1IM4A

Crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
205
Chain Sequence
HHHHHIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DinB lesion bypass DNA polymerase catalytic fragment reveals a classic polymerase catalytic domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords DBH
total genus 63
structure length 205
sequence length 209
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1im4A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 1im4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1im4A01
4NYZA 4B3OB 4MIAA 5J0YA 3C1ZA 2VG5B 4WYWA 4J9KA 4GXKA 3PZPA 5HLFA 1HYSA 4I2GA 3M8QA 1KFDA 1Y88A 3DM2B 4R0EA 3Q8RB 3GV8B 3B0XA 2FLLA 1TVAA 3N6NA 1UA1A 2ZTCA 3E51A 3KHHA 3LP0A 3RH5A 4QW8A 1LW0A 4UQGA 2VG5A 1TKTB 3DLGA 4ED8A 2KZ3A 3BGRB 1TKDA 7ICUA 5CB1A 1C1CA 3M8PA 5CWRA 1KFSA 4J9QA 2ILZA 4MFBA 5F8NA 7ICMA 3UDLA 4UB3A 4IQTA 7ICRA 1ZTWA 4J9NA 4M9LA 3H8SA 5CR0A 5IIJA 4F4XA 2WTFA 4O5EA 5I42A 3UQ2A 4DS4A 3GIMA 1X2IA 3PW5A 3LAKA 4I2JA 4IG0B 5J2HA 1GX5A 2KZMA 5KFDA 4F8RA 2FPKA 3ZDDA 1QLNA 4EZ6A 3CJ2A 5CP2A 1S9GA 3I5AA 1S9EB 2BE2A 4Q8EA 1S0VA 2UUTA 4M9HA 1KHWA 3ETLA 4YR3A 1ZJNA 3NBPA 3EW9A 5FDLA 2HNYA 1S6PA 4F3OA 3LP1B 1RT4B 1FKPB 3JYTB 1WCNA 2FVPA 3RB0A 1C0UB 4IDKA 2FJVA 1ZQMA 2YNHA 4ECQA 1JLAB 1QSYA 4QZEA 1TVRB 1RT4A 4U7CA 1RTDB 3ZDAA 4LQ3A 5KT2A 2YNGA 2RDJA 3JSMA 2HMIB 2FJWA 1HNIA 1ZYQA 4NLYA 3IRXA 5KFYA 2BKEA 1SH0A 1RT2B 3QEAZ 3QIDA 2B5JA 4IH7A 4O3NA 1DTTB 4TYBA 4JWNA 3G6YA 1JLFB 5J0QA 3FDSA 4H4MB 1D8YA 4DFMA 4O4GA 2XI2A 4B9NA 1LWFA 1S1TA 4RPXA 3MF5A 4JWMA 4QPXA 9ICIA 1VRTA 4H4OA 1LWFB 4F5QA 4DO9A 2WRMA 5F8JA 2ZUBA 1TKTA 3HVWA 1ZQNA 4ECVA 4G1QA 2D41A 3V6DA 3BR9A 3RJIA 1MU2B 2YKMB 3IGVA 1S1WA 3JPRA 4ZP8A 3KLHA 1RTJA 4JV1A 3UQSA 1RYSA 4K4ZA 1K1SA 5DQHA 1D0EA 5KFZA 3FFIA 4UAZA 4PHEA 1ZQXA 5DBCA 1JLGA 3PW0A 4PPXA 4Q44A 3THVA 3IGNA 2KFNA 4IDKB 3EPGA 4URGA 3CWJA 1BPBA 1KFTA 5KFPA 2MUTA 2XI3A 4DG1B 4QZCA 4KE5A 4R64A 2IMWP 3T5HA 9ICQA 4ELUA 4B9MA 4PGQA 4QZIA 3V81B 3KHGA 2FPLA 1RT3B 3QO9A 1NJZA 5KFAA 3SYZA 5EWFA 4GC6A 4NRUA 1BPXA 4ID5A 2BCUA 4MFFA 4B9LA 1CUKA 2UUWA 5KFUA 4BGDA 4C8MA 1FK9B 5L9XA 3LAMA 4R5PA 2FPMA 2ZJ5A 4RNHA 4BWMA 5DKWA 4WE1B 1VRUA 4B9SA 4DQPA 5KG5A 1ZQOA 3SFUA 2IM1A 4MKAA 3IRXB 4BXOA 4I2HA 1UWBB 1NOMA 1SZPA 4DLEA 3NAHA 5F8IA 5J1EA 1TL1A 4YR2A 4EBCA 2AX1A 3BDPA 3TQ1A 4RQ2A 3H59A 2NRXA 1S48A 4NLUA 2HWIA 4PUOA 3KOAA 2ZKUA 1JXLA 2F1HA 4B9TA 1RDRA 5TZVA 4GC7A 1OS5A 4EO6A 4EO8A 3CJ5A 2ALZA 5KFLA 4YN4A 3PJXA 1RT1A 4Q45A 1BVSA 1X9WA 2HNZA 4RW7A 3V6JA 3CJ3A 2I1RA 4X5VA 1HQUA 1T4GA 4RW6A 1U48A 5HBMB 4QZGA 4RNOA 3MECB 2PFOA 2ASDA 1QSSA 5J0SA 4Q0BB 1C0TA 3ORYA 4TY8B 3KHRA 8ICLA 4DSIA 2WOMA 2UVRA 3KLGA 2ISPA 3MEEB 2BDPA 3DMJB 2XGPA 3T3FA 1FKOA 2BANB 3PW2A 4DQRA 3IS9B 1D1UA 4IQUA 3BSAA 4O3OA 2JZBA 2FMSA 1NNDA 4MH8A 1FKOB 8ICNA 4NRTA 3KHLA 3PW4A 4TQRA 2RKIA 2P6UA 3LP0B 2HNDA 2R8KA 5DG9A 4QWEA 3DYAA 3QGIA 4NLPA 1NJXA 1TAUA 1TV6B 4PWDA 3Q8QB 3EPIA 1XO1A 1HQEB 4ED0A 1XR6A 5IIKA 4KLOA 2AGPA 2XY6A 3C5GA 3GV5B 3DI6A 4KSEB 1L3TA 1BQNA 3BSOA 3PMLA 1ZQTA 3AU6A 2LYHA 3DOKB 2F1JA 3DRPB 4QWBA 1JLBA 1T03A 3C2MA 3MDCA 1S9EA 4WFZA 3ISDA 5IILA 4WYLA 5DB6A 2P6RA 1DLOB 3I0SA 5J2QA 3CO9A 4NZ0A 1JLBB 4M9JA 4K4YA 1COOA 8ICMA 3MDAA 4NLNA 1JMSA 3V6KA 4IKAA 3PR4A 3KLFB 4ICLA 3DLEB 4DL4A 3V4IB 1RPLA 2I9GA 3VQSA 1HPZA 4P4OA 4RW4B 2GIQA 4K50A 3RJKA 4RT2A 2H5XA 1N6QB 1UT5A 3MGIA 3KJVA 3TFRA 3I0SB 4RNNA 1JLAA 4DF4A 2YNFA 4NLZA 4F4ZA 7ICOA 4O44A 2C22A 5F8LA 1BPZA 1LWCA 4DL3A 2D3ZA 1YVFA 2W9BB 3PW7A 4KV8A 5J2BA 1ZQSA 3I5BA 2CKWA 2UVUA 1QSLA 4MF2A 4KLEA 4NLWA 2WHOA 1SL0A 1T03B 3KK1A 4QZBA 1RT6B 5DBAA 1B43A 4R66A 1MC8A 4LSNA 1PZNA 4XA5A 4KFBA 4FS1A 4BDPA 4ED1A 1CEZA 4GXIA 4IRDA 3TVKA 3H7IA 2C28A 4I2AA 3RJFA 3ZDBA 4NLOA 5L1IA 2V4QA 3KLEB 3CDWA 3D28A 5KG3A 4WZQA 4TY9A 3KK3B 4C8NA 4TUQA 3DOLB 2DFLA 2EC0A 2AWZA 4O0IA 4RNMA 3UPQA 1MQ2A 4URQU 5EDWA 2YKNB 4KLGA 1Z4UA 3BQTA 4RUAA 8ICJA 2R2UA 1DTQB 8ICQA 1NKEA 3I0RA 5L1KA 4ELTA 1RA6A 1S1VB 5IIMA 5I3UA 4C8LA 8ICAA 2O5DA 5DBBA 4RQ7A 1VRUB 2BQ3A 3KLVA 3IN5A 4M47A 3EYZA 4M94A 3EWAA 5J0XA 1XC9A 8ICGA 1ZETA 2IHMA 3V4IA 4YMMA 4O4GB 3OLAA 3GIJA 1HJPA 1U4BA 5CYQA 4DLGA 7ICFA 3B0YA 1RXWA 5D3GA 5J2NA 4UBCA 4TYAA 5J2KA 4Z6CA 4F91B 5C25A 1A77A 2V9WA 3M9OB 2HHWA 2YNGB 5F8GA 3LP2B 3TANA 4I27A 3EZ5A 4XRHA 1T94A 3LDAA 1RAJA 1RTIB 3IG1B 3G86A 3RBEA 1MMLA 5IINA 5KT5A 3V7JA 1C0UA 3GV7B 2HAIA 2AJQA 2E9RX 4R65A 3QGHA 3JSMB 4ELVA 4Y34A 5DQIA 3HWTA 4IG3A 4RQ0A 1UWBA 1NK0A 4J9PA 1KDHA 1T7PA 4DL6A 3BJYA 4TUSA 5C24A 5EWEA 2R8IA 3ISND 4ED7A 2BE2B 3LP1A 1JKHB 1ZQAA 3I5CA 2R2RA 2HNYB 5KFBA 3KK2B 1JXEA 2XY7A 1NJYA 3GQCA 2UVWA 1N5YB 2W8LA 1EXNA 3H4BA 1S9GB 1V9PA 7ICIA 3RH6A 2E9ZA 1ZQQA 4PHPA 4KO0A 3V81A 4WFYA 4QZHA 3TI0A 4Q43A 4NLSA 2BCVA 2IHNA 2AQ4A 3T19A 3KMSA 4PGYA 2NRZA 3LWLA 3H4DA 4QWAA 1HMVA 2C2DA 4QZFA 4LVSA 4PHAA 7ICVA 2KN7A 2HNZB 2MUTB 4DFJA 2HHVA 5J0UA 5KFTA 4ECYA 4K4XA 4RQ8A 3CDUA 1HYSB 2VG6B 1AROP 4ZVFA 1U49A 4BXOB 9ICAA 5F8HA 5F9LA 1NHUA 2VANA 2IC3B 8ICYA 2KZZA 1SKSA 4ECXA 1TL1B 5HMMA 1KHVA 3SZ2A 4R5PB 1T05A 1N48A 5BOMA 4ZH4A 1TKXA 5HMLA 4H54A 4RZRA 3AU2A 4RW9A 1S6QA 1X9SA 3MEGB 5J2MB 5HROB 2NRVA 1MSWD 1XR7A 4RW8B 4WE1A 4EBEA 1RT3A 3QO9B 4K4TA 2BCRA 3D5MA 4ZP9A 1U47A 4QZAA 4ZVGA 5CJ7A 4KLTA 4WXOA 4KO0B 1C1BA 4F2RA 3OL9A 4M9GA 4WFXA 3H5UA 2JC1A 3JPSA 4MIBA 5HNKA 1RT7B 3K75D 3C6TB 8ICFA 1N6QA 5DLGA 1NK6A 2XO7A 2HMIA 2RKIB 1XU4A 3TAPA 5C42B 4RW4A 3N6MA 2JEJA 1C7YA 2AU0A 4F4WA 3MEGA 3MR2A 4DEZA 1HUOA 4RPYA 1TV6A 3C2LA 3KJVB 4JUZA 2OWOA 4ED6A 4P4MA 2FVSA 4IRKA 3C6UB 1SUQA 4TQSA 4I2CA 3LP2A 2ZTDA 3QE9Y 5KT7A 3LK9A 1HNVA 5KFNA 1QAJA 4Y2AA 3TFSA 2ZUCA 4TY8A 1LW2B 1C1BB 2DPJA 2BCQA 3IS9A 4U6PA 2XC9A 4UB1A 5CYQB 4I28A 3Q8PB 3BQ1A 1QTMA 1JLCA 2WB4A 3HX0A 5J2MA 3BGRA 1HQEA 4ZHRA 5J29A 3MR3A 4FBTA 3PV8A 4TURA 4UB5A 1NK8A 1JLCB 2OPSB 4H4OB 3HPOA 4KLUA 1R0AB 4QZDA 5I3UB 4MFBB 1L3UA 3RJGA 4I2FA 9ICSA 2OPPB 5J2CA 4Z6DA 9ICVA 2VA3A 1A76A 1S10A 1S1XA 4Z6EA 3ZD8A 4Q8FA 1X9MA 2OPRA 5J2JA 2YKNA 9ICGA 3HHKA 1TV9A 2F1IA 2FVQA 4O4RA 5KFWA 3NGDA 1S77D 4RPZA 4MFCA 3MEEA 1S97A 1MQ3A 3C6UA 3OSNA 3PMNA 2J6TA 2M9NA 9ICJA 4M9NA 3G6XA 1GX6A 3GIIA 1SH2A 2BRKA 4RQ5A 3RR8A 2R8HA 5KFEA 1D9DA 4F5NA 1S6PB 2IAJB 3QYYA 4ID5B 4IR1A 3HVTA 3C5FA 1QE1A 3C6TA 4KMUA 2ASJA 1Z00B 7ICPA 3ZDCA 3SFGA 3ZDEA 2JEGA 8ICKA 4M2YA 7ICEA 4KV8B 4X2BA 1L3SA 3KK1B 5J0WA 4O3RA 3KMQA 4KAIA 4F93B 2B6AB 4LZDA 5DGAA 5EWGA 4KLQA 3MFIA 3OGUA 2HHXA 4M6WA 3T5KA 3NKYA 4IG0A 2NRTA 5KG4A 4O5CA 4IFVB 3NL0A 3KNAA 3DDKA 1KSPA 1JN3A 1JLGB 5HHIA 2OPRB 1LWEB 1S1XB 1HUZA 2PI5A 2A1JB 4ED2A 1SH3A 1RYRA 1TAQA 3Q8SB 5BOLA 4IFVA 2FLPA 3N4MB 2HHTA 3JPOA 4K4GA 4G1QB 4DOCA 2I5JA 3DLEA 3N6LA 3KLHB 4KLDA 4MK8A 4IR9A 3PX4A 2B6AA 1WCLA 2IJFA 2F8EX 9ICWA 4ZHRB 3CIZA 2YKMA 3LALA 1KLMB 1NHVA 1TK8A 1TL3B 4IFYA 2OPSA 1KLMA 3OJSA 4KLSA 4FO6A 4J9SA 4DL7A 1BQMB 4EYIB 5J2PB 4UAWA 1JLFA 5EUHA 2XY5A 2BR0A 3PY8A 4LSLB 2HNDB 1N4LA 4MEYA 4DSKA 4RNFA 2ILYA 4PWDB 1JKHA 5F9NA 5DG8A 2ZE2B 4P2HA 3ISNC 3QGGA 4DL2A 1RTHA 9ICRA 4EYHB 5IIOA 3OLBA 3RRGA 1IXRA 3OSPA 2AX0A 2YNHB 3TAQA 3RJJA 2RF2A 3DLKB 1RT2A 2FMPA 2I1QA 4YMNA 1REVB 1FKPA 3JYTA 5DG7A 2V0NA 8ICRA 1ZQFA 3DLKA 4NLKA 8ICPA 5KG0A 4M04A 5DQGA 1LV5A 4KHRA 1SL1A 3LWMA 4MK9A 4O3PA 4YD1A 3QEBZ 4WZMA 5D49A 4J9OA 3ISBA 4KLHA 5KG1A 1NKBA 2J6UA 4DFKA 5J2AA 4Q0BA 1DOQA 2E9TA 5CYMA 2ZD1A 3PX6A 5KFIA 4H4MA 2HWHA 5EOZA 4KN4A 3V7LA 4PHDA 5D3GB 1L3VA 8ICUA 4F5OA 3H40A 3Q8KA 3IG1A 4RW8A 7ICKA 4ZPBA 4DQIA 1XSNA 2AGOA 9ICOA 5KFXA 1BPYA 3QZ8A 1TP7A 1BGXT 9ICMA 4M0AA 1HNIB 5J2QB 1ZQWA 3Q8MA 3BSCA 2PFNA 1RTDA 4RQ6A 2VA2A 1U9LA 2AQ0A 3RR7A 4WXWA 1K1QA 7ICQA 1QAIA 4DSEA 7ICGA 1LW0B 2PFQA 1S1UA 1UT8A 5KFQA 4K4VA 3GDXA 1EETA 4I2QA 9ICHA 1S49A 2VG6A 5JXSA 5KFSA 2UVVA 5J2DA 3ZD9A 3H8JA 3M9NB 2HHUA 1XWLA 1S1VA 1B22A 4YCXA 7ICSA 3JPQA 5KFGA 1ZQGA 9ICXA 9ICLA 4P4PA 1RZTA 3KLIA 4NCGB 5HLFB 5J2GA 5HP1B 3OHAA 3M8SA 2RF2B 2CJQA 3MBYA 4ECWA 1ZQIA 1ZJMA 5KFJA 2W9AA 1EP4B 3H8WA 3UXOA 2WK4A 3KLGB 2R8JA 5HHHA 1QUVA 2FJXA 4F5RA 3MEDA 3DRPA 3RBDA 8ICXA 9ICCA 3KK3A 2XWYA 4YXMA 3PR5B 3C2KA 2FLNA 2R8GA 4B9VA 4KN7A 2ASLA 3V6HA 4YMOA 1L5UA 1C1CB 1SKRA 4F2SA 5HROA 4YD2A 4IRCA 2KTQA 3OL6A 4KFBB 1NK7A 5BPCA 1T3NA 2ZD1B 2FVRA 1TL3A 1HQUB 4K4UA 4DG1A 1XR5A 1W25A 4QZ9A 4RW7B 1IKXB 4MKBA 5HP1A 4JK1A 2YNFB 1EP4A 3ITHB 4QW9A 8ICZA 1ZQKA 4NLDA 2IC3A 5J2EA 3DRRA 2JZBB 1MU2A 8ICWA 3BREA 3H5SA 5C24B 7ICHA 1IM4A 2OPQA 1JIHA 4GXJA 4RQ1A 4YFKA 1RT5B 2WOMB 3PX0A 1RT7A 4ECUA 5JUMA 5KG7A 4DOBA 4O3QA 8ICBA 4GLXA 1S0MA 4ECSA 3RB3A 1HPZB 3MR6A 4KKOA 1ZQEA 1R0AA 1RA7A 2R2SA 4IQVA 5C25B 4ICLB 2JLEA 2XCPA 2ZTEA 1Z3EB 4YR0A 4KLFA 4F50A 4B9UA 3GFKB 4M6WB 1RT1B 4LQ9A 3RJEA 5KT4A 4JV2A 1HARA 3PJWA 1DLOA 3PNCA 5J2PA 2W9MA 1ZQCA 1TKXB 9ICPA 5KFMA 1UA0A 3RAXA 1BQNB 3OL7A 2C2RA 4KKOB 4ECTA 4PGXA 5K14A 3CVKA 4BWJA 1RT5A 1KRPA 8ICCA 4YVZA 4I29A 4TLRA 2I5JB 3ITHA 5DGBA 3RRHA 4ZMMA 4KTQA 2J6SA 4DL5A 3FRZA 4DSLA 1SL2A 4MFAA 8ICEA 5DB8A 4IOBA 4YP3A 4XQ8A 3HVAA 2D7SA 4K4HA 3G6VA 3T1AA 1FK9A 5KTQA 3CJ0A 3DRRB 3KLEA 1IKXA 3ISCA 3BSNA 3N97B 3NBPB 4MF8A 1C2PA 3DOLA 4IQXA 4I2EA 5KFRA 8ICIA 1NJWA 4C8OA 4YXJA 1C0TB 2BQRA 3RJHA 4FBUA 4YG2A 2AGQA 1ZQVA 1ZQDA 2ZUDA 2OPPA 5I42B 2HHQA 2R2TA 1ZQRA 3PO4A 3M8PB 4DWIA 2W9BA 2WONB 1J5OB 4OL8A 4NLRA 4F92B 4DOAA 5L1JA 4NM2A 1BPEA 5KG6A 3H5XA 5HBMA 3T5JA 3H5YA 4O44B 4IFYB 3OJUA 5D46A 1VRTB 1QE1B 3DLGB 4XPEA 2ATLA 1XSPA 4K4SA 1NK9A 2XCAA 1LWCB 5KFVA 1DTQA 1ZQLA 2BPCA 1T05B 4DFPA 4RU9A 3H2LA 9ICKA 4IG3B 5K14B 4EBDA 4QWCA 8ICVA 4DQQA 2Q0ZX 9ICEA 5DLFA 4J9RA 4LZGA 1S76D 5J1EB 3FQLA 3V6DB 2JEFA 3QIPB 1KEJA 2JC0A 4NLXA 2Y1IA 7ICNA 3SI8A 1WNEA 2BQUA 5KFCA 3NMAA 3GIKA 2IA6A 5KFKA 4I2PA 1TVRA 3V72A 9ICFA 1LB2B 2W9CB 3E01B 1XSLA 1NKCA 2GIRA 3IM1A 3NTUA 1IKWA 4NLTA 1ZTTA 5IIIA 4ZVHA 2HVIA 1D8LA 2BGWA 1S0NA 1SV5A 5FDLB 3JPPA 2HHSA 2PI4A 5L1LA 4TN2A 4C8KA 1DTTA 2W7OA 3M9MB 3LANA 5CYMB 1S4FA 3E2EA 1CSJA 3H98A 1IKYB 3NAIA 3DI6B 4K4IA 3QZ7A 1ZQZA 1N56A 4PH5A 5KFHA 1TQLA 1LW2A 4KHMA 4J9LA 2BCSA 4TUPA 3GILA 1JLEB 2NRWA 2IM0A 2ZE2A 5KFOA 5J2IA 2W7PA 5CHGA 4DS5A 5DDMA 1ZQHA 5KFFA 1KTQA 1DGSA 4TXSA 4Y2CA 2C2EA 4KBIA 3MTKA 5F8MA 4UBBA 2B43A 1I6JA 2GWSA 4O5KA 4I2DA 3DMJA 5KG2A 1RXVA 3RAQA 2ZJ8A 3UXPA 1S9FA 1NK4A 4R8UB 2V4RA 4DF8A 3BQ0A 4EEYA 3IHQB 1TK0A 2OH2A 4MEXA 5CA7A 2JEIA 3RB6A 4ZPCA 4KB7A 2RDIA 3OHBA 4ZP6A 5J2NB 4NM1A 8ICSA 3MEDB 3K4GA 1BPDA 3CDEA 3MR5A 7ICTA 3FSIA 4JV0A 3BQ2A 4I7FA 3EZUA 4CCHA 7ICJA 3CJ4A 3Q8LA 4RT3A 2BPFA 1IKWB 1S1UB 2BHNA 3KLIB 2FVCA 4IH5A 1TFRA 4RQ4A 5DDYA 2A1JA 4DSFA 3M8QB 3I0RB 4MK7A 1EETB 4I2QB 4YQWA 3V7KA 2IJNA 4UB4A 2B21A 7ICLA 3KLFA 3MGHA 4ED3A 4K4WA 2HW3A 9ICBA 3OL8A 5DB7A 4XO0A 1JLEA 3MFHA 2BRLA 2IBKA 1RTHB 2VG7A 3DRSB 3C1YA 4NLQA 1SV5B 4KLIA 4O3SA 4LSNB 5J0TA 4I2BA 5HP4A 4IH6A 3DOKA 5D4BA 5T14A 3KTQA 3GYNA 2Y1JA 4QWDA 4YMEA 2GC8A 2XGQA 5J0RA 2YNIA 4E0DA 2ISOA 4EZ9A 2QV6A 1S6QB 3UXNA 4IQWA 4Y3CA 4G3IA 4O9MA 4UB2A 3QLHA 1T8EA 5J2FA 4XPCA 3RH4A 3FYHA 2W9CA 3RTVA 4RW9B 3M8RA 3KK2A 3MABA 4NCGA 1D9FA 8ICOA 4UAYA 1U09A 1REVA 3AUOA 1H38A 4RQ3A 4DQSA 3C21A 1U45A 9ICTA 2P66A 4ZP7A 2QE5A 4I7FB 3FFIB 4R63A 2KFZA 3HW8A 4XUSA 9ICNA 4PQUA 4PQUB 1TK5A 2PXIA 8ICTA 1S1WB 2HVHA 1J5OA 3MECA 1ZQJA 4RW6B 3DM2A 3UR0A 3TAMB 4QZ8A 5KT6A 4KLMA 2FMQA 4FS2A 4B3OA 1HMVB 4KITB 1KLNA 3TAMA 2WONA 4Z6FA 3FQKA 8ICHA 1SKWA 1S1TB 4NXZA 3PO5A 1S0OA 1N5YA 3UQ0A 4RUCA 3HP6A 1RT6A 4R8UA 1ZQYA 1JX4A 4NY8A 1SUQB 1LWEA 3SV3A 2VG7B 3DRSA 3C23A 1Z00A 4KLLA 2D3UA 2B5JB 1HNVB 1XS9D 2IAJA 3UPFA 3RB4A 1NK5A 4ZVEA 1JLQA 3T5LA 4HKQA 3DYAB 4ZPAA 2OPQB 2VA8A 1IKVB 1RTJB 4F4KA 1TKZB 5C42A 1TKZA 2W8KA 3HT3A 4NLGA 4I2IA 1IKYA 1IKVA 5C5JA 2DPIA 3QLHB 4F5PA 2PFPA 1RTIA 2ZJAA 3JPTA 2WCXA 5J0PA 2BPGA 2BANA 9ICUA 4NLVA 2YNIB 3HKWA 4F4YA 4KLJA 1JLQB 3TARA 1ZQBA 3SV4A 1ZQUA 3JPNA 3ICLA 4ECRA 3PVXA 3E01A 5KT3A 1ZQPA 2MAXA 2IM2A 4I2PB 2IM3A 4DSJA 4LSLA 1BQMA 4URSA 4HYKA 4PUOB 3HVTB 4ZPDA 5J0OA 3PHEA 3QIPA 5DB9A 4J9MA 4ECZA 4M95A
chains in the Genus database with same CATH superfamily
5AKZA 5EE0A 4AT1B 4B3OB 4ZCKA 4DX8H 4LIRA 2BW2A 2Z56B 1HYSA 2VIHA 4QJFB 4I2GA 1TFWA 3HKZC 1U0HB 5AM2A 1U24A 3N6NA 5AE3A 2ZTCA 2FDNA 1KQFB 2CIMA 1VQPS 4QW8A 2RMLA 4UQGA 4L75A 4LMZA 3DLGA 5BYRA 4ED8A 1BHNA 3WIVA 5E0OA 1FRXA 1QM9A 7ICUA 3LGMA 5GTHU 1KFSA 4J9QA 1NB7A 1D3WA 1KVJA 7ICRA 4J9NA 4USTA 3H8SA 5I42A 2V9KA 3UQ2A 2Y8YA 3LAKA 3GIMA 1X2IA 3J7ZT 4IG0B 3IMQJ 2KZMA 2VHLA 2YTCA 1Z19A 5ALDA 2H4YB 3M05A 3KDOA 4K5SA 1IBKJ 3IWXA 5A8WA 2HPUA 3NWRA 3O5TB 1UTAA 2BE2A 5AM3A 4Q8EA 3D2WA 1YJ9S 1W2BR 2AQVA 3VCBA 2IVFB 3ETLA 3TA1A 2WB1F 2BYCA 2QRRA 1ZJNA 5E33A 3BPDA 2AP6A 5FDLA 2HNYA 3D6NA 2EG2A 1S6PA 4X62J 3SSQA 2X1GA 1L7NA 1FKPB 2OUGA 4WCEQ 1C0UB 4IDKA 4BHQA 2E1FA 1HI8A 4ECQA 4U7CA 1S72S 3G2XA 1RTDB 4TKTA 3ALRA 2KHCA 3KYLA 5AKYA 2HMIB 3IRXA 1SH0A 1JJHA 2RD5C 3T8LA 1WJ9A 3QIDA 4IH7A 2ZHBA 1WOOA 1DTTB 2PDAA 1XIQA 4JWNA 1VDHA 3FDSA 4H4MB 1D8YA 1Y11A 2W2QP 1HNZF 4O4GA 2DHHA 5LSRA 4ZCLA 2YKOA 1FJ7A 3RRKA 3MF5A 2HQIA 5K8PA 4WKYA 3HKZF 2GJFA 4F5QA 5IC6B 1T9TA 1WG4A 4OZ3A 5F8JA 2B0CA 4Y28C 3CCQS 3HFZB 3VQTA 1QVFR 4C7QA 2ZUAA 3IM8A 3QPIA 5T7LA 2KJWA 5LXYA 1NPKA 3KUEA 2ZHOA 2HLUA 4EPDC 2B56A 3VTIA 2CJBA 1FI4A 3O8WA 1RYSA 4K4ZA 1VLOA 4PHEA 3GIRA 5DBCA 5DETA 1WC3A 3TEGA 1ED1A 4CNSA 1JROA 3CULA 2KFNA 5J1PA 2GA7A 4K2XA 3JSRA 3TX0A 4EPEC 2QFIA 2XI3A 1FD2A 1PYOB 2IMWP 9ICQA 3UO0A 5DDQC 5B09A 2ADCA 2FI1A 2NLWA 1HWLA 4N7TA 1M5OC 4UZCA 1J2VA 2M52A 1TAMA 1NJZA 2MTLA 4GC6A 2VFSA 1BPXA 2LDIA 2BCUA 4MFFA 1CUKA 2P8IA 3PIPQ 2KO1A 5ALIA 3LW5C 4NLBA 3L4PA 4BGDA 3C19A 2I6WA 2Z30B 2XWXA 1M5KC 4F0HA 3MM6A 5HQLA 1S8OA 5L9XA 2ZIWA 3LAMA 4R5PA 2IRYA 2FPMA 2V50A 2DBBA 1CRXA 1WWHA 1ZQOA 2DNLA 2HOIA 5GAGI 4M5HA 2XULA 5J1EA 1HHTP 5E3PA 5GMEA 4U9RA 3H59A 2QARB 4PWWA 3M32A 2DXEA 3ICJA 3M8YA 4DPWA 1VQKS 4CLFA 5HVHA 2FE9A 4B9TA 2EK1A 3BGLA 2ACYA 3QT6A 4PQAA 1EQ0A 4EO8A 3CJ5A 3HVRA 4KC5A 4YN4A 3IA0A 1FE4A 2K8AA 1VLBA 1S3TC 4EX6A 2HNZA 4YOEA 2ZH6A 4LFBJ 4PPZA 2I1RA 3MD3A 5HBMB 4RDWA 4QZGA 4LRCA 1QSSA 5J0SA 1N5VA 4Q0BB 3HK2A 3ORYA 1DZ5A 1HA1A 2OMOA 1WC1A 3WHIA 3MEEB 2BDPA 5MLCV 3DMJB 4KGMA 3DRXA 4NOHA 2UV8A 4UT4A 4IQUA 1Q16B 5DZ7A 2JZBA 4MH8A 1FKOB 3G8SA 1XO0A 2C2KB 2XYPB 3PW4A 2QB0B 1BMQB 1FXRA 4WIQA 2R8KA 2V8DA 3DXSX 3QGIA 4PXDA 2AYEA 1NJXA 3N5BA 2LKZA 2R7SA 2QS8A 1FA0A 1YT3A 1FRHA 4KLOA 2AGPA 5AKQA 4FP9A 4KSEB 1R89A 2HQDA 3BSOA 3NP5A 3OBIA 2LYHA 4YUDA 2KJ8A 2I8EA 3SDEB 5IT0A 5IILA 2F9JA 4DR2F 4ZPTR 4GVLA 1DLOB 3NS6A 1T9WA 4NYOA 5D4OA 1JLBB 1N2XA 9ATCB 1XEZA 5KL8B 8ICMA 2GQ2A 4FFDA 4NLNA 1YRTA 4RX6A 3KLFB 3N7RC 3KFUF 1RPLA 3ED5A 2V8PA 3M8ZA 4RPFA 3KJVA 1REGX 3TFRA 3O0FA 1KCXA 3I0SB 2HFNA 4JI1J 7ICOA 4O44A 3OXFA 2YXLA 4OLOA 5FSDC 2XMMA 4ZVTB 4M5NA 4CLUA 1YRUA 1DK2A 2C1EB 3FEXB 2WHOA 1X5TA 2RH3A 2HBYB 1FCAA 2Y9HA 1JB0C 4ZVRB 4R66A 2GWNA 2RRAA 3C15B 2KH9A 4C8ZA 4KFBA 4FS1A 4BDPA 1I1GA 1CEZA 1ZM9A 4IRDA 2B9EA 4N77A 3ISZA 2WVBA 3RJFA 3TA0A 1GKPA 5GMDA 3KLEB 5KG3A 2V2KA 1BY9A 4TY9A 1WOPA 5ALRA 4NZ7A 3ULHA 3J80U 3QRPA 4URQU 2WF7A 1G7CB 1Z4UA 2G07A 4Z42C 1Q5YA 4P0QB 3O6QA 1X40A 4Y2UA 8ICJA 1DTQB 1S7IA 5D78A 3ZTPA 4ZKAA 3AA8A 1HBOB 3I0RA 3MUTP 4M63A 5L1KA 2C42A 1VI7A 1RLDA 5MAOA 5DBBA 3L3CA 1HBMB 2BQ3A 7FDRA 2NSBA 3RUBL 5GVQA 2K8BB 3EYZA 4M94A 5G4DA 3EWAA 4CLTA 4Y2PA 2IHMA 2AW0A 4O4GB 5CYQA 3B0YA 4L73A 1RXWA 2KL8A 5D3GA 4UBCA 4F91B 5C25A 1UKUA 1CLFA 1A77A 5LMUF 2YNGB 3LP2B 4LF6J 3TANA 4I27A 2WVFA 3DXBA 3EZ5A 2ACMA 2CPEA 1RTIB 3IG1B 4PZVA 1WEXA 5IINA 3GV7B 2HAIA 3QXGA 4ZVOB 3FBBA 4K8RA 1ZPVA 3CCLS 1HD0A 3HWTA 1D9AA 2V67A 4ZOSA 3V5RA 1WACA 3MTJA 4J9PA 1Z2LA 3TUZC 1JALA 2R4FA 5AM1A 1HWKA 2BBEA 2W2MP 4DL6A 3BJYA 5HMDA 2QJ3A 4QIWF 2MKHA 2R8IA 4FXDA 4P0QA 5RUBA 3E8OA 2R2RA 1FHTA 2PKEA 5KFBA 1UVLA 2FGOA 5E3RA 2NPFA 3ZZ0A 4C98A 1YWXA 2XZWA 1WSRA 3MC1A 3GQCA 3CTRA 1CS4A 3AB2B 2H3EB 3W65A 5LMNJ 2NYVA 1ZQQA 1VQSA 4PZOA 4KO0A 3QU9A 1JK9B 2CZVC 2FJDB 1EKSA 3UNYA 4QWAA 1HMVA 1U6ZA 3AB4B 5ALGA 2F5GA 4WHBA 4ED4A 7ICVA 4LSZB 3UCZP 3DGPA 2GHVC 4NMLA 1NDCA 4LR7A 4QU7A 5KFTA 4ECYA 2VG6B 2HBQB 4ZVFA 1W2IA 4OV6A 1U49A 4BXOB 3QGPA 3P45B 4NV0A 2KP7A 4HT7A 3SENA 3PIOQ 4ECXA 3D6TB 1TL1B 3SD7A 5HMMA 2M4MA 4WTYA 5BOMA 2OODA 2ZXHA 5HMLA 4RZRA 4RW9A 1S6QA 4FDFA 2NRVA 1MSWD 2M3DA 1VHFA 1XR7A 4RW8B 5DM7Q 2D3OR 1GMVA 4EBEA 1YKWA 1RT3A 1U47A 3C15A 3RYLA 5ALOA 2KHVA 3L4BC 4KLTA 1FWBC 4KO0B 1R8BA 3OL9A 3JTOA 3S1TA 2EXUA 3FBEA 2QLXA 1DGJA 2CVIA 2RS8A 3W61A 4LF6F 2UXCJ 4P0PA 1CPZA 3WK9A 3CDBA 5B0EA 2W01A 3S6JA 1YNYA 1N6QA 1O8BA 4A48A 2RKIB 1XU4A 4RW4A 2F1FA 2ZOMA 2H3VA 2JEJA 2LQ5A 3MEGA 3MR2A 3D0IE 4LF1A 4LIWA 4JUZA 2OWOA 4AC7C 2DGXA 3W2WB 4IRKA 2X1BA 3A3OB 3UVJB 1FF2A 4C97A 1M1HA 1FRKA 4YHHF 3LP2A 2UUBJ 1FXLA 3LK9A 1ICEB 2R18A 1HNVA 5KFNA 2MQOA 4ZLJA 4Y2AA 4TY8A 3MAAA 1FWFC 1LW2B 4DHVA 3TWZA 3W8PA 1Z4OA 2IMRA 4U6PA 2VIXA 3M6XA 5C2GA 2XC9A 1RJQA 3MM5B 3JSYA 5CYQB 4I28A 2VM8A 1QUPA 2MKKA 3Q8PB 3A12A 1JLCA 3DFEA 2WB4A 1HWJA 1HQEA 4ZHRA 5IT9U 2RRNA 1OY6A 3MR3A 1YI2S 4BC9A 2P9EA 5I3UB 2OMLA 3FMBA 5CRXA 4I2FA 2OPPB 3BE7A 5AK6A 9ICVA 2VA3A 3K5NA 1S10A 2VQFJ 3POTA 5DJBA 3ZD8A 1FWLA 4RL1A 3WC2A 3TRGA 2O67A 5ETSA 2FVQA 1FEHA 3DDNA 4H4KC 1MQ3A 1R8CA 3PMNA 2DK2A 5EX0A 3NRBA 2M9NA 2JL9A 1H7WA 1QVGR 1KDNA 4N56A 5ETTA 4C80A 1VQ9S 2G3FA 5GADU 2J9CA 2QO3A 2GQCA 4F5NA 4ID5B 2YQEA 4UAUA 2LKYA 1KBRA 3N4WA 1Z00B 7ICPA 4F0MA 4OI1A 1ZD5A 8ICKA 3FZBA 4OJOA 1L3SA 5LMNF 2AQOA 1SXLA 1K73T 5B0GA 1LEOA 2E7VA 4KAIA 5EWGA 2DGSA 4OJ5A 2UP1A 1IJFB 3OGUA 1YBAA 4OX7A 4DCOB 4QPTA 2NRTA 5KG4A 2R7VA 3EE3A 3PEJA 4PCQA 2JJ4D 5CXTA 3PHTA 3K5PA 1JLGB 4C7YA 3L3FX 1WDTA 2MY7A 2H3QA 2U2FA 5A6WA 2N3OA 2LI6A 3JAMU 1LWEB 3CMQA 2G1DA 4HDGA 3T9ZA 3SAFA 1RYRA 3TYTA 4FVCA 2FLPA 4AP9A 4RDVA 4K4GA 4DOCA 5FD1A 4ZLNA 1ZA2B 1N54B 2DNPA 1VBXA 4KLDA 4MK8A 2EQYA 4ANCA 3J7YU 5ETNA 2B6AA 5G5GA 2O6KA 2F8EX 9ICWA 3F41A 3H0MB 2IYGA 2YKMA 3LALA 1KLMB 2MJNA 3TZXA 3ETRA 3LGHA 2XZTB 2AKWB 4KPCA 4UBPC 1KLMA 3BKTA 4KLSA 3W5XA 1BQMB 2C2OB 1JLFA 3NNHA 2OELA 4Y00A 3PY8A 4F0KA 1NSQA 1J2NA 4FPIA 1N4LA 2E1MC 2E5LJ 4RNFA 1RHKB 4ITSA 3GJQB 4DCCA 3ISNC 3EUNA 3PSIA 1RTHA 9ICRA 4LR9A 5D0EA 2G5HB 1FO1A 2YNHB 3TAQA 3DLKB 2N4DA 3HSGA 2ZNZA 2MKIA 2NQPA 3DDHA 2K7JA 3UMCA 5DG7A 2UUBF 5ALHA 4C11B 3K58A 3VC8A 5DQGA 1R0BG 1LV5A 3NCPA 4O3MA 3MM8A 5D49A 4CWBA 4X4RA 1Y5LB 3ISBA 1KWMA 1NKBA 2AZ1A 4Q0BA 2E9TA 5CYMA 2ZD1A 3PX6A 2BDUA 5AKGA 3MMCA 3FAHA 2GNKA 3CCRS 4KN4A 1WSVA 5E79U 2RSQA 1FIQA 1QDUB 4OI2A 5A76A 1MN7A 1JMTA 1XSNA 2AGOA 1Q5VA 2EFGA 1G4CA 2B9YA 3QZ8A 1BGXT 4HL9A 2VODA 3Q8MA 2OJ3A 5CCMA 3BSCA 4A8FA 2VFRA 4RQ6A 1VQMS 2CDRB 2VA2A 2QT7A 3IBFB 1K1QA 4CF4A 5IOLA 1QAIA 5HI7A 4AFFA 2H65B 7ICGA 2PFQA 1S1UA 4WU2A 4K4VA 3CD6S 4I2QA 9ICHA 2VG6A 4K0KF 5JXSA 5KFSA 3OTCA 3H8JA 1Z1BA 3MUMP 1ZQGA 9ICLA 2QIFA 1RK8A 2W11A 2W54A 2LEBA 4NCGB 2LVWA 3OHAA 4DPYA 2RF2B 2GS8A 2HBRB 2B0GA 3MBYA 5IC4B 1Z1VA 3GWCA 1ZQIA 5B0FA 1A5NC 5KFJA 2D8CA 1PJ7A 3KLGB 4ILMA 3UDCA 2R8JA 1QUVA 3QX7A 2J0SD 3DGPB 4CO1A 1POJA 2VFVA 2R8GA 4FZNA 2MXYA 4LF7F 2CNOB 1Y10A 1HEKA 2DH9A 2GVDA 3ETOA 1YJUA 4AE5A 1LQ9A 4KN7A 2ASLA 4DR6F 5M2RA 1L5UA 1RAFB 1SKRA 4WJ3B 2QX0A 3W9HA 4PXEA 4UTGA 4KFBB 2ZD1B 4NL9A 1P1MA 4HHJA 3CJ8A 3RW7A 1NH8A 1F0MA 4RW7B 3ADAC 4MKBA 3FM9A 1KOOA 2R7QA 2I9UA 4YHHJ 3ITHB 2DGZA 8ICZA 5FIIA 5J2EA 2VB6A 3BREA 5K8MA 1M5SA 3B4DA 2XZDB 3ZTSA 4G6VB 2KHQA 4GXJA 4EFAC 2DXDA 2W2OP 4IO1A 2DITA 2MKSA 2LA4A 8ICBA 1RLCL 4RLEA 2DR9A 2FJ6A 3VAKA 1VQ8S 3K5OA 2RHSB 1IE7C 5SZTA 3AHPA 4KLFA 4B9UA 1RHRB 3J7AN 3VALA 3CMES 2WF8A 1HARA 4C65A 2ALYB 2HIQA 2AYMA 3OXGA 2E1RA 4RU2A 2E1PA 4DUZJ 2JV3A 1AZSA 2W9MA 5AE1A 1ZZNA 2GMJA 2VF3A 2BKOA 2H54B 2RQMA 1GTHA 3M1VB 1BQNB 4DR7F 1HW9A 2PE8A 4ECTA 4PGXA 3DHXA 3NCRA 1HWIA 3MEKA 3DLHA 4I29A 2I5JB 2XYGB 3ITHA 4GVBB 1UP1A 2VOPA 1ZD4A 2DCLA 3PRVA 4KTQA 1VBKA 4DL5A 2VQEJ 2JHEA 3FRZA 5LJ5Y 5DB8A 4M5IA 5HR7A 2YWEA 5AK4A 3TR5A 1NLKL 3G6VA 3ISCA 4YB5A 4RBUA 1YJVA 4V1YA 3I4HX 1IG6A 2KM8B 1HHQA 1Y3KA 3DOLA 2YB4A 1RWKB 2RUSA 3JSBA 2LXFA 3FRYA 4DZHA 4FYYB 1NJWA 4YXJA 2E3TA 2PN6A 2HQ3A 1SC4B 3HHDA 5DDPC 4F04B 1ZQDA 5I42B 1N8RT 1F2GA 2R2TA 4EELA 3FEZA 4QCLA 3MM7A 4DR6J 2CG4A 4PG7A 3VZHA 1CC7A 4F92B 3CCSS 1BPEA 2G0IA 2XIDA 1B7YB 3DLGB 2E5HA 5D4LA 3FBCA 2EEYA 4P7VA 3M6VA 3C3LA 4EPBC 5ITHA 1T05B 4I56A 4RU9A 2ZITA 2ZBRA 1GH8A 4EBDA 4QWCA 5ALKA 1R6VA 2HK3A 2W3SA 3BPSP 2FZKB 3FQLA 2VJ5A 1LK7A 1UWAA 3D3BJ 1SC1B 1ZH5A 3P96A 3QIPB 7ICNA 3LF0A 1N32J 1NZAA 2IA6A 3HF5A 1IR1A 3N7PD 4TLQA 1TVRA 3V72A 4GBDA 2M8HA 2W9CB 1NKCA 2GIRA 1IKWA 5F3TA 2OYYA 4ZVHA 4E8UA 4EU0A 1D8LA 1EJ7L 3QYPA 3MM8B 4C8KA 4NZ6A 1DTTA 2W4PA 2W7OA 5H2FU 1NB2A 5CYMB 3E2EA 4K4IA 2DQNB 3QZ7A 5IS2A 2GMLA 2DVIA 3BBFA 2Q66A 1N56A 2QMUB 1TQLA 2R9LA 1LW2A 4KHMA 1OO0B 1B64A 3IP4B 2XTJP 2W7PA 2VKZG 4DS5A 4ZIWA 5DDMA 1ZQHA 3R3TA 5KFFA 4FYXB 1KTQA 2DGWA 1DGSA 1R9ZA 4PABA 4KIAA 3LA4A 4Y2CA 4DV0J 2LA6A 3EGWB 4CIOA 5F8MA 4UBBA 2B43A 4I2DA 1DQAA 2J9EA 1RXVA 3SAHA 1Q86T 4W90B 1S9FA 4GVBA 5G0RB 3D2QA 4EEYA 3ETMA 2OH2A 1GT8A 4MEXA 1NHKL 2Q79A 5CA7A 2JEIA 4ANEA 4G7EA 4ZPCA 4C0ZA 3OHBA 5J2NB 4NM1A 1PK3A 1J27A 1X0PA 3MEDB 2JVOA 3K4GA 2GGPA 4WU3A 1BPDA 1X31C 2DB1A 5GADI 4Y2SA 2NYIA 4I7FA 4Y2TA 4CCHA 3GFZA 4V1Ak 4BC7A 1EF2A 3E0FA 2BPFA 1IKWB 4KGXB 1S1UB 1SJFA 1HLWA 1TFRA 4K0KJ 5DDYA 3M8QB 3ZTQA 3D54A 3LPEA 5B66U 2E1CA 1EETB 1M1GA 2C2NA 2HGNA 1Q8KA 3GJTB 3KLFA 1N33J 4K5RA 3MGHA 4ED3A 4BX9C 4DN0A 9ICBA 3M8WA 4YN3B 3KJQB 3TNVA 3FVYA 2F44A 4NLQA 1T0TV 4I2BA 1IBKF 1UMJA 4XTTA 1T9UA 3DOKA 3F44A 3KTQA 2KSOB 5E5NA 2K3IA 2CJKA 3CT9A 3ICXA 5J8YC 2W2NP 4E0DA 3V7PA 4EZ9A 1OSCA 3L7OA 3UXNA 4Y3CA 4G3IA 2WAQD 5A2QU 4KJIA 1FRMA 2FJEB 2W9CA 2JRZA 3OR1A 2D9OA 2G0JA 1FRLA 4P2SA 3KK2A 3WKBA 3QGKC 8ICOA 1REVA 2EBGA 3FCHA 2ZWOA 3BZCA 4N47A 2JMGA 9ICTA 5CD4H 4I7FB 5ETOA 4R63A 3HW8A 3CGIA 3F56A 3S01A 4DBQA 4PQUA 1BUXA 1TK5A 4OV1A 2DGQA 1CJVB 1J5OA 4P9SA 2ZKTA 3BO4A 1ZQJA 4EX7A 4F71A 4RW6B 2VC0A 4DU8A 5ALFA 1YDLA 3J81U 1SIWB 3FQKA 2Y0BB 2FJAB 4NMXA 2DJWA 1S1TB 3ILOA 3ENQA 4PR6A 3W7BA 4B3SJ 3UQ0A 4RUCA 1F2HA 2CA9A 1KEKA 3CEDA 4R8UA 1JX4A 4NY8A 4PG8A 1FDDA 3I87A 1LWEA 1A0PA 2YMMA 2A3JA 1YX2A 3MAAB 2VG7B 4DUTA 2D3UA 1SVDA 2B5JB 1HNVB 2VPYB 4QU6A 3VHQA 2IAJA 2OP5A 1NK5A 1RBLA 2VQEF 4HKQA 1T9XA 2E8OA 2F8HA 3QT5A 4Y2XA 3QFHA 4F4KA 3LS9A 4KPYA 4AL7A 1FWDC 1Q4RA 3OTQA 5HMWA 4DN9A 1N33F 4F5PA 1YJ7A 1N63A 2WCXA 2BPGA 4S0MA 3K89A 3SSRA 4CQCA 3PTWA 1PCAA 2GHPA 4NLVA 2YNIB 1EAYC 2EFQA 1HIWA 4F4YA 2NYHA 2GIFA 1ZQUA 4DV6F 4ECRA 5TISU 2PFFB 3AOBA 1N5WA 1FWPA 3E01A 5KT3A 1SV0A 1AXQA 1RCXB 3I9V9 2NXNA 1QQ5A 4ZVQB 1WG1A 4HYKA 3AOAA 3HVTB 1DRGA 3QIPA 4GOAA 4ECZA 2YWWA 4USKA 4NYZA 2KJVA 4MIAA 2V2QA 3PZPA 4MAKA 3G87A 3K5MA 1H7XA 5I4MA 1Y88A 3HT0A 2Y1RI 2FLLA 1TVAA 2MQMA 2VV5A 2JNJA 3E51A 3KHHA 2DNHA 3RH5A 4RJVA 1OIAA 1TKTB 1GMWA 4PRFA 4HLBA 3T9NA 2F3JA 2KFYA 2KKHA 3ZZYA 4A8QA 1C1CA 3M8PA 3IR5B 1SJ4P 7ICMA 2ASYA 3UDLA 3KOOA 4IQTA 1KVKA 4M9LA 4PL1A 3BGUA 4F4XA 3LSCA 3G9CA 4FZVA 4N41A 3PW5A 5J2HA 4PYDA 2FPKA 3ZDDA 1K0TA 4CT8A 4EZ6A 2KAUC 3CJ2A 1S9GA 4RBTA 4M1KA 3JTPA 1PK1B 3SDEA 3GSDA 3B9JA 4M9HA 4NL5A 4EGLA 4ZS6A 3GFXA 2CPXA 1PO9A 3ZZRA 1AT1B 1AUSL 4WK3A 4OI4A 3TJ8A 3JYTB 1WCNA 3RB0A 1RKIA 1F5CA 1ZQMA 4QZEA 1OW5A 3NVVA 3OXLA 2UXDJ 1TL4A 4ENOA 3P8BB 4A8MP 1HNIA 1ZYQA 5KFYA 2BKEA 1L7OA 2Q4TA 4X4OA 1ZRNA 3D0HE 1UCNA 2B5JA 1XERA 2XICA 1YG0A 4YB6A 2Z8QA 1JLFB 5J0QA 2KB2A 4DR2J 1U8WA 2KG5A 1T02A 1FRJA 2H5JB 1FEZA 4DFMA 1S1TA 4N5SA 3K17A 4KGVB 1UAWA 4QPXA 2OSRA 4H4OA 4CQDA 3QJJA 2NPIA 2WRMA 2G13A 2D6FC 5IXUA 5AE2A 2DR6A 4B3SF 3F73A 2D41A 3V6DA 1RABB 4MKVA 3NY0A 2LQ9A 1SXEA 1N34F 3BR9A 3IGVA 2YKMB 1S1WA 2AH5A 4M5MA 4ID8A 4ZP8A 2ZH1A 4UF4A 1D0EA 3BZKA 2R7WA 3FFIA 1YJTA 1DURA 2ICSA 5ALEA 3EPGA 2J76E 2NXEA 3CWJA 1TE2A 1KFTA 2DNRA 4QIGA 4C6AA 5KFPA 1ZM2A 2MUTA 1U1QA 2BJ7A 2AMCB 1FEEA 5ALWA 3I76A 5B0AA 4QZCA 4PG5A 4R64A 1QD1A 2A10A 2VBXA 4M5LA 2CAJA 3CCMS 2OEKA 1RWUA 3J81Y 3D9BA 2J7WA 1IN0A 3OT9A 2XMKA 2FPLA 3QO9A 1Y7PA 4NRUA 2V2VA 4ID5A 1WG8A 2UUWA 1FWKA 3G8TA 3M32B 1WTBA 2IMOA 1FK9B 2H5IB 1EX8A 3BGFA 5DKWA 4QQBA 4WE1B 3DU5A 5HSPA 3SFUA 3CIMA 3GPAA 3ZZUA 1KKHA 4P73A 2NS1B 2MYFA 4YR2A 3WK5A 2YMQA 4CO0A 4JI5F 3TQ1A 1NDLA 1VHIA 1BQXA 1R27B 3BS9A 2VDHA 2YQ3A 3AT1B 3OTEA 5J1NA 5F3ZA 1XMBA 5TZVA 2CRXA 3O3LA 2LECA 2HCFA 2FTRA 3AJ2A 4Q45A 1BVSA 4JI5J 4RW7A 3V6JA 2ZH8A 1V5VA 3CJ3A 1DHMA 2V6AA 1WHXA 1U48A 4CE6A 4JV5F 2NXCA 4A8XA 3MECB 1RAKA 2PFOA 2ASDA 4JOUA 3NXZA 3IAM9 1RU2A 2L5YA 4Z7CA 3KHRA 4AYBF 1FWCC 2GCFA 4DSIA 2UVRA 3AD9C 3ONQA 1U2CA 4ZJLA 4CNZA 3PW2A 1NPPA 3B6BA 4H4KA 3VGVA 3IS9B 3BSAA 1WEYA 1NNDA 1M5PC 3P49B 5ALPA 1V3SA 4DV2J 2W03A 1VR6A 8ICNA 2AZ3A 3MI7X 5D77A 1R31A 1LOUA 2AYBA 1R6YA 4TQRA 1HWUA 4QWEA 1GMWD 4IOCQ 1TAUA 3EUB2 4I6YA 4USIA 2AEFA 2EPIA 4ED0A 3LNPA 1LNQA 2XY6A 1L3TA 1BQNA 2LYBA 2IVYA 2HG4A 3PMLA 1ZQTA 2LEAA 3AU6A 3IC1A 2F1JA 2QB1A 3DRPB 2SXLA 4DUYF 3MDCA 4WFZA 3RW6A 2L9DA 2HAFA 3PYGA 1KNZA 5G0RA 4WYLA 5DB6A 5L46A 3MPWA 1F9FA 2XSJB 3I0SA 4NZ0A 2N7CA 3VWSA 1H2TZ 2ZBCA 1DJ0A 4C0BA 3V6KA 1NZ8A 3IR6B 3PR4A 1BWEA 3BBBA 3FGVA 3DLEB 4DL4A 4DJBA 2G08A 2I9GA 1APSA 3AQPA 1IBCB 4OCZA 1FWAC 2FJBB 1F6TA 5LMUJ 4RW4B 2IRUA 3RJKA 2GSEA 3FNNA 1N6QB 1FFGB 1KONA 3MGIA 4GRSA 3T1HF 1IQTA 2X1AA 3OV7A 3NNCA 4NLZA 2LFVA 4QIWC 5E2QA 1Q82T 2HRYA 2W24A 2EANA 2ZDOA 2VONA 2DNOA 3MAHA 5JTIA 1NXIA 3ZNUA 1GTEA 3OR1B 5HVGA 4Z7YA 1ULRA 4J37A 3PW7A 5J2BA 3HM9A 2F76X 2UVUA 2KVQE 2UZAA 2GVZA 4C5YA 3O1LA 2D74B 1T03B 4QZBA 5DBAA 3GG0A 3CCJS 2WW4A 2W55A 1UBPC 4LSNA 2LMIA 4XA5A 3HHNB 4USMA 4C4SA 3DRYA 4F7VA 1URNA 3T1YF 4GXIA 1DAXA 3TVKA 2EFVA 5L1IA 4DV1F 3WK8A 3W63A 3DGVA 5L9NA 1U26A 3B8HA 3HCXA 4TUQA 1N5SA 3DOLB 3QRRA 2AWZA 2YWKA 2J9DA 2CJYB 4RNMA 3HKZD 4LFCF 5EDWA 2CQBA 2N7YA 2J0XA 1ZA1B 3HHEA 2QEXS 3RGIA 3AJ1A 2QA2A 1SC3B 2B9WA 1RJRA 4ELTA 1XK8A 5I3UA 3UCGA 5A6PA 4RQ7A 1VRUB 3W9JA 4US8A 4M47A 1Q3VA 2NXJA 8ICGA 5J0XA 4DR7J 5ETLA 2DO0A 2IHR1 1KL9A 3GIJA 1HJPA 1U4BA 1MLAA 3VAHA 3PJ9A 3MM9B 4TYAA 3HULA 3JXOA 3LGNA 3H42A 3M9OB 4U7UD 5GAHI 3GJSB 2P6SA 4XRHA 1H3DA 3R27A 1HQ2A 1RAJA 3M1YA 3RBEA 4U67Q 1YRRA 2FHMA 5KT5A 3TUPA 1C0UA 1HBOA 2VJVA 3WC0A 1UWBA 3K57A 3JAMY 2F4VF 3MPVA 5AK3A 2CQIA 3PM9A 1T7PA 2FY1A 4OYOA 5EWEA 3T1HJ 2FGCA 2HNYB 3KK2B 2H3ZA 4LUBA 1NJYA 2HEKA 2MSNA 2UVWA 3H4BA 4CO4A 3L09A 3CC2S 7ICIA 3RH6A 4F0LA 2E9ZA 4PHPA 2MGZA 2CQ0A 2NXUA 4TVAB 3ZZPA 1UVMA 3WKCA 4YDXA 4ZOHC 2KVSA 3TI0A 4CO2A 4NLSA 2BCVA 4ZCMA 1VS3A 2AQ4A 2GVDB 4P71A 5HMXA 4PGYA 3SMVA 2C2DA 4JI8J 1A5KC 1KRCC 2CJ9A 4K4XA 2JDJA 4RQ8A 3GYGA 5F0UA 3CDUA 5ALVA 2HBZB 3UW1A 2NCKL 9ICAA 2VANA 4ETXA 1X6IA 3CD7A 4JI1F 2P5VA 8ICYA 4XIUA 2KZZA 1SKSA 3BYPA 4IQMA 2ZH5A 1T05A 2VC1A 3FUYA 3HPAA 4H54A 3U02A 4HT5A 2P35A 1X9SA 2YMPA 3GE9A 1ELOA 4C0HA 4WE1A 4L9XA 4K4TA 2MA1A 3D5MA 1P6TA 4ZVGA 4US9A 2E1AA 2ZJPQ 1C1BA 1R7IA 2AJ2A 1N36F 1GXUA 4UOGA 4V1XA 2W7AA 3R2CJ 2YN4A 2BW7A 2JC1A 4MIBA 5HNKA 1KC8T 1VYAA 1RT7B 2DGTA 3C6TB 4ATNA 2XO7A 4DV0F 1TL5A 4USWA 2V8GA 3TAPA 2FHOB 4OMFG 3N7SC 3N6MA 1C7YA 1H6KX 2ZUGA 1L3KA 3CO0P 2G09A 1HUOA 1TV6A 5B5EU 2MQLA 3KJVB 3CJQA 4P4MA 3D1OA 2FVSA 3H8MA 3M6KA 1SUQA 3L7UA 4DPUA 1SWVA 3MCOA 4ZLLA 1SB3C 5L1MA 2AIRB 4W92B 1OY9A 3W2VB 2ZUCA 2HMXA 1MROB 2BCQA 3R5BA 1C20A 4Y2VA 4Q2MA 4UB1A 1CJUB 3BQ1A 5T7LB 4NXMJ 3D3CJ 5J2MA 1OJ4A 4CEUC 2J8AA 1IIPA 4RUHA 3PV8A 1N0VC 4H4OB 3HPOA 4KLUA 1R0AB 1RK5A 5FLXY 3MCSA 4MFBB 3RJGA 2XNQA 5A6TC 3DLBA 2WSCC 2H3IA 3UDEA 1C4AA 3LO3A 5M2UA 1V97A 2MY8A 3JQMA 4BBYA 1S1XA 4Z6EA 3SCIE 4D3HA 4Q8FA 4FKYA 3K0JA 2CNNB 1XMQJ 9ICGA 4Y65A 1TV9A 2W4CA 2F1IA 1RWMB 1MWQA 3NS5A 1FKAF 5THWA 1S77D 2FHJA 4MFCA 3MEEA 4NI2B 3UBPC 3NRZA 4P2XA 1PG5B 4LF9J 2BRKA 4RQ5A 2EVZA 4J03A 2R8HA 5KFEA 1EHWA 3HX9A 2HQFA 1S6PB 2IAJB 2A6MA 4IR1A 3C6TA 3EICA 3SFGA 3KFWX 3ZDEA 1FX4A 2JEGA 4M2YA 1NMEB 1Y00A 1RQ0A 4KV8B 3KK1B 4DV1J 1SI9A 3MM9A 5CHCB 2IPOB 4OFZA 5AI8A 2B6AB 2A19A 4LZDA 3P6YC 5DGAA 1AUDA 3S7RA 2AXTU 2MQPA 3IM9A 2HHXA 4JI6F 2DKXA 2KE7A 1SPBP 4IG0A 4CQ1A 2KXHA 3A8KA 1R8AA 5EHHA 1JN3A 5C0YA 4WFBQ 1GMUA 2J8SA 4JI2F 2V8HA 2KVCA 2I5HA 2PI5A 1SH3A 2LYAA 4JBCA 1TAQA 3N4MB 2HHTA 3JPOA 3NGSA 2YWHA 3ZC4A 4TNOA 3C28A 2E1EA 4G65A 2I5JA 2NO4A 3N6LA 5HATA 3N2CA 4IR9A 3IFEA 2BJ1A 3PX4A 1WCLA 3CJTA 4ZHRB 1X42A 2CNKB 3SEIA 4DUZF 3U1MA 3BM7A 1M5HA 3OUYB 2PUZA 3OJSA 4J9SA 4DL7A 3LOUA 2RP5A 5J2PB 4UAWA 2CQ1A 5EUHA 1MG7A 1Q81T 2UXCF 4NA3A 4ES3A 4NPOA 1CQMA 3AY0A 4C5ZA 4FYWB 2DISA 4PWDB 3G6ES 2ODGA 4UOHA 4PYAA 2MJUA 3N79A 5DG8A 2BOAA 4P2HA 1CVJA 1RG6A 3QGGA 2J0QD 1A6SA 1YIJS 2VZ9A 1GNKA 2ZIVA 3OLBA 1IXRA 3HHLD 2FMPA 3CDAA 4YMNA 3JYTA 2UXDF 2M2BA 1ZQFA 1RSCA 1F3FA 1TFYA 4WZMA 1FDNA 4EMDA 4WTOB 2E29A 1X7VA 1NU4A 2CQDA 1FFSB 3HSJA 3M30B 2FY8A 5A8WB 4M5DB 4USVA 5EOZA 2JSXA 3V7LA 2D1CA 1LXJA 4F25A 4PHDA 5D3GB 1L3VA 8ICUA 4F5OA 3IG1A 3Q8KA 4RW8A 7ICKA 1HHSA 2DNGA 3NGKA 1SXDA 4OLPA 2M5YA 2QT3A 1N60A 4NXMF 2YVSA 1TP7A 4M0AA 1HNIB 4OQJA 4OI3A 1NZPA 2PFNA 1TELA 4WXWA 2MZ1A 1YZ6A 2CQ3A 1ZQ1C 2DUYA 1SV4A 1S49A 5J2DA 2RILA 1QQ6A 4CM2A 1S1VA 4YCXA 7ICSA 3JPQA 9ICXA 3UI3A 4P4PA 1RZTA 1CJKA 2CJQA 2EBEA 1ZJMA 1PILA 1GK8A 2CWXA 3H8WA 4HH1A 2XMWA 1HD1A 2K60A 2RNEA 1X6JA 1ZS6A 1O51A 2B6GA 3KK3A 2XWYA 3C2KA 5KAIU 5DS7A 4DCPB 1UW9A 3LUYA 1FDAA 3V6HA 4Y2RA 1C1CB 5AXNA 4F2SA 3VGSA 5HROA 4BUGA 4IRCA 5KAKA 1POKA 1T3NA 2RQKA 2FVRA 2RRBA 4K4UA 1W25A 2MMYA 4I68A 2KSOA 2O1PA 4RBVA 2YH0A 2D3DA 2EFPA 1EP4A 8RUCA 1A0OB 4N8OA 4NLDA 1ZQKA 3DRRA 4W4MA 1U1LA 1ZD3A 1X4DA 4ZCIA 5C24B 3EM1A 4JMUA 2WOMB 3PX0A 2HZCA 4Q7AA 5KG7A 4O3QA 2MB0B 1S0MA 1WF2A 4FXWA 4DZ6A 3I31A 4KKOA 4FF3A 4Y6IA 5AXKA 5LL6d 5C25B 3GIQA 2JLEA 2MSTA 4A8OA 4DX5A 2ZVIA 1Z3EB 4YR0A 1B7FA 1H2VZ 5A0LA 3GFKB 5CAAA 2KIVA 1RT1B 4LQ9A 4DUYJ 3RJEA 3SAGA 2YTUA 3Q8YA 2MLYA 1DLOA 4NASA 3NGUA 4XDDA 2UUCF 2YX1A 1ZQCA 1AA1B 4WP3A 1TKXB 9ICPA 3SXLA 3AQFA 3RAXA 2QLBB 2C2RA 1MWZA 1RT5A 1KRPA 3UMGA 8ICCA 4OX8A 4CQBA 3GLJA 2DKZA 2PO4A 2BJ8A 4ZMMA 4NLCA 4R25A 1VK8A 2QLJB 5ALLA 3H25A 5JRTA 4MFAA 2EK6A 4YP3A 1FWGC 3X3UA 3HVAA 3T1AA 2LYVA 3KLEA 4F0SA 3E3XA 1JJ2R 1NDKA 1V51A 2WVDA 1VQNS 2ROEA 3BB5A 1URRA 2XI9A 2HQCA 1Q7LB 3TX8A 1O12A 2C2ZB 1S59A 2BQRA 3RJHA 2RHQB 1EQMA 3UFCX 2DH8A 2KYXA 1ZQVA 3NVYA 2OPPA 2DGUA 1VMBA 2KT2A 5GAEI 2DO4A 2DEIA 3PG9A 1U25A 1J5OB 3T1YJ 5AIBA 1IVZA 3ELHA 3H5XA 5HBMA 3T5JA 3R5AA 4BLGA 4O44B 1FFUA 2GFFA 1B3TA 5B0DA 2ADBA 5F3XB 3P3DA 1LWCB 1DTQA 4CNTA 2WF9A 2IOFK 4IG3B 5CH7B 3OVBA 8ICVA 2ZWPA 2Q0ZX 3Q89A 4J9RA 5J1EB 5AK5A 2M9KA 3BO2A 1N34J 2JC0A 3BEGB 1RJPA 1WNEA 2BQUA 5KFCA 1V5IB 3QFWA 9ICFA 1LB2B 3GYXB 2ATCB 2GOLA 3MMCB 3IM1A 3NTUA 1KD1T 4C8YA 3C46A 1PJ6A 2BGWA 4LF8J 3NNAA 5FDLB 3TJAA 3JPPA 4QIFA 3MGVA 5L1LA 2FC9A 2HBMA 4CLYA 2FC8A 1FJEB 4EWTA 2HBJA 3TW0A 2WW8A 2OTJS 1S4FA 4UQTA 3LQVA 3H98A 1CSJA 1IKYB 2CVEA 2A2CA 4QR2A 4LFCJ 1ZQZA 4GKJJ 3AH6A 3QU7A 5EX3A 1JWWA 4J9LA 2BCSA 2DKOB 2IM0A 1XNRF 1M5VC 2M0NA 4QR0A 4DV4J 3PDNA 1QH9A 1ZOTA 5BJRA 4KBIA 4UASA 4CF3A 3MWBA 2RU9A 1I6JA 1G6BA 3EXCX 3DMJA 1VGYA 3BN7A 4G7EB 1N32F 3UXPA 4OZLA 2H9ZA 1NK4A 1Q8LA 3HO1A 1X4GA 4FYVB 1X4FA 4NCBA 1TK0A 3HLUA 3RB6A 1PSDA 1PUZA 3I9ZA 2F3NA 2XG8A 4ZP6A 2JLFA 2ZH4A 3D68A 2EKYA 3IRUA 1RAEB 1RHMB 3KUHA 4DDFA 2VHGA 5LSLA 5D0RA 3MR5A 5DDOC 2F8KA 3FSIA 3EZUA 3PSTA 4I4BA 3L9ZA 1W26A 3D6HB 2BE9B 5DM6Q 1VIOA 1RACB 4LBIA 4RT3A 1CS4B 4LF5F 2D9PA 2BHNA 1RHQB 1ZBTA 2JFKA 3OQ2A 2RU3A 3I0RB 3UMBA 4MK7A 3DNCA 3GIPA 4C11A 3IDWA 2R7UA 2K1RA 4KHPF 1K44A 2F9DA 1JLEA 4OJPA 3OW2R 4ER8A 2KRRA 3C14B 1RTHB 3OFEA 1G3OA 3C1YA 3DEEA 4P52A 3HILA 2J0WA 4O3SA 2YX4A 3RU0A 5HP4A 5D4BA 1VLYA 1VK3A 3OPXA 3SCKE 4ZJQA 2H48B 1E6YA 3D67A 4NEYA 3CF5Q 4F02A 2E8NA 1S6QB 2AHOB 1PBUA 1MW7A 4UB2A 5J2FA 3FYHA 4RO0A 1CJTA 3PRDA 2CPRA 3RTVA 5C2CA 4RW9B 3M8RA 2XMUA 2GOKA 3MABA 1PJ5A 1SWWA 4Y2YA 3GZ7A 4NCGA 4NE9C 2PEHA 4UAYA 2P50A 3CCVS 1H38A 3TADA 3HDSA 2RS2A 5D6GA 4DQSA 3KWMA 3C21A 3AAWB 4CYUA 2QA4S 1U45A 2P66A 4ZP7A 2B4VA 2X51A 3O2IA 2WAQF 5I3QA 1NI3A 3NMRA 4PQUB 3AL0B 1E9ZB 2PXIA 2JR5A 1WWUA 2VJUA 1D09B 2OFHX 2KG1A 3V2UC 3WQPA 3MM7B 4PKDB 4F26A 1PC5A 3TAMB 1Y3JA 1FESA 3LTOA 4KLMA 3N28A 1RHJB 4B3OA 1HMVB 1KOHA 1RYUA 1KLNA 3TAMA 2WONA 3N0VA 1E6YB 5IT4A 4NXZA 3OTBA 4EEKA 3CJSA 1S0OA 3AQOA 1XNQF 2XEXA 3HP6A 2B51A 2R7TA 2Q43A 2W43A 4MKYA 1GEHA 3SV3A 1B4FA 3C23A 3SQGA 2EH9A 2ERRA 3RB4A 2AJ4A 3RZAA 4ZVEA 4HEA9 3T5LA 1Q0NA 3HFVA 4ZPAA 5IQQA 1RXOB 1IKVB 4DMZA 1B0TA 2DR8A 3D0GE 2Z2ZA 2P9CA 2W8KA 1I51B 1OXJA 1FWEC 5IV4A 2VUNA 4CLPA 1RTIA 2OOFA 2XMVA 3JPTA 3GJRB 3IO1A 1YGYA 1JLQB 2DBYA 3SV4A 4IO9Q 3MCNA 1JNZB 1NDPA 3PVXA 2VPZB 2A6OA 2IM2A 3FCVA 3JQKA 4I2PB 1SJ1A 2IM3A 3FEYB 4DSJA 1WC0A 4LSLA 5D0GA 1BQMA 2KT5A 4NA2A 1H74A 1CULB 2YQ0A 5GTIU 1BC6A 1D8ZA 1UJ5A 4OYZA 5ALSA 2VG5B 4WYWA 4GXKA 5GAEU 2BUNA 1WTFA 1KFDA 1URJA 3DM2B 3Q8RB 1A5OC 1UA1A 3R7BB 3EDRB 2HGMA 3K1RB 3CCWA 4OI0A 4F72A 3AXKA 1H73A 2PEBA 3W5YA 2KZ3A 3BGRB 5JMNA 5CB1A 2G0AA 2ILZA 1XJWB 4UB3A 2ZIWB 1WF1A 1ZTWA 2QL7B 1A5MC 3K59A 2M8DB 3DHWC 3J81j 2ROGA 2WTFA 2ZOFA 4FNHA 2GH1A 3NRWA 3CD0A 4I2JA 3IAS9 3GB0A 1GX5A 1RBOB 1BLUA 2C2MB 3CP8A 5CP2A 4GKJF 4K59A 1KR4A 4CH0S 4ES2A 2FVKA 2N82B 2UUTA 4AXJA 2KJ9A 2LPEA 1KHWA 1CC8A 2R42A 1I5OB 4L3KA 5KNIA 3NBPA 3EW9A 4ERDA 2LCWA 1KP6A 2KJ5A 3LP1B 1RT4B 1U02A 4ZVPB 2OIHA 3VAJA 3UD4P 1SCJB 4LRFA 2FJVA 2HLTA 2YNHA 1YITS 4QIVA 1O08A 1HI0P 1TVRB 1UJ4A 2QTWA 3QT8A 1V4YA 2YKAA 3I4PA 5KT2A 2WB1D 2YNGA 1J97A 2RDJA 1XTZA 5L39A 3JSMA 2CXEA 2FJWA 4YY3F 4NLYA 3F53A 1EJSC 1T3QA 1RT2B 5E3QA 4X4VA 5A2QY 1P27B 1EARA 3HJFA 4TYBA 4U8YA 1HR0J 1RZMA 3H7HB 2RQ4A 1RTZA 3NQBA 3U26A 4RPXA 4JWMA 2FHJD 2XS7A 1RKJA 9ICIA 1VRTA 5A0YB 1NNLA 3LVVA 2ZH2A 1VFJA 2MRLA 3WX4A 1LFWA 3DU6A 2ZUBA 3PACA 1Y0HA 4ECVA 3RJIA 1MU2B 3ILLA 2QA1A 3X1LB 3BGOP 3RF9A 1UVKA 3KLHA 4JV1A 3UQSA 5K20B 2B4UA 2DNYA 1K1SA 3BS7A 2VBYA 1JLGA 3NOGA 5HMZA 3PW0A 5AKXA 3FK4A 1SGGA 3THVA 3IG8A 4OIXA 2GX8A 3IGNA 4CLZA 4IDKB 1U7LA 2ZIXB 2APOA 4RWXA 1HNXJ 1BPBA 3W2WA 3AQEA 1IWGA 4FZLA 4DG1B 3MUVP 4IOAQ 4DV6J 2DRAA 4HI2A 4KE5A 2YWGA 2DR5A 3T5HA 1JJCB 4ZLPA 4ELUA 1QAYA 2P9GA 2E8MA 2ZG6A 3TKAA 4PGQA 1PAEX 3W8GA 2CJXB 4QZIA 5FSEC 2A3VA 3V81B 3KG1A 2HQGA 4DR5F 3SYZA 5EWFA 2WFAA 1XN9A 2K3KA 4ZN1A 2MPUA 3EGVA 5F0WA 4GKKF 4B9LA 4OHVA 2DNNA 5BYQA 2C3UA 2I38A 5KFUA 2KU7A 2CQCA 2X3DA 4WPAA 3QGAC 3ZZOA 2ZC4A 2ZJ5A 4RNHA 4BWMA 3QWPA 5LXRA 1TR0A 3NGTA 1VRUA 2HI0A 2Q1LA 4GY7A 4DQPA 3VZIA 2IM1A 4L3NA 2GAHC 2F63A 1VQ4S 2UV8G 1N61A 4CI0B 3A3PB 2BABA 4BXOA 1UWBB 3RG6A 1NOMA 1SZPA 4DLEA 4UZBA 3NAHA 1TL1A 2AX1A 3BDPA 1UPPA 3LA0A 3MHYA 3KNGA 3TA2A 1FWIC 2HZAA 4NYPA 1COKA 3CNQP 4NLUA 1YTYA 4USUA 2HWIA 3NVZA 4HHUA 4PUOA 3KOAA 1L7MA 3DUGA 1RDRA 1WHWA 2PMZD 3MMAA 3OTOJ 4DR3F 4CLWA 5G4HC 2ALZA 5KFLA 3QU2A 1X9WA 4X5VA 1HQUA 2CG8A 1T4GA 3A4TA 2GO8A 3UM9A 4DPOA 5D15A 4DFDA 3FMWA 1U6BA 4TY8B 1R43A 2VDIA 8ICLA 3FZ2A 2PMZF 2WOMA 4UATA 1IBLF 2ISPA 2V4JA 3BDEA 3AEVA 2Z7JA 3VCDA 1FKOA 3T3FA 2BANB 4OX6A 4DQRA 3M2RA 2FQQB 4OJHA 4K7QA 4O3OA 1QY7A 5AIAA 3JB9k 2HS3A 1YJWS 2BM1A 3K8WA 1I3OB 3KHLA 4ZA1A 2V68A 2PSZA 4PPDA 2A1AA 2RKIA 2HNDA 1O6XA 1RA0A 5DG9A 4NLPA 1XRTA 1KBUA 1KQKA 1FFWB 1H0HB 1UJ6A 3EPIA 4DV4F 2PLMA 4UOCA 1XO1A 1HQEB 2YY6A 1XR6A 5IIKA 1TTHB 2HOFA 3GTYX 1WORA 2VFTA 4K2JA 3DI6A 4OHZA 3R7SB 1HR0F 3BS5A 2DY1A 1S9EA 2A0FB 2Y9UA 3F2BA 5AXLA 2H51B 2P6RA 2XM3A 2KICA 1S5LU 2UXBF 2F40A 4HR2A 3MDAA 3T41A 3GCWP 3TQEA 4IKAA 3BH6B 1YRXA 2CPYA 3HSZA 4ICLA 1UHUA 3M7DA 1NCLA 2JXJA 2OXOA 2PA8D 4RT2A 3CCZA 3G4SS 2H5XA 4HTIA 3FEQA 3H90A 2KMDA 4RNNA 1JLAA 1SJRA 2DHGA 1BPZA 1N62A 4L74A 5M2PA 1FFVA 3HD2A 2D3ZA 4LF9F 1QTNB 1BE4A 2W9BB 2HDOA 2RQCA 2D3O1 1U1NA 3OFGA 4ZIVA 1YBQB 4MF2A 4KLEA 1Y5NB 2DTJA 2I0XA 3CNHA 2MEWA 1S7HA 3BS5B 4ES1A 3A1YG 1B43A 1MC8A 3B82A 2ZJQQ 2HYIB 1N5XA 1PZNA 2ZZTA 1U1RA 2HHHJ 3LPYA 2XHWA 4ED1A 1KN5A 2J7KA 3NG8A 3H7IA 3M6ZA 2C28A 2DNMA 2V4QA 2Q3PA 3CDWA 4WZQA 1Q78A 3HMJG 3P4UB 1Q46A 4C8NA 2RJZA 2K8GA 2DFLA 2VKQA 2EC0A 3MDWA 4O0IA 3RJMB 3UPQA 2BX6A 1E9YB 3BQTA 1H2UX 1XMOF 2ZBIA 4UY8T 2MLXA 2R2UA 8ICQA 1NKEA 2OLWA 3BZQA 3K2YA 4PG4A 2AYGA 5FJ4A 3LH2S 5IIMA 3EJMA 8ICAA 1WG5A 2DIVA 4J7CA 4F36A 3KLVA 1S5ZA 4D3GA 4P7TA 1ZETA 5B7WA 1O0PA 4YMMA 3OLAA 2GGPB 1PYSB 4LF8F 2PGCA 3ZTOA 3W5ZA 5J2NA 4AL6A 2ZH3A 3D6FB 5KL1B 3NGRA 2HHWA 1PVRA 5F8GA 1T9YA 1IQZA 1E6VA 3S8SA 2G06A 5IZHA 2CQGA 2UXBJ 2NR0A 1MMLA 1K8AT 4C4WA 3VGUA 2E9RX 1N36J 4R65A 1DFDA 4ELVA 1M7JA 2XVTA 4A47A 4IG3A 4RQ0A 3D6JA 2M0GB 5ALMA 4CZCA 4HHHA 2XLIA 5D0HA 1FNMA 5HQ8A 1YHQS 3HHLA 4X65F 2G9OA 4JI7J 4ED7A 2BE2B 1JKHB 1ZQAA 3I5CA 3MD1A 1JXEA 1ZXIA 2ZDPA 2GV1A 2B4OA 2YKQA 1N5YB 3QQCD 3PEHA 1X60A 4UW2A 3UD3P 3H8YA 5LJ3Y 2KN4A 4KQNA 3V81A 4J5OA 4WFYA 3MOZA 4Q43A 1RWOB 1VQ6S 2IHNA 4N8NA 3KMSA 2NRZA 3LWLA 2RDDA 5HJXA 3H4DA 1V38A 4DPTA 4B6JA 4LVSA 2JH1A 4PHAA 2HNZB 1LKYB 4LF2A 4HACB 3WKEA 2OCEA 8AT1B 2HHVA 2QGFB 2WVEA 1HBUB 5J0UA 5HAOA 5IV3A 5ETVA 5BR8F 1HYSB 4RR5A 2V63A 5K5MA 3UVJA 1UFLA 5F8HA 1MA7A 3PKYA 5F9LA 3W60A 2IC3B 1IV8A 4DL0C 1HNWF 1CI4A 1KHVA 3SZ2A 1WWVA 3OFFA 3BR8A 1N48A 3FC9A 3KKAC 3MM6B 2ZZMA 5B08A 1TKXA 3T79A 1ZOLA 4KMOB 4USAA 3MEGB 3Q8VA 2KVIA 2KOBA 1XNSA 5EN1A 4YB1P 4JYAJ 3PNIA 3QO9B 1HNZJ 1BNOA 2NO5A 1WELA 4OZ5A 5KOXA 4L72B 5CJ7A 3KJFB 4B17A 4F2RA 1UFKA 4M9GA 1KVIA 1NJIT 2YH1A 1U1PA 2Z2YB 4LF4J 2XHCA 3K75D 5AM4A 5AI4A 5DLGA 1NK6A 5C42B 2EC2A 3TOQA 4LRDA 5CEHA 3LSBA 4DR5J 2Q6CA 4TQSA 4YEAA 5KOWA 3QE9Y 5KT7A 1B70B 3Q2SC 4A46A 5ALZA 1AQ6A 1VISA 1XNRJ 4X65J 2YPYA 1VQLS 1RAHB 6FDRA 1V9OA 2R7RA 4L6V3 4NJ8A 1C1BB 1WI6A 3QU5A 4HDHA 2DPJA 3BV8A 3AA9A 4TU7A 3EMTA 3M1VA 2E5IA 1XNQJ 3IV8A 3QNWB 2IOHA 1JQGA 1QTMA 1AZSB 2G1HA 1NH7A 1H72C 5J29A 5IM0B 2V34A 4FBTA 4TURA 1JLCB 1NK8A 2Y8WA 3QRQA 1RCOB 3SCLE 4QZDA 4C9DA 1ZPWX 5AI0A 9ICSA 2KKVA 2UBPC 4KHPJ 5J2CA 2DNQA 2AEJA 1VJQA 1VCTA 3HJEA 4ZVUB 5L8RC 4OJ6A 1X9MA 2OPRA 5J2JA 2YKNA 3AXMA 2E5SA 4O4RA 2DYAA 4CGZA 4RPZA 4U7UK 3GZFA 2QZ8A 4UB6U 3DOMB 4GO7X 1UFWA 4YIWA 3GIIA 1RUSA 1SH2A 3KXDA 1V85A 2LQ8A 3VR1A 3KKAA 3WX8A 2V69A 1EIYB 1V6HA 4P0PB 3RR8A 2G5IB 2WBMA 3L95X 3TZYA 1HNXF 2HS4A 3QYYA 5HN0A 2ASJA 4QOTA 2B4PA 4OYMA 3LVWA 1N52B 1SKUB 1YBQA 2HURA 1R9XA 7ICEA 2MHEA 5J0WA 1SJ3P 3MGJA 2B3TB 4FKXA 3KMQA 1M0SA 2EZYA 1FRIA 4F93B 4PXCA 4KLQA 4CP5A 5ETKA 3WK7A 3G77A 5AJ3J 2R7OA 2XMAA 1X9XA 4M6WA 3T5KA 5I3PA 3TZZA 3J80Y 4UUXA 4O5CA 4KQZA 4CH1A 1RE1B 4B3ZA 3EVWA 3KKFA 1T3OA 1KN6A 5HHIA 2A1BA 2OPRB 3QUQA 3EZOA 1HUZA 3R9KA 2A1JB 4ED2A 4JI2J 5BOLA 1NSKL 4IFVA 1SC6A 2ZM6J 3H0PA 1IBMJ 3ZO7A 1V3RA 4OZ0A 1WHVA 3DLEA 2U1AA 4WGXA 3I28A 1A9NB 2F4FA 4G1IA 2IJFA 2BJ9A 2OM6A 2C3MA 1VC5A 4FN5A 1TL3B 4IFYA 5E3AA 2OPSA 3OTOF 4DR3J 2ZIUA 2QC3A 2XYHB 1K9MT 2CPZA 2XY5A 2BR0A 3VVUA 2R7XA 4IUFA 3TVYA 3MPGA 2HNDB 1F0XA 4MEYA 2HVEA 4DSKA 2LQBA 3AM9A 1SBRA 1K6WA 1IR2A 2ZE2B 1DRZA 3M2RB 2M7SA 4EYHB 2QN6B 4DU7A 5CCLA 3UN5A 5IIOA 2AX0A 3RJJA 2RF2A 1RT2A 2I1QA 3MDUA 4RQMA 1REVB 1FKPA 8ICRA 4PZNA 3DLKA 3WBZA 5IQ6A 4XDCA 4Q2LA 8ICPA 4EI2A 4B3MF 2A18A 4QZVB 1YBUA 4MK9A 4O3PA 3QEBZ 1F3VA 1X0FA 3NS1A 4J9OA 1OQ3A 1XBWA 4KLHA 5KG1A 3J7YI 3D1HA 2J6UA 4DFKA 1DOQA 4KX3A 4H4MA 2V94A 1HBNB 2HWHA 3KD3A 2RRDA 2QL9B 4ZPBA 3GGMA 3PKMA 9ICOA 2F2AB 4P72A 1B0VA 3TADC 1WF0A 1MWYA 9ICMA 1EJXC 4C2MA 1WI8A 1RGVA 2YKPA 5CD4A 4KYZA 2LXIA 1RTDA 4KR0B 4AYBC 1U9LA 2AQ0A 3PYFA 4CLSA 1T11A 1LW0B 3RAMA 1UT8A 5KFQA 2FYXA 2PMWA 3GDXA 1EETA 2DHAA 3ZD9A 3M9NB 2HHUA 1OQ6A 3HXMA 4CH7A 2LEPA 1HBUA 3MURP 3CJKB 4CTAA 4KT0C 5J2GA 4AQYJ 3QAEA 2Z0GA 4RQNA 4C3MA 1AW0A 5E7OB 4ECWA 4A4JA 4NXNJ 1TZ0A 2W9AA 2WK4A 1LFPA 5JJBA 2EZZA 5HHHA 2EAPA 1PYTA 4FPRA 3MEDA 8ICXA 2XLKA 2FLNA 4Y2MA 1RAAB 4TU8A 4B9VA 2EZXA 1BWVA 2B8PA 3ET6B 2QFJA 1S99A 2YWFA 2KTQA 1DQ8A 2ZH7A 1NK7A 2DT9A 5HMEA 1ZZFA 3UE2A 3PFOA 1VQYA 3PSFA 4DG1A 1XR5A 4Y2IA 3W66A 1IKXB 5AKJA 2N4CA 5HP1A 3FJ2A 3CB4A 2CJAA 2QARA 2MHNA 4WFNQ 4QW9A 1T9VA 3WK6A 2EG1A 2CXYA 3MTWA 5ALUA 5LOQA 4RQ1A 3TUIC 1ROFA 1RT5B 1RT7A 2N1RA 4ECUA 5JUMA 1J2MA 1RAIB 3C66A 2JRSA 2DCUB 2IFXA 4ACOA 1HPZB 1HL6A 2WSFC 2BZ2A 1XMOJ 2DR7A 1ZQEA 1R0AA 2R2SA 1CG2A 5IM0A 2E7WA 2ZTEA 2IIHA 8ATCB 2CQPA 2VPWB 5FP0A 3ZNJ1 5KT4A 4JV2A 2P2CB 3PJWA 2AF6A 1Q1KA 2VKRA 1SZHA 1S57A 1VQ7S 1SJQA 3T6BA 4YB7A 1RM6C 5KFMA 1TU0B 4UB9A 4OHWA 3OL7A 3ENAA 3QJLA 3MOJB 3I96A 4KKOB 2E7XA 5K14A 1RBAA 5AI6A 3ENVA 4YVZA 3PYDA 4TLRA 2GJ2A 1FX2A 2J6SA 3GU0A 3HFKA 3K5LA 1DBDA 2FD2A 2F4VJ 1I94J 3B78A 2NZCA 1BD6A 4X4QA 1FK9A 1WD6A 4CF5A 5KTQA 1IKXA 4LRAA 3RBXA 3N97B 3QSYB 5HL7Q 3S6EA 1C2PA 4CNQA 4HI1A 4MYTA 4X4UA 4JI4J 1RHUB 4IQXA 4I2EA 5KFRA 2WAQC 4C8OA 4J91A 3Q22A 1NBEB 1C0TB 3M7VA 4FF4A 3NASA 4FBUA 3CD5A 2AGQA 3R5CA 2HFUA 2Y0SC 3MR7A 2EI5A 3PO4A 4DWIA 5EE9A 3DN9A 2WONB 1F9EB 4OL8A 4NLRA 2BVZA 2BZFA 1UQVA 5L1JA 5CZXA 4NM2A 5KG6A 5K8OA 2JX2A 3H5YA 5DZ6A 4IFYB 3OJUA 4Z37A 1EJUC 1QE1B 3UWTA 3M6WA 1IR0A 1KW4A 2ATLA 2E66A 1XSPA 1ONXA 2DIUA 2DRDA 2HKEA 3ILIA 4K4SA 3I32A 5H9FK 1GKQA 1ZQLA 4DFPA 3A0HU 1YK9A 5K14B 3KDNA 3CE8A 5A8KA 1S76D 4CRXA 4O0NA 4IC9A 2JEFA 1RADB 1KEJA 4NLXA 2Y1IA 3SI8A 1YZ7A </