A 3ENAA 2V2KA 2RNEA 3GILA 4IFYB 1RJRA 2FJ6A 2VFUA 2JSXA 1QTMA 3MEGB 3ZTPA 1WHVA 3VWSA 3AH6A 3WK4A 1N60A 2Q1LA 1M6YA 4P4PA 4CNTA 2FZKB 1SKSA 4GC6A 3WKCA 2PO4A 3MF5A 3ETLA 2ZOFA 4KLLA 2IAJB 2ZH3A 1U6FA 1RK8A 2QLTA 2C2OB 1QD1A 1GH8A 1Q82T 1HBOA 2KKPA 2QMUB 2XI9A 1VIXA 2OXOA 1NKBA 5F8HA 3ITHB 4PGYA 3R9LA 3MAAA 3VTIA 1HPZA 3MM5B 3ZZTA 2LDYA 3FC9A 1VDHA 3TVYA 4ZLPA 4ES1A 2XO7A 5J2KA 2FLNA 2YKAA 5IT4A 3PG9A 2WAQF 2KRBA 1FWEC 8ICAA 3NS6A 3AQFA 2FVMA 3OXLA 2C2KB 1N63A 2W9CA 2RJZA 2KXFA 2QIFA 2QA4G 2VG7B 1YBAA 2PEHA 1IBMF 3E0FA 3O1LA 4L72B 4MIAA 1QH9A 2OI2A 3AA9A 2RHSB 1T02A 1L7MA 3M30A 4ZP9A 1A7GE 2R7UA 2C3UA 1FHTA 4HHUA 1PC5A 2JFKA 4ECRA 2FGOA 3M05A 4UARA 4WU2A 4P71A 2AZ3A 2QLBB 2ATCB 1VRUA 3K89A 2AJ0A 1RA6A 3GYGA 2AGPA 4QBUA 1E6YA 3OOQA 1JIHA 2CQDA 2WB1F 2N3LA 4UB3A 2DH9A 4PPXA 2F4VJ 1VQ7S 1S8OA 2BOAA 4C0HA 3TZZA 1F9EB 2JRZA 4DPYA 3RW6A 3PR4A 4ILRA 3TRGA 4EWTA 5LMUF 4EPDC 2OPQB 2KMDA 2OAUA 3OGUA 2HBRB 3T6BA 4F92B 3U1NA 2W4DA 2O01C 3ZZOA 4M47A 1LWFA 4F0LA 5HMMA 3HFVA 2X1AA 1UBPC 3W9HA 2BW7A 1KVJA 5C42A 4I2DA 2LDIA 3QRRA 4J9NA 4ZK7M 2VG6B 5ETTA 3ISND 1JLEA 4ZOHC 1NDCA 3EGNA 2KM8C 1R8CA 3RJJA 1F0XA 3CO0P 4Z37A 1UA0A 2V50A 1T9XA 2IA6A 2ZKUA 3N28A 3ZTOA 3N7PD 2RF2B 4DLEA 2BKNA 1I51B 2ZBIA 4J7CA 1S9GB 3BQ7A 2CVEA 3K1RB 4K4HA 4RW4B 4ZPVR 2KU7A 5DS7A 2OGJA 2P9EA 3SCJE 1IWAA 1EP4A 2HQFA 4C2MA 1FWDC 3MM7B 2ZZNA 2ISOA 2D6FC 1EARA 2F1HA 1X0PA 3BN7A 2GIRA 4J03A 3R1HA 1LFWA 3C15B 2Z2LA 7ICJA 2R2TA 1FWPA 2YWKA 2FJXA 3PEJA 2JWNA 2W7AA 3GB0A 1R7IA 4RBTA 3H8YA 2JJ4D 1ZAXA 2G9OA 5H9EJ 5A8RB 2YKNA 2OPSB 1R6VA 4ECTA 2PEBA 3NWRA 4ZA1A 4B9NA 1K8AT 3NBPB 4OYPA 9ICKA 5ETNA 3POTB 1OJ4A 5ALUA 3HHNB 3RAXA 5G5GA 4A4JA 2W55A 5FLXU 3HJVA 5IM0B 4P75A 4JI5F 2OPRB 2BANB 8ICBA 1G1XA 1K70A 2N7YA 2XS2A 2CQBA 5EE1A 5JJBA 2EG1A 5CHCB 3KK3B 4M6WB 4JB3A 1VC6A 2YKMA 1N5SA 1RHQB 3A3OB 1XN9A 3N97B 3PZPA 3ORYA 2D3O1 4C60A 5KFEA 4LQ9A 5T7LA 1UVIA 8ICRA 3TKAA 3E01B 4B3RF 2ZC3A 4ID5A 2MB0B 1JLBB 4DWIA 4RUAA 4DSLA 3SSQA 2DKZA 4ED0A 4Y2SA 2C3MA 2FJVA 3DLKA 2HVIA 4DG1B 4UW2A 2LPEA 4OJ3A 1Z3EB 5AM5A 1B7FA 2OH2A 4F0KA 4I2FA 2J9CA 5KFAA 5A76A 5E3RA 3KYLA 4HLBA 2N1RA 1RJQA 3D6MB 1YBUA 4TVAB 1YSJA 2Z2YB 4KB7A 2DR8A 2V8VA 1FTCA 3R1LA 4N8NA 3KJFB 4K50A 3WKEA 9ICPA 2L9DA 2QB1A 1OY6A 4M9JA 2RKIB 3IBWA 4RPYA 3BSCA 5F9LA 4LUBA 9ICNA 1ZS6A 2YWGA 2FHJD 3HVTA 2MSNA 8ATCB 2LYVA 1AA1B 2F8MA 2GA7A 3ILLA 4OZ2A 4RJVA 4DPOA 4WCEQ 3PO5A 3K5LA 8ICUA 1NDLA 2B5JA 5EUHA 4HH0A 3Q23A 3H0MB 2H5JB 3T6JA 1AYEA 4WIIA 1X4HA 2GJIA 5K8OA 4Y00A 4RQ8A 3TA0A 3H2LA 1F5SA 1J6PA 2FIUA 3NAIA 3F2BA 1CG2A 4JV5J 2YKOA 1ZAVA 2FB0A 4YFUA 4IR1A 2DGWA 1HQUA 3F5EA 4PG6A 3HFZB 2WF5A 1RACB 3O6QA 1FKPA 3ILOA 1U0SA 2DHXA 3F2DA 3ISNC 4QZEA 2KNJA 2APOA 3OL7A 2K89A 1BPYA 2P9BA 4QZFA 1OXJA 3I4HX 1TELA 4IFVB 1C1BA 3NKYA 3C5FA 4DV2J 3PJXA 5L38A 3G6VA 1MN8A 2HBKA 3HVRA 3KMQA 5AKXA 2ICSA 3V4IA 1ZQFA 2KKHA 4XK8C 1H7WA 1XSPA 2RH3A 2DY1A 2HHVA 1TL7A 3FEXB 1RWWB 3NL0A 2PMHA 2CQGA 2EDUA 7ICHA 3D5MA 3MGIA 3GR0A 3IWLA 3UN3A 3D2NA 3DMJB 3KUGA 4UOCA 3PX4A 2GVDB 3S6EA 3FVYA 5E0OA 2WVDA 4O9MA 4YIWA 1NK7A 1UJ5A 4LF6F 2PD1A 3DLEA 1N5TA 2W9MA 3RR7A 4HT7A 3LALA 4M2YA 8ICJA 4R85A 5GAGI 2AQ0A 1RAKA 3HHLA 1XSLA 5HR6A 4PH5A 3OTOF 4R25A 1RB0A 2M3DA 3K2YA 1N34J 2JMGA 2E7WA 2VBXA 1HQEA 1N2XA 2JVOA 3P45B 2N3OA 4KHMA 3GMGA 1RADB 1HD0A 3MM8B 4OZ5A 3VAIA 1S1TB 5DM6Q 5DRKA 4N8OA 1M5HA 4U7UK 3PW5A 4K4IA 3OV7A 2OOFA 2RP5A 4KGZB 5AKEA 4NMXA 4DQRA 2HSZA 3ZD8A 3KK2A 3GIRA 1EETA 2QT3A 3OSPA 1L3KA 4KSEB 3NAHA 4ED4A 2CZ4A 4B17A 2GQ2A 3PCOB 4LF9J 4NI2B 1WF2A 5C25B 1JNZB 4C0OC 2AEMA 3ZDCA 2MQQA 4V19J 2KM8B 1OQ6A 2HCFA 2LECA 2BKOA 1VBYA 2HBZB 2OWOA 2OJ3A 1EX8A 2HS4A 1ZD3A 2CJ9A 5IQQA 3LSBA 2DKOB 4BWMA 1MQ2A 1FWCC 3N2CA 1FJGF 1WF1A 1YJ7A 5DO2A 4DPTA 3FBBA 5ETRA 2JDJA 2VOOA 2K8AA 4WE1B 2W2QP 2EZXA 3LP1B 1JJHA 3PYDA 4PQUB 4R8UA 2HVDA 5DGAA 1PAEX 5L9NA 5KFXA 3W65A 5ALSA 5IT9Y 5EOZA 1ZQSA 4XAKA 1M5KC 5AK4A 1NK4A 9ICTA 1NLKL 1N5XA 4ZIWA 3DHXA 5B0BA 1WCNA 2QRRA 5ALEA 2JZBB 2MLZA 1CSJA 1M5OC 4NZ7A 4IH6A 4KGKA 3B82A 1TKZA 1D8ZA 2BCUA 4GKKJ 2AYEA 4NL9A 2CPIA 1HEKA 4H4KC 3QLHB 1IWGA 2QN6B 3MDAA 2KJVA 1T3OA 3MMAB 1N32F 4LT6A 1Q86T 2K4IA 1HFEL 4EBEA 3T1YF 2BCSA 1EJRC 3A13A 4MFCA 1VRTA 4C8NA 4I2QB 3KOOA 3TQ1A 4RPXA 4Y2RA 2HNZA 4DFKA 1NNDA 4EUVA 1LKYB 4BKNA 1YRUA 1S6PA 2AGOA 2Y9TA 1DTTB 2G08A 1X9MA 3A8IA 5BR8F 4RBVA 4DCPB 1YZ6A 2IBOA 1S9FA 4HACB 1WG5A 1T9TA 3DRXA 4NCGB 4OZ3A 3B78A 2J76E 8ICEA 2K1RB 4NYPA 1MMDA 3QGKC 3Q89A 1DTQB 3RH4A 2ALYB 4YR3A 1YZ7A 1RTIA 2B9EA 4F71A 4ENOA 5KFFA 2NYIA 1G3OA 1FE0A 3QGHA 4P6QA 3GCWP 3B9JA 3KLGA 3QAEA 3AQPA 4J9UE 3DLGB 3B0XA 2DNZA 4JI2F 3G6YA 1HR0F 4QZ9A 2ZH4A 3BBCA 1TVRA 2LM4A 1ZQ1C 8ICXA 2HZAA 3EM1A 3D4JA 3BS7A 4DL5A 4OZ0A 4LF5F 2ZIXB 3FSXA 1O51A 5HNKA 3GR1A 4PGQA 4CM2A 4OJLA 1TUWA 4CCHA 3JQJA 1HARA 1CJUB 3K5MA 4WP9A 1PUZA 2XI2A 1DRGA 2DGOA 4OHZA 3M9MB 5DGBA 1XMBA 1JROA 3H5SA 4GC7A 4Q5VA 4I7FB 5IIOA 3FAHA 2F8KA 2X1GA 1N33J 3TYTA 4NX9A 1HI1A 4MKAA 1Z00A 2XWYA 3PJ9A 2BM1A 2MZQA 3TX8A 1XMOF 4IOAQ 2IC3A 1YLXA 3HMJG 1RISA 2HLTA 1SB3C 2BE2B 3W2WA 1J5OA 2B9YA 3EE3A 2PMZD 4ZDNA 2JC0A 3I76A 1N4LA 2WHOA 3U1MA 2RQ5A 2ZHOA 1S1VA 3WDOA 5E3AA 4BC9A 2CPDA 1UWBA 5C5JA 4Y2MA 4JI3F 2VUGA 2X51A 4F91B 5J0UA 5J2AA 1Q8LA 2R4FA 3D6FB 2XCAA 3EPIA 1HNVB 1Y3KA 2FZGB 3BGLA 3RZAA 4B3SJ 2WBRA 3SV4A 3F41A 2ATLA 3OTQA 4KLEA 2CQ2A 1WWUA 1G7CB 3P8BB 3KFWX 1HIYA 3WKBA 3TA2A 1UW4A 5AKJA 4O3PA 1T9VA 2XSFA 4OI4A 3KFUF 1X5TA 4OHWA 2NXCA 4I29A 1GNKA 1N36J 1NJWA 2YY6A 1LNQA 2RU3A 4P2SA 3QU9A 2V8GA 5H9FJ 3KLEA 4QPTA 2RD5C 1D9FA 1RT7B 2R2SA 8ICTA 1L7NA 1HW8A 4JV0A 2KD1A 2IYGA 1SIZA 4BX9C 3RBDA 2CDQA 3TADC 5CR0A 3AA8A 2XHCA 3TFSA 1KFTA 1HHTP 4S0MA 3DDIA 4UB8U 2UUAF 1L5UA 2Z30B 5BYSA 1J5EF 2M7SA 1BPEA 3AMZA 1HI8A 4ZLLA 2MTLA 1UPPA 3NEKA 3OL6A 1IVZA 4BS2A 2GO7A 1FRHA 4US9A 4F0SA 2CPEA 3EGZA 4AQYF 3Q8UA 1FTRA 3VAJA 1VDVA 2DHAA 5JMNA 2XY5A 3LGHA 1NJYA 1URNA 4A8EA 2ASYA 1GXUA 3JB9k 1COOA 1I94F 3QGAC 4AYBD 3PSFA 1DZ5A 1ZOLA 3KLIB 5J0XA 8ICWA 3L7OA 4F0RA 3EVOA 5CWRA 1KEJA 3S6JA 5HMXA 3SCIE 3CYMA 2UVRA 5HQMA 2HAIA 2MZSA 1KQQA 4OLOA 4P0QA 2ZWOA 2K8BB 4FZNA 4ELUA 4PWDA 1T3QA 4H4OB 2QFJA 1F2HA 1YDLA 2BYCA 3R9KA 5J1PA 1LWCA 5LMNJ 4RU9A 3D0GE 4PHAA 4XQ8A 4CF5A 1JN3A 1KRCC 4J9PA 3BZQA 1QAJA 3IA0A 2DNLA 5AM1A 2QL5B 2RIJA 3ED5A 1R0AB 2HFVA 1NDKA 3D6NA 2RVJA 4P4OA 1REVB 5HL7Q 3L4BC 1JLCA 3CJTA 1ZBTA 1VQKS 1Q4RA 5C0YA 3WK7A 2B6AB 5LXYA 1TKXA 4Y2JA 4B08A 1IKVB 2CJBA 4PZOA 3K5NA 7ICUA 2AX0A 3EW9A 1W26A 4KQNA 1DAXA 2QB0A 4IQTA 2VV5A 2WTFA 5HSPA 1GMWD 2K3KA 1LWEA 2LXUA 1PZNA 1ACMB 2Y0BB 2JOQA 4CH0S 3LAMA 2PMZC 5B0GA 4P0PA 3ULHA 2VQFF 1QJHA 1M7JA 2C2ZB 1OPZA 2XMKA 3S7RA 2YPYA 2VIXA 2C2MB 4X4NA 3GJQB 2GGPB 3MPWA 4O44A 3N01A 4DOBA 5L1JA 3CMQA 2QO3A 1N5VA 2AF6A 3QJJA 2K60A 3KD3A 2HBMA 4LSLA 1LQ9A 1D09B 2FY1A 3AN1A 3GZFA 5FJ4A 3CCVS 1HNWJ 4CLUA 4KT0C 2CRXA 1KOOA 2KI2A 1Z1BA 2W2MP 1NSAA 2EZYA 2OPPA 2IIHA 2F4VF 1BPDA 1OMSA 1PSDA 4WKYA 1KVKA 3G9CA 2AV5A 4TU9A 5E33A 4B3ZA 5D15A 2FQQB 4MT1A 4MJKA 2MGZB 1BQMA 2HS0A 3IFEA 2EC2A 1NHKL 3AXMA 4WFYA 3N4MB 1GFWB 4KH0B 1B0TA 2DEIA 1SKRA 5L9XA 3TX0A 5BOLA 4CO5A 3EPGA 4LBHA 5ALWA 1S9EB 4BWJA 4XTTA 1N5WA 1DK3A 3GV7B 3IV8A 2QLFB 3DOKA 2DISA 3ETMA 4F3OA 3MUVP 3QUQA 2ADBA 1IV8A 2H3QA 2HOIA 2A19A 5GTIU 2R8IA 3EUNA 1UHUA 2XSJA 4LRCA 3R6GB 2ODGA 5K4LA 1H0HB 5DB8A 4USKA 2RILA 3QQCD 2MAXA 3I5BA 1FX4A 1NK6A 3QPIA 1S7HA 1VHFA 4ZN1A 4NLQA 1T03A 2DR6A 3Q8SB 3DDNA 1TUVA 3QFWA 1ZTTA 2HLUA 3NGRA 3QSYB 1XC9A 4M5MA 3F44A 2K4PA 7ICEA 2NZ4A 3BQTA 2QC3A 4HI1A 4MIWA 1KW4A 3G87A 3W1YC 4V1Ak 3N5BA 2VJVA 3ICXA 2ZE2A 3SQGB 5ALTA 5EDWA 1B99A 5HBMB 3JSMA 4ZVTB 3D3BJ 1KN6A 1ZM4A 2XLKA 3CCSS 1T9UA 4IG0B 1WEZA 3QIPB 4U7UD 3RB3A 3TWZA 2YNFB 1ZETA 4ZOSA 4LSNA 4WGXA 4LBPA 1A0OB 1DURA 3BQ2A 1FO1A 1FEEA 1BLUA 3B4MA 4KLTA 2HK2A 4RW9A 4OI1A 5K8MA 1KQGB 1C2PA 1MQ3A 2WB4A 4NLDA 1ZQKA 1FWFC 2V67A 4PG5A 4ICLB 2YNHA 8ICQA 5CYQA 2Z7JA 2DJWA 3C3LA 3DGPA 1QE1B 1ONXA 1UKUA 3DUGA 1N5YB 3DRRA 3LP0B 4XUSA 2FVPA 2LXFA 5HAOA 1F5BA 3QBCA 4YR2A 1P1LA 1WKLA 4ZJQA 5AK3A 1VS3A 2EFOA 4Q0BA 4NLGA 3KK1A 2NUUG 4MF2A 3RUBL 2HWIA 5I42B 2VD3A 4J9OA 3PJWA 4DSEA 5C24A 1PGZA 1WG8A 1XNRJ 3UDEA 4DV6J 4C97A 2VL1A 2BGWA 4G65A 2ZTDA 3JYTA 1MWYA 2IVYA 2RQMA 1R6YA 1D9AA 4F5OA 1I1GA 2IHNA 3K1ZA 5ALIA 2FYXA 3V72A 4Y2TA 3FEQA 2Z8QA 5J2GA 5KG2A 4LVOP 4W4MA 2DO4A 2C42A 2HIYA 1HNZJ 1BC6A 4M5JA 4NRTA 3AOBA 1FFUA 1NSQA 4ZKAA 1T05B 2DRBA 4WYWA 4EEKA 3BQ0A 2XMWA 2IM0A 1S57A 4U7CA 1Q1KA 1LW0B 2B7CB 3FSIA 3KTQA 3T5HA 1FKOB 4OZJA 4NCAA 4RR5A 2F8LA 3UDCA 3X1LB 1RTZA 1UVLA 7ICNA 1UZDA 1T4GA 3DRPA 1FO4A 1FF2A 1U2RA 1NHVA 3F0NA 4LR7A 3AQOA 4R5PA 2MMYA 3Q22A 1U48A 2RRBA 2YNIA 2CNKB 3KNGA 3R7NB 4JV5F 2XY7A 1HBOB 3D6HB 1SJRA 1M5SA 3OXFA 5JUMA 2ASJA 2FDNA 2DWQA 4N77A 3RJFA 4X5VA 3RAQA 1KFSA 3MAAB 5KOWA 3C2LA 4MTPA 1RJJA 5M2RA 1KVIA 2WHEA 3BKUA 2MQLA 3FCHA 4DV2F 3NG8A 2HAFA 3VGUA 2DB1A 4ZJLA 2W9CB 4OD0A 1LVHA 1NPRA 3DOMA 3N0VA 3MPDA 2VFSA 5HN0A 1KRPA 2JL9A 3AFGA 4FXWA 5G4HC 1WEXA 4K2JA 3M30B 2UZ9A 2B4PA 4F4YA 3DCAA 3KKFA 4OYOA 3LVVA 1A76A 3LP2A 3HFKA 2DT9A 3IG8A 2ZJ8A 1VRUB 4Z7YA 2KZMA 1A5NC 4RUHA 1SJ4P 2VHGA 1E6YB 1TL3A 1HQ2A 5KFUA 2UUCF 1Y4ZB 2XYPB 3H42A 3NRWA 4MH8A 3FBEA 4KHPJ 2ZDPA 4E0DA 5CYMA 1ZZFA 3HD2A 1N34F 2C22A 2H1YA 9ICJA 2AU0A 4IH7A 1TTHB 4F93B 3PRDA 3QT7A 1FWGC 5J2MA 3GYXB 2R8JA 3OT9A 1LWFB 2IOHA 1JLAA 3BYRA 4C8YA 3OTBA 1Z2ZA 4ACOA 2AXTU 4RT3A 4KMUA 3IGNA 3KDOA 3EUB2 1RZTA 1UP1A 1VK3A 1S72S 1RWVB 2Q6BA 2F65A 1JLEB 2VF3A 2MY8A 1U47A 2Q66A 2LA6A 1PVQA 1VCTA 3GGMA 5TISU 3M4XA 1OSCA 1K1SA 5H2FU 3JPRA 2ESEA 2HWHA 4LZGA 3KJVA 3J81j 4LF9F 3PX6A 3WBZA 3TAQA 5J0SA 2NV3A 5ALXA 2ZIWB 2C28A 2YMQA 4LZDA 2R42A 3H0PA 1JMTA 3HF5A 3NGUA 4JI4J 9ICEA 1O08A 1EP4B 4DPUA 2VFRA 1R9YA 4C8MA 1MN7A 4F5RA 2PSZA 5E3QA 1KBRA 2ZXHA 5F8LA 4DX8H 2DK2A 5HMZA 2G0IA 1O8BA 1M5VC 4L3NA 1WHYA 5CABA 3W7BA 2MA1A 4I2EA 5D4NA 1YBTA 4ZIVA 2I8EA 2AYBA 5L1IA 1FRKA 2ASDA 1RPLA 4EO8A 3MURP 3THPA 1ZQBA 4RW7B 3K8VA 1V5IB 3GU0A 5A0YA 2M0GB 2ZZTA 2W9BB 4CTAB 2VONA 4P4MA 3K5PA 4F26A 4ATNA 1HL6A 4GKKF 2WONA 4CYUB 2XM3A 3UPQA 4ZLNA 4IH5A 1S1XA 3FQLA 3G82B 1COKA 2FPMA 3M6WA 2G3FA 3T19A 2BKPA 2AJ2A 2HFUA 1WF0A 1P27B 1RGVA 2QA2A 5ALOA 1XRFA 3JPOA 1RT3A 2WZ1A 4YD2A 2LM1A 1NFGA 2W3SA 1QUVA 1RK5A 4NEYA 3K7RA 1JKHA 4UY8T 4F4WA 4ZPWR 3DLKB 4WFZA 1IR1A 3UNYA 3MMBA 4DS5A 2ABYA 5AIBA 3BZCA 4GXJA 2MKCA 3THVA 5K8PA 3Q8VA 4M9HA 2A1JA 4NWBA 1K73T 3PFEA 1NPKA 3NNCA 4ECXA 4YY3J 2BQ3A 2F76X 1RAJA 2WAQD 3OVSA 2WVCA 3K4GA 1EAYC 3KOAA 4RW6A 2BJ3A 2ES6A 3M8WA 1GO3F 1Z4OA 1ZQDA 5HI7A 5J0QA 3CJ0A 3KLFA 3ZTRA 5KL1B 2QSWA 2KL8A 3K8WA 2B21A 1A5MC 1ZQQA 4G7EA 3JXOA 2CFXA 4MHVA 1V6HA 2K8CB 2GHPA 3I55S 2I9UA 1J27A 3CCJS 4F5PA 2B5JB 2DNMA 4K2XA 3QATA 1NRKA 2ZIVA 3AOAA 3QU5A 5AI6A 4Y6IA 2E1FA 2XG8A 5LM7E 2KFYA 5I4MA 3IGHX 2CPHA 1KNZA 3IRXA 3GIQA 3A1YG 2GS8A 4BJQA 1FWAC 2O5DA 4PWUA 2KHDA 4KITB 1HQUB 4LJMA 4F4ZA 1RT4A 4JI1F 3LUYA 1ZQOA 4DV0J 1FKPB 1JRPA 1N8RT 2K7JA 4NCBA 2BJEA 1S0OA 5EX0A 2D8CA 2KG5A 1FDNA 2KVIA 4KH1B 1ZPVA 2IM1A 1N33F 4RQ4A 4HEA9 2F1FA 3OFHA 3VHQA 2KYXA 1CULA 4NXNJ 5E5NA 2ZTCA 4LR8A 2JX2A 1SV0C 1PBUA 3QU2A 5CH7B 2M2BA 4PGXA 4EPBC 2FDRA 1FD8A 3N6LA 4AL7A 5FIIA 2X1FA 2BQRA 4A8XA 2JZ5A 4RNOA 2XMAA 2LQ8A 4IRKA 2QLXA 1U8SA 2D9PA 1JLFA 3H5XA 4N7TA 2E8OA 2DITA 3HO1A 4L76A 2AGQA 4E2FB 1MNEA 4G3IA 2JNJA 1U02A 2IM3A 2PFPA 5HMLA 3DLEB 4M5DA 1JXLA 1MU2B 2W11A 3HHLB 4GVBB 5CA5A 2I6WA 4KMOB 3PNCA 3MMJA 1R8PA 4WWSA 5J0OA 5SUHA 1QVGR 1VIOA 3ZZZA 3HVWA 1FEZA 1NH8A 3FFIB 2HVHA 3DN9A 1G6BA 5HMDA 4Y2UA 1Q78A 4TLQA 1N0VC 3F73A 3VCDA 4K4SA 2AZ1A 3VCBA 5KFYA 2RLTA 1X2IA 2EC0A 2V2ZA 3QNMA 3ONNA 2B4VA 4YB5A 3BV8A 1EETB 3BS9A 1Z4NA 3SCKE 3BH6B 3GP9A 1YJ9S 2R8GA 5GAHU 3SQIA 2BPGA 4KX3A 9ICIA 2UBPC 3T1HJ 2UU9J 1UCNA 3QX7A 2LMRA 3DV9A 5JU5A 3PHTA 1J2MA 3OLBA 4QIWF 5ADZA 1Z19A 4X65F 1CJKB 1R27B 4DX7A 3M8PB 2M9KA 3BSOA 2FLLA 1S49A 4NLUA 1XSNA 2IM2A 2UUWA 1POKA 2CA9A 2VKRA 4O3QA 2MZJA 3DI6A 3M9OB 3CT9A 5J2NA 5J2HA 1TL1B 4FZVA 2JV3A 2QYCA 5DB9A 4QW9A 2P8IA 4EX6A 2WAQC 2G06A 1NPPA 1FNMA 3UCUP 1UTAA 1RXWA 5J0YA 3EMTA 4R8UB 3IMQJ 3KKAA 4UQGA 2L9NA 2HW3A 4K4TA 4NLYA 9ICLA 1RLCL 2DNPA 2IJRA 2EAOA 5LMNF 2R7WA 4NYZA 4X62J 3PYGA 1YTYA 4C7ZA 1N54B 1RT6A 3IRWP 4A8WA 1S99A 2EFGA 1XEZA 3JPSA 2DH8A 3UI3A 4ETXA 2KOBA 4Y34A 1P1MA 3AJ1A 5J2EA 2ZUAA 1EXNA 1JALA 1CS4A 1S6OA 3NOGA 1F5AA 5KFIA 3C16A 4QR2A 1WSRA 1E6VA 2MKKA 1PG5B 4HTIA 3H20A 5D0GA 3BYPA 3L3CA 1GXLA 3C6TA 2F5GA 1HBNA 1FK9A 4NM1A 1VRQC 4RZBA 1S6PB 5AM0A 1KOHA 5CP2A 2CPJA 1EJSC 3N5FA 4P52A 5JXSA 1Q8KA 4QWEA 3GIKA 2JR5A 2JVRA 4DSJA 5AXMA 3O3LA 3OHBA 3OSNA 2HGLA 4OX9J 1RXOB 4WJ3B 1RTIB 3ISBA 4AT1B 2QL7B 3AJ2A 2QLJB 1SBRA 3M8QB 2C3OA 4U67Q 4CLYA 2PFOA 2EFPA 1KTVA 1CJTA 3B54A 1KHVA 3KLGB 2UXCJ 2ZDOA 3JSRA 4W90B 5B0DA 4ZP6A 4J9RA 1N88A 4TUSA 4ZP8A 3D7SB 3LWLA 2HFZA 2KIVA 1HNWF 2IHMA 5GMKa 3EZ5A 3IS9A 2W8KA 4P74A 2E9RX 3MGJA 3NNHA 1RXVA 2JEGA 3M8ZA 4DQIA 3QMQA 3RN6A 3V6KA 1BPZA 2OTJS 2B7BB 3UMBA 4M94A 1WC0A 4OIXA 4DR6J 3UO0A 1ZD5A 1PVRA 3KZIU 5DZ7A 4DEZA 3RBZA 5G4DA 2R18A 1JB0C 1IN0A 3H7HB 3UVJA 3BN4A 1F60B 4R64A 3BDPA 1RT1B 5EHHA 3C28A 1U1KA 5A0LA 1S97A 1Y5NB 2D3OR 1Q16B 1URJA 3WC2A 1TL5A 1Z00B 4KLFA 1SWVA 2J9DE 2YB4A 4UAYA 2KRRA 3RJIA 5B08A 3TUJC 1VOMA 2IC3B 4QWAA 1TZ0A 1ZQJA 4USHA 3QRQA 3W2WB 2PAJA 1X8DA 1J5OB 3TAMA 4LSZB 4GO7X 3T1AA 3LDAA 4F36A 1RAIB 3C29A 3MD3A 3FYHA 1V97A 1SGGA 2DNQA 1RYUA 2PT0A 3IXQA 4IL6U 4M5NA 2HIQA 1WG4A 3H90A 2YB1A 2R9LA 1C0TA 1UWBB 4O4GA 2AD9A 4F72A 2KHCA 2W1BA 4DN9A 4J90A 1R31A 2LQJA 2W3RA 4TU8A 1XERA 1AW0A 2RAQA 3DXSX 1Q3UA 4UB6U 4PABA 4C3LA 4QZAA 1GKRA 3QU7A 2ZHAA 2KZZA 8ICVA 2D74B 1S59A 2XLJA 4N56A 2KV2A 1OW5A 2QARB 4RQ6A 2BPCA 4DFDA 5GAEI 2KEYA 1IQZA 2UVUA 2IRUA 1EF2A 3T3FA 3CJKB 4MEYA 2HBQB 1VYAA 2VASA 3CB4A 4F04B 3ICJA 4YDDB 2D3UA 3F2CA 2WOMA 5D6GA 3QWPA 5HLFA 8AT1B 3BR8A 4BC7A 4QZGA 4TQRA 1NUEA 1GX6A 2EI5A 2QX0A 4HR2A 3UXPA 2PA8D 5F8IA 5E41A 4PL1A 1HNXJ 3HSJA 4L6V3 4NLBA 5IXUA 2MKHA 4DV5J 4UB2A 1NZ8A 3CUNA 1GQEA 2FVRA 3WK9A 4UZBA 1UVKA 2E1RA 2ZH5A 2QLWA 1ZZNA 1LV5A 3D28A 1X5PA 3RH5A 2ZVSA 3VF0B 4J5OA 4DV6F 1XNRF 2PFDA 5HVGA 2JLFA 2FHMA 3EX7B 4BGDA 4UATA 5D3GB 2FJBB 2OM6A 3FSYA 5M2PA 3QNWB 1JLGA 1KQSR 3KG4A 3R5BA 4Y3CA 1HNZF 1UT5A 2BRLA 3F53A 5ALQA 4CLZA 5AE1A 4I2CA 3VAKA 1N5QA 4F2SA 4WK1A 4P0QB 3CO9A 3WKAA 3MOJB 4DR7J 2VKQA 4PWDB 1IKWA 2AEJA 4FVCA 3ZI4A 4Z42C 1PKUA 2J6TA 4KGMA 3TNVA 4QNLA 1LWCB 1FRLA 5J1EA 1JMSA 3CNHA 4CEXC 2OHFA 3R97A 5LL6d 2DNHA 1XTZA 4DV3J 3MXHP 5MAOA 4G1PA 1T9WA 2J7WA 2E1MC 3NP5A 3RBEA 3SMZA 3QGIA 1VJWA 2HFSA 3CD6S 1HNIA 1TK0A 2E1EA 4X4QA 4ED8A 1JLCB 3PX0A 2RS8A 1LXJA 4QIVA 3M32B 1RM6C 1X9XA 1DK2A 2D3ZA 4RQNA 4P2HA 1IKXA 4MAKA 3LVWA 2X3GA 1QAXA 4KLIA 3DLHA 3PW2A 1DLOA 2XNRA 4O23A 4M5LA 2MKYA 4B9UA 4ZP7A 1LWEB 2E3TA 3FJ2A 1PC4A 4P73A 4J9SA 5KT6A 3HJEA 3OW2R 4P0PB 4DV4J 4WHBA 2XGPA 2H5XA 2CRLA 3DYAB 4RW8A 1S0NA 4RUBA 3GV8B 4MK7A 2MHNA 4YN3B 1W7WA 4DQPA 4JBCA 4IRDA 2GIQA 5HR7A 4AXIA 3LGNA 4LFAJ 3R5CA 1YNYA 2BRKA 3ELHA 3JTOA 5ETPA 2K4EA 1DBDA 1SJ3P 4BXOB 4C98A 5K5MA 8RUCA 1VK8A 4LSLB 5IOLA 4ZCLA 5IIMA 4WKRA 5A8KB 1LWXA 4DUZF 2V4JB 2VFTA 3HJFA 1WI8A 5KFVA 2OPPB 5B0CA 4I67A 2FVKA 5LT5A 3I9V9 2OELA 4KHPF 3V7LA 4DL3A 2MLXA 2HMXA 5ALPA 1U4BA 4V1YA 1VLYA 2HVEA 5AI0A 2ZIUA 1S12A 4NLXA 5FD1A 2FI1A 2UZAA 2GH1A 1ZTWA 5KG6A 1WUUA 3I5AA 4DHVA 1RHRB 1Q46A 4CP5A 3HSGA 2VICA 1Z1VA 3MCOA 4NLTA 3BM7A 2QL9B 1Y0HA 2QJ3A 1RAAB 4ZLJA 4ERDA 4QU7A 1RWKB 2XSJB 2ZJQQ 1I5OB 2VJ5A 5HK4A 4CLTA 2DIVA 5KFQA 4KGXB 2E5SA 1T03B 1B70B 3KWMA 1RWPB 1BNPA 2DNYA 5KFJA 1K1QA 4DL6A 7FDRA 5U47A 1YBQA 4OO1J 1NAQA 3T81A 3H5UA 4KKOA 2BE9B 2F8EX 5CQGA 5IS2A 1NSPA 4QYZJ 2DL0A 4TYAA 2JGAA 2B8PA 3CCRS 1WKJA 1UVJA 1QAIA 5HANA 1QQ6A 2XEXA 2ZE2B 3QT6A 2CKWA 2BPFA 4URSA 4CNZA 3JSMB 5JVHQ 1TFRA 4Z6CA 2ZH9A 5ALMA 5E7OB 5IT9U 4ECWA 1AUDA 4NASA 3C2KA 2RB7A 1ZQUA 2WVFA 3IWNC 2HHHJ 4L3KA 1MROA 5D8HB 1VGYA 3MI7X 1XMQJ 2KVSA 4LSNB 8ICCA 1PJ6A 4LVNP 4NLOA 4NXMF 3BKTA 2JHEA 2FVQA 4FKXA 2HSEB 5K20B 4FP9A 2PXIA 4OI3A 3FBFA 3BGOP 4DR4J 4RW9B 1SJQA 3CDWA 5HVHA 3H0LB 3MR6A 1YHQS 4B02A 3RFAA 3RJMB 4LREA 3E3XA 1SV4A 3WK8A 4DO9A 1X5SA 3TFRA 4O4RA 3IGVA 2VC1A 5KT4A 5CYQB 4OYMA 4F4XA 3MM5A 5KT7A 3BO2A 4RPFA 1RDRA 2HHXA 1Q3VA 5EE9A 4PCQA 1O5JA 2M88A 5KOXA 1E9ZB 4Q0BB 4GRSA 4PXDA 3B8HA 2RDJA 2VC0A 2L48A 2DXFA 2MUTB 4I2JA 4US8A 2MDAA 3U1LA 3NGDA 5C24B 1NKCA 1RTHB 1FJ7A 3GDXA 3GG1A 2FJDB 3JYTB 1VBXA 2WSCC 2VQEJ 2LP4A 2DGVA 1MMLA 1AROP 4RDVA 1EKRA 4YDXA 1ZQWA 3C19A 4YY3F 2J5AA 2A1AA 3LANA 4DYKA 4WXWA 1J2VA 3B0YA 3CPWR 3K58A 1KSPA 4RDWA 2HBYB 4DSFA 1RWOB 3VZHA 4I64A 5I3UA 1FVQA 3CJ3A 2R7SA 4LRFA 3HP6A 8ICZA 1FWIC 2PFNA 5GMEA 2BCRA 2OPQA 4LMZA 4FYYB 5AKLA 5BXIA 4YQWA 2VPXB 4MFBA 4IOBA 4OV1A 3ZTQA 5ETOA 3CC4S 5F0WA 2L3MA 4R5PB 1FIQA 1M0SA 3C23A 1NCLA 1TE2A 4PJ0U 3C14B 1IM6A 2YNIB 1ULRA 7ICRA 1TQLA 2BV3A 4GLXA 2KICA 4ES3A 2BVZA 4ID8A 1F6TA 1A5LC 5ALVA 5FSEC 2KVQE 1PYOB 2FJWA 2I5JB 3R7SB 2ASLA 3ETRA 2V6AA 4DLGA 2H51B 4OHVA 3J7AN 2VHLA 4P72A 3L95X 4CEUC 3GFXA 3LO3A 3BJYA 2OODA 4NXNF 3M6UA 1G2EA 2YNGB 3MM7A 3LSCA 3DOMB 4DQSA 1YQHA 4EFAC 3IWXA 2CG4A 2FPKA 1OSDA 2XZDB 1SWWA 1DQ9A 1F0MA 2LI6A 1QSSA 1NI3A 3PMLA 3C15A 3CJ2A 5CXTA 4DX5A 1U6BA 5F9NA 2KN4A 5IT0A 2OPSA 3OTDA 1IR2A 5GADU 3DRYA 9ICBA 1IBCB 1RI7A 5K9FA 2CQHA 4FBTA 2Y8YA 2PLMA 1KDNA 3DLBA 1TL3B 3NBPA 1ZQMA 2XMTA 5DDOC 1GXTA 3AY0A 4OHXA 3MAQA 2CPRA 2ZM6J 5HHHA 5B09A 4DR2F 4FYDA 5FP0A 5LXXA 5IM0A 4ZMMA 1U1MA 5CYMB 3SV3A 3R0DA 1NJZA 8ICPA 3ZDEA 1JJCB 9ICRA 3J80Y 1GK8A 3SAGA 2AP6A 3NS1A 2R8KA 5J2MB 1N52B 6FD1A 2NPFA 3KK3A 1RBOB 5HO4A 3BQ1A 4WYLA 2C2DA 3TQEA 4L73A 2C2NA 2EW9A 4B9TA 3M2RA 4JV2A 4OJ1A 3HM7A 3B4DA 2CJKA 3WK6A 3RB0A 5J8YA 4F8RA 1ZQYA 4OJGA 2YQ1A 1NK8A 1R3NA 2RRNA 2HK3A 4N41A 1H72C 4WFXA 3RBXA 3T5KA 2BZFA 4DJBA 4JI0J 3T1HF 3FBCA 2W25A 3O8WA 3FK4A 2P66A 3WIUA 4R0EA 4ETZA 2UU9F 5LJ3Y 2JEFA 3M8YA 3RW7A 2QTWA 1R9ZA 2PDAA 2ZNZA 1F44A 2P53A 1EZZB 3BREA 3GFYA 4IYQA 4DFPA 1T11A 3QSIA 4CQBA 1LXNA 2MZRA 5EWGA 3QYYA 2RKIA 1M1GA 1VMBA 2ROGA 3I6PA 4CH1A 4FS1A 3MFHA 2DBYA 3DDKA 1LK5A 1FDDA 3OR1A 4KR0B 4DCJB 5K14A 1U09A 3D1QA 1YITS 3ZO7A 3PTWA 4BLGA 1ZH5A 2OO4A 4OYZA 2NLWA 2V63A 2MSTA 1F9FA 1UJ6A 2CQ3A 1XJWB 2MKJA 3JPQA 1RU2A 2Z4PA 1WWHA 3VZIA 4X62F 4KIAA 1XNQF 3CCES 5KFLA 4RQMA 4O3MA 3AB4B 4K5SA 3MPVA 4I2BA 2EBGA 3MEKA 2WONB 3MECA 3FM9A 1AQ6A 1IG6A 2A2CA 4CO2A 1EQMA 1FRJA 2YVSA 2DNOA 1S1XB 1NJIT 2U1AA 2R3VA 2V68A 1N61A 3AU2A 2DGTA 3R2DJ 1U1QA 4JWNA 4LIRA 3OL8A 4ZJOA 3J7YU 3OJSA 2HOFA 4GVLA 3HW8A 1Y88A 4HAIA 2ZH6A 3IG1A 4OI6A 1U9LA 3C8YA 3CJ4A 4USVA 1JKHB 1H6KX 1LB2B 2P5VA 3W9JA 4C9DA 4IDKB 2Z00A 2HS3A 4QIEA 2E5HA 2B51A 3PYFA 3GIMA 2AYMA 1S7IA 5EE3A 4NLCA 2W03A 2P6UA 1Q8BA 2NRXA 2A1JB 4ZHRA 8ICMA 2GVDA 2H3IA 3MEEB 4WTOB 4MKVA 1VHIA 2RQCA 1UVNA 2R7XA 2KKVA 4RW6B 9ICSA 4UASA 1S6QA 4YUDA 3R2CJ 3V6HA 3EXCX 3HHKA 2PKEA 2R8HA 5J29A 2LYBA 2A10A 5LMUJ 4ER8A 2G09A 4HTJA 1WACA 2FTRA 5AXKA 3ZDBA 3PHEA 1TV6A 3X3UA 3MM8A 3MABA 3T8LA 1IKYA 3TEHB 3UQ0A 2GVZA 1S1TA 3QGPA 2KTQA 5J2CA 5HROB 4FZMA 2VJ4A 2GSEA 3BGRB 1N62A 1IBLJ 2PMZF 4DR6F 3H4BA 3QFHA 3AM9A 1WHXA 1DQ8A 3MZIA 4UAVA 1WJ9A 4ED6A 2YKPA 1U49A 3W5ZA 4KN4A 3WX8A 1Y5LB 2DFLA 3JAMU 3G2XA 2V4QA 3MPYA 5KG4A 4QR1A 2W43A 2QSFA 2BA9A 2GJFA 4NLKA 5LSLA 1JLQA 3HX9A 1SCJB 1FVSA 2ZOMA 2C1EB 1CULB 1SL0A 4K4GA 1ZQAA 2DNGA 1VQYA 1RDFA 1KTQA 2E1PA 4KRWA 2IMOA 1SL1A 4O5KA 2YQEA 4YB7A 1Q7YT 1ZQIA 1C4CA 2XS7A 3H8WA 3ILJA 4EZ6A 4WE1A 3P5TL 4AQLA 3IAM9 1RAEB 4J91A 4CQ1A 1Q7LB 1JLFB 5KG3A 1ZJMA 2MQMA 2Y1RI 4FFDA 3RJKA 4KLSA 1MWZA 1A9NB 3OTEA 4KTQA 3D1OA 4K0KJ 2FLPA 1OIAA 5KT5A 4NL5A 2HNDB 1NZAA 4NV0A 2R7RA 4EELA 1KLMB 2JXJA 3QO9A 4TYBA 4XPCA 1S3TC 2K7KA 3GYNA 1Q81T 3FEYB 3V81B 1HWLA 5L8RC 2D9OA 4OYIA 3MMAA 4OJHA 1U6ZA 3HWTA 3R3TA 4K7QA 2NRZA 2VPWB 2LCWA 3VAMA 4AYBF 1VQNS 2BB0A 3EZUA 1VQLS 4I2QA 4JWMA 1VLOA 4AFFA 2KE7A 2NCKL 3LGMA 1LKYA 3HSZA 2YQ0A 1S0MA 1R9XA 1HNXF 4DOCA 1DTTA 3PXGa 1RWUA 4LRDA 3QUCA 4DV5F 2CJAA 4HACA 1SC6A 5AI5A 4H54A 4F5NA 2OUGA 4RO0A 1AUSL 2K1RA 1QQ7A 1FWBC 1O0PA 1S1UA 2Z0GA 4NOHA 3CXCR 2KDOA 1TMMA 5IWAF 5J2JA 3WK5A 2DH7A 3AOCA 1HMVA 2VZ9A 4NZ0A 2BR0A 4UOFA 5AJ3F 1FCAA 3DI6B 4F4AA 3IBCB 2CJYB 3BO4A 4LRBA 1X0FA 4DL4A 1L7OA 2I38A 3IHQB 2FC9A 1RWMB 2FPLA 2G13A 2EAPA 1BY9A 2RE1A 2AQOA 3MDWA 5LOQA 2P6RA 1Q79A 1QCKA 2M52A 4E8UA 1LFPA 1M1HA 4DR7F 1KS2A 4M9GA 3AAWB 2B9WA 5M2UA 1S5LU 1GMVA 2EQYA 2K4HA 3MTJA 2ZC4A 1FI4A 5KFGA 1TKTA 5H1SV 1JI7A 1U26A 4KGVB 4DL7A 4C7QA 5C2CA 1U24A 2P9CA 1FXDA 1V3ZA 1RT6B 3G8SA 3TZXA 4DV3F 3KUHA 1JUDA 1K5OA 3HVAA 4HDHA 4I7FA 4CI0B 1ZQLA 5AE2A 1VQ8S 1CS4B 3G8TA 4USMA 5F8MA 4TY8B 2QA1A 2KK0A 4DR5F 3C16B 3CCZA 1E6VB 3UBPC 3G6XA 5AI8A 2EBEA 1Z4UA 2BE2A 1Z2LA 2NO5A 3C6TB 1HBNB 2N82B 1FK9B 4CDGA 5IQ6A 1PK1A 1YRTA 2KSOA 4JMUA 4KIRA 2GHWA 4MFAA 2V2VA 2G5IB 1S0VA 2V2QA 2BX6A 2F7VA 2Z58B 1S10A 3FMWA 1RE1B 4TNOA 3ISCA 3DM2A 4QWDA 3G6ES 1H73A 3D0IE 4DV4F 1S5ZA 2Q09A 1SJFA 4R0JA 3CCTA 4USTA 4WFAQ 4U9RA 5BYRA 1HNVA 1EHWA 1MW7A 3W2VA 4IO1A 4DUYJ 3BS5B 5ALFA 4C5ZA 5KG1A 7ICLA 4LF6J 1VISA 2DNKA 1IXRA 4LFAF 3MOZA 2G1HA 4DL0C 1CJTB 2CQ1A 5HP1B 2XLIA 1NSKL 4OX6A 1YGYA 4K8RA 1ZQNA 3SR6A 4CM0A 3AT1B 3L09A 2HNYB 1SPBP 1UPMB 5DBCA 4P2FA 5IILA 1RT7A 3ZC4A 2Y1IA 1IQTA 1ZD4A 2GW8A 3NCQA 2GLEA 2W01A 4GMKA 1NZBA 4M5IA 3IO1A 4P7VA 1OWXA 2YH1A 2ZBCA 3UVJB 3IRUA 1YJRA 2FVCA 4Y2QA 2BKEA 4MYUA 5L39A 3VAFA 1Q53A 1AZSA 3TR5A 1QSLA 1IE7C 3VV2B 5ALNA 2VU5A 4HT5A 1B3TA 2BEFA 3S01A 3IP4B 3C6UA 5KFDA 4ED2A 2LYAA 1HI0P 1FFSB 3JTPA 2J0SD 3SIPB 2AJFE 1H38A 4O5CA 3RRKA 1CC7A 1OYEA 4IG3B 1SC1B 3TAMB 2B4UA 1RT2B 4PRFA 4CQCA 4NA1A 1M90T 2ZWPA 2GC8A 4Q43A 4KV8B 4LF4J 4KAIA 2HHSA 3KLIA 2GNKA 2HBLA 3T5LA 1FJGJ 1FT8A 5HMWA 1UZHA 2V69A 2MQOA 2LQ9A 2F4FA 1C0TB 4LR9A 4ES2A 4O4GB 3UN5A 5HATA 1A6LA 4O0IA 5AM2A 1GKPA 2GO9A 4C8OA 4P10A 3KHLA 2ILZA 2EFNA 5GVQA 4ZVHA 3CD5A 4QWBA 4NEZA 2BXJA 3TAPA 1U0HA 4C4RA 2UXDF 2BJDA 2FHJA 3MR2A 4CO0A 4PG7A 2C3PA 1BQNA 4G1IA 4LFBJ 3IR7B 3NCPA 4CRXA 5DDYA 1XMQF 1OUQA 2V8HA 4CF3A 7AT1B 1ZQEA 4RNFA 3MM6B 1REVA 2I2YA 3D6TB 1HUOA 3ISDA 4DU7A 2GZOA 2WOMB 3I0RA 4DR4F 1MN9A 2ZG6A 4H4KA 4UB4A 2HZVA 1SKWA 1RKJA 4EO6A 1XS9D 3CF5Q 1MC8A 1W2BR 3MGVA 4JI6J 4CNSA 2CVIA 3QE9Y 2XBPA 2MQPA 1WG1A 2IRYA 2HHQA 3RGIA 4LF7J 2W8LA 1ZAWA 1NBEB 2LYHA 4LQ3A 5DLFA 1F2GA 1D3WA 2JH1A 4PXCA 1VBZA 3OL9A 2C3YA 2GGPA 2Q6CA 1AT1B 1ECWA 1HHSA 5ETLA 1YRRA 1R89A 2HQCA 1JLGB 2VQEF 4NPOA 3SXLA 2OFHX 3CJSA 1K0VA 3KNAA 4QQBA 3AD9C 1KN5A 4JI2J 2KJ8A 2HHWA 3D2WA 1VJQA 3DU5A 2LVWA 1FNXH 3WHIA 3DEEA 1IJEB 4ECQA 1SH3A 3CSKA 5J1EB 1MWQA 1BNOA 2PE8A 4B3TF 2M4MA 1ZQHA 4PHPA 4ZITA 3Q8PB 3W61A 2G07A 2PIIA 2HMIA 1GTEA 2DY9A 4ZVUB 4YR0A 4ZVEA 1XR5A 4I2PA 1S9EA 2EAMA 4RT2A 2NYVA 3EVWA 1F1BB 3BSAA 1TVAA 4ILLA 4M51A 2BJ8A 4OX7A 3M2VA 4UOGA 1KR4A 1XMOJ 2VANA 5HQLA 4EP8C 4DSKA 3UDVA 4JI8F 4FS2A 2OLWA 1S4FA 3TI0A 1R43A 1H98A 3NOCA 2YY3A 4MK9A 4YHHJ 1V38A 2YWFA 1DLOB 2NYHA 2J0QD 2E5LF 3RF9A 5A2QY 2Y0SD 3M1YA 3WU2U 2LLZA 2F40A 4K4WA 3BPDA 3PACA 1I3OB 3O5TB 4UBCA 7ICGA 3MUMP 1SZHA 3KHRA 4O0NA 4OJ5A 3QYPA 4EGLA 3F5AA 2CQPA 4A8QA 4Q8EA 2FMPA 4PL2A 2BJ7A 4RQ7A 3M8SA 3SQGA 1MMNA 3M9NB 2VM8A 5HBMA 3CCWA 4E98A 3W60A 1FA0A 3JPTA 1V9OA 4Z6EA 2HQ3A 4ED5A 7FD1A 3HCXA 4IG0A 2O66A 2VUNA 3QIPA 4Z2XA 3SSRA 3AB2B 3U7JA 2VDIA 2MKSA 3C1YA 4GXIA 4WP8A 1ZD2P 3BBFA 5AIAA 1RHUB 2JEIA 4UUWA 2ZM6F 2MY7A 1RTDA 3IP0A 4Y2YA 3BKFA 1R0CB 3MM9B 2MQNA 4UF4A 3TUIC 4Y28C 3ZDDA 4A46A 3MBYA 2IJFA 1AB8A 3TOQA 2XYGB 4A48A 2JLGA 1P9YA 4M5KA 2UV8A 2ZIUB 2EVZA 2JHDA 3ONQA 3CCLS 1R0BG 3GU3A 2KG0A 1N5YA 1T9YA 1ZM3A 2NSBA 1JJ4A 4R66A 5J2PB 3TADA 1A6SA 3CIMA 1SVDA 1BGXT 4X4VA 3SSSA 1ZOTA 3UCGA 3PKYA 3HKZF 4UB9A 1V3RA 1LEOA 3A8EA 2RS2A 3RU0A 4KLMA 1YKWA 2HVZA 1WELA 3PSIA 4NY8A 2XMJA 4KQZA 3VQSA 4JI0F 3UN2A 3FC4A 3TJ9A 2XMVA 2A18A 4NE9C 3CDBA 3IR6B 4KPCA 3IC1A 1RA7A 1YBQB 3EICA 2IOFA 2H9ZA 3GJSB 4EENA 4DX6A 4KKOB 2DR9A 3OFFA 2XS5A 8ICIA 1QLNA 3IR5B 4FF3A 5EGYA 3OVBA 1UT8A 4YOEA 5KL8B 2LU1A 1X66A 5CJ7A 2AQ4A 2Q79A 3GONA 1FKOA 4Y2PA 1KFDA 3R5JB 5D49A 4Y2CA 5MLCV 2Z2MA 2FHOB 3LK9A 3NRBA 3UPFA 1WC3A 4UW9A 2KG1A 3V7PA 2D1CA 1MROB 5GAGU 2GQCA 1U45A 1UMJA 1SUQB 3IN5A 2OEJA 2EG2A 4UZCA 1RHJB 4PWWA 4DV7J 2A2DA 5D4BA 1RU1A 2LFVA 4YFKA 3JPPA 4HDGA 4C8LA 3MAHA 3OTCA 4CO3A 1WTBA 4OHYA 3OBIA 5J2DA 4M0AA 3KHHA 4OYWA 2ZFHA 2LQ5A 1YJUA 1UWAA 4DV1J 3CTRA 5AKZA 4ZPCA 1U1OA 4U8YA 4C3MA 4YB6A 1FFGB 5KFWA 5J2BA 3DNCA 1S79A 5T14A 1LW2B 4F67A 4DR3J 4QZCA 2VQFJ 2YWEA 1UEUA 4PAAA 5E3PA 2Y0SC 4EU0A 4P2XA 4ZCMA 1XNSA 2KT2A 4WZMA 2ZXIA 2U2FA 1ICEB 5KFHA 3B6BA 3LH2S 4CNYA 1QTNB 3HHLD 2OEHA 5IZHA 2P50A 2LEPA 1MLAA 4I2AA 2IFXA 4K4ZA 5B0AA 1VQOS 3UQSA 4LBIA 1KLNA 3OJUA 3CJ5A 4DZDA 5J2QA 3FKBA 4UAWA 1P6TA 4AD6A 1FE4A 4PG4A 3MCSA 4CE6A 5I3UB 2YX1A 5D0HA 3HM9A 4NXZA 4N5SA 3HRDD 2IBKA 3ENVA 2K2PA 1FERA 5D0EA 1SC4B 2BOPA 4R88A 3UR0A 2KT3A 4JV1A 2QV6A 4TQSA 4MFBB 2BBEA 2CQIA 1RCXB 1APSA 1H3DA 3QZ8A 1RQNA 2B43A 2HKEA 4I6AA 1ZRMA 1NZPA 3PV8A 3NVWA 2BCQA 3IM9A 1IBLF 2BZ2A 2DUYA 3J7A1 3R27A 1U2FA 2D69A 5BJRA 1UPHA 2CPYA 2ZJAA 5A6PA 5F3TA 3TEGA 4WIQA 9ICUA 5CB1A 4NA2A 2HOQA 2N4DA 1R8HA 2CG8A 5EX3A