1IM4A

Crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
205
Chain Sequence
HHHHHIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DinB lesion bypass DNA polymerase catalytic fragment reveals a classic polymerase catalytic domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords DBH
total genus 63
structure length 205
sequence length 209
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1im4A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 1im4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1im4A01
2WHOA 5DB6A 3HWTA 3ITHB 4RT3A 4UAZA 3H8WA 4ZHRA 1EP4A 4R65A 3IGNA 3BQ0A 1UT5A 3PZPA 5F8JA 3RJIA 2FLPA 2D3UA 4KB7A 4I2DA 1JLQB 5D46A 1ZQPA 1HARA 1S0NA 4O3QA 3OSPA 2D7SA 3V7KA 8ICGA 4RQ1A 4YVZA 1SKRA 4ED8A 4QWCA 2UUTA 3DRPA 2W7OA 4URGA 4XPCA 2ZE2A 4QW8A 3CJ3A 1RAJA 2ZTDA 4PHEA 4UQGA 1SL1A 1TL3A 4E0DA 2D41A 4ZP7A 4OL8A 5EUHA 2VA2A 1IKYA 1COOA 1QAJA 1Z00B 1X2IA 4B9UA 4UB3A 4R8UB 2PFQA 3QLHA 3PX6A 1EP4B 4ZVHA 2HHTA 3HX0A 1HYSA 2AU0A 1QUVA 1BPXA 3PY8A 3IN5A 2ZJAA 3BQ2A 1C1BA 3TQ1A 1ZQLA 1TP7A 3CVKA 5J2PA 8ICPA 2RDJA 4LQ9A 2WTFA 3C5GA 4KLEA 5K14A 5J0SA 2YKNA 5J2NB 4Q0BA 1RDRA 4YMNA 4UB5A 2H5XA 3KLEB 3PW4A 1S1XB 3KHRA 4PHPA 1KDHA 9ICGA 5F8IA 1KLMB 3V72A 5KFYA 1IXRA 1XSPA 3KLIB 3PR5B 3V81A 3MEGA 3GIKA 4ECQA 2FMPA 4UBCA 3FQKA 4ED0A 2XCPA 4UAWA 1SH0A 1SKWA 1TL1A 3UXOA 2BPGA 3RB6A 4K4VA 4PQUA 2IC3A 4O4RA 1ZQHA 4NYZA 5F8GA 1GX6A 1LW2A 5IIJA 5CHGA 5J2AA 3OL8A 4KLSA 3M9NB 2AWZA 2B5JB 1YVFA 2XWYA 7ICTA 1BQMB 3EW9A 5DG7A 1RTHA 1WCLA 4IFYA 3GIJA 3OL6A 2CKWA 3JPRA 2FJXA 4I2JA 4PHAA 4WYLA 2HAIA 3JSMB 9ICAA 1L3TA 1HMVA 3HVTA 5C42A 3BSNA 3ORYA 1C0TB 3M8PA 1T05B 3V6DA 3KLEA 4RQ4A 2HHUA 4I2EA 3C21A 2XY5A 2ISPA 1LV5A 2RF2B 5J0QA 2BQRA 1C7YA 5KG2A 2R2TA 4NLPA 4DQRA 4I2CA 9ICEA 4DSIA 1A77A 4O3OA 3JPTA 1JLAB 3TAMA 3CDWA 4EO6A 4RQ7A 4TYBA 8ICNA 4KFBB 5KFBA 5DGAA 5DBBA 3PX4A 1HMVB 4NLSA 4BXOB 4IG3B 5J2PB 4YFKA 4I2FA 3ZD9A 3ISNC 2IMWP 2IAJA 7ICGA 3RBDA 5J1EA 2J6TA 1GX5A 5HLFA 4NZ0A 1ZQBA 4TYAA 4TY9A 5I3UA 8ICKA 2KZMA 4RUAA 4MFAA 4DQQA 1C2PA 4GLXA 3ZDBA 3OSNA 4RW4B 3RH6A 5J0RA 5DKWA 4O5EA 5DQHA 3RTVA 1RA6A 3QLHB 2BE2B 1N6QA 4MEYA 3EYZA 3CWJA 3KLHA 1SKSA 1ZQXA 4JK1A 5J2IA 1HPZB 2ZTCA 9ICXA 1J5OA 3UR0A 1T7PA 2YNIB 3GV8B 1ZQQA 3FQLA 2W9AA 4IRDA 5BPCA 4NXZA 1KHVA 3DLEB 2JEFA 9ICLA 4DL6A 3KOAA 2V0NA 4KO0B 2R8IA 3E2EA 3MEDA 1RXVA 4C8LA 1B22A 3AUOA 2FPKA 3OGUA 4QZAA 4IH5A 9ICFA 1TKTA 9ICTA 1Z00A 3CDUA 3B0XA 1HJPA 5CB1A 2F1IA 3RB0A 1BQNA 4YR2A 2ZUBA 5J2QB 1RXWA 3MTKA 4TXSA 4PPXA 1QSYA 1S9FA 5J0XA 2HHXA 4M9LA 4JV0A 1D8YA 3B0YA 2ATLA 1TV6B 1Z3EB 2I5JB 3LK9A 4QWDA 2HNYA 3QEAZ 4NRUA 5HNKA 4F3OA 4NLOA 2BCVA 4NCGB 2FVRA 2AJQA 4RW8A 4I2AA 3TARA 1ZQYA 2OPQB 2ALZA 2XCAA 2FPLA 5KFCA 4Q8FA 4RQ0A 5BOMA 5DB9A 4QZEA 4F4WA 4QPXA 1JLCA 1C0TA 3UQ2A 3GIMA 3EPGA 1QLNA 3T19A 4Q44A 3H7IA 4M9GA 4M95A 2F1HA 3C5FA 3N6NA 4Y2CA 1ZQOA 1DLOA 4ECUA 2HMIB 1N56A 2UVUA 3G6VA 2GIQA 1NKBA 3JPOA 4WFYA 4ELUA 3PR4A 3KLFB 1X9MA 3K4GA 4KAIA 3ISDA 2A1JB 1H38A 5F8MA 3LP2B 3NKYA 4IH6A 3OL7A 3ZD8A 4ECVA 3JPPA 4KLTA 3JSMA 1ZQVA 1QTMA 4U6PA 2JLEA 8ICWA 1AROP 4ED3A 3C1YA 3HP6A 1N5YA 3FDSA 3IHQB 7ICLA 1L3SA 3GILA 2W9CB 3LAMA 5FDLA 2VA3A 5KFVA 4H4OA 1V9PA 3MEEB 3LWMA 1D9FA 3MGIA 4DLEA 1NK5A 3N6MA 1JLBB 5J2EA 4DSLA 2HNZB 1REVB 2R8JA 1VRTA 2R2SA 3MEEA 2HHVA 2IJFA 4TLRA 5K14B 1TAQA 4RW9B 2BHNA 1KTQA 4I27A 4RQ8A 3H5SA 1D8LA 3EWAA 7ICPA 5L1IA 1TKXA 3DOKB 1NK9A 2KFNA 4QZGA 2VG7B 3LP1B 3I5CA 2HHWA 5J2GA 1RTDB 1S1UB 1N4LA 4ZPAA 2JC1A 8ICQA 4R5PB 4O44B 1NK6A 2JEGA 1CUKA 1TV9A 2D3ZA 1SL2A 1U9LA 1JLEB 2BPFA 3D28A 1S76D 4RPXA 4ID5B 2FMQA 2BANB 3DYAB 2FLLA 4QZHA 1HPZA 1BPEA 3H4BA 1FKOB 3BSAA 5IIIA 4K4UA 1LWCA 3UDLA 4MFBB 4U7CA 8ICVA 2FVQA 3GIIA 5KG4A 1S6QB 2XY6A 5KFRA 1RTIA 4F50A 2OPRA 1JLGA 1QAIA 2W8LA 1ZJNA 1TL1B 2YNFB 2WB4A 3DMJB 3KK1B 1JIHA 4FBTA 4IRKA 4NRTA 5F8LA 4WZMA 4F8RA 1SV5A 1T03B 3KNAA 3DLKA 5D3GA 2HVIA 3LAKA 1RT1A 4QW9A 5KFJA 2OPSA 5KG7A 4C8NA 3C6TB 1KRPA 1S9EB 1TV6A 2WOMA 3DLGA 4GXJA 1S6PB 3PHEA 2B6AB 1Z4UA 4EYIB 5JXSA 1X9SA 1FKPA 4Q0BB 2VG6A 1LW0A 1S1WB 1JX4A 3V6DB 3SYZA 2GWSA 4PQUB 3EZ5A 3PJWA 4YCXA 2R8KA 5C24B 2UVVA 2XO7A 4URQU 1XWLA 2OPSB 4FBUA 3ZDCA 4KLGA 2BCRA 4DOAA 1SL0A 4KKOB 5CYQB 5DB8A 2B6AA 3Q8PB 4LZDA 4BDPA 1U49A 5J0YA 4KE5A 2NRZA 4IQXA 4EZ6A 7ICVA 2AX1A 7ICIA 4NLGA 1KEJA 4Z6FA 2W9BB 1XS9D 4IKAA 4M47A 3SZ2A 4F93B 1SZPA 4IFVA 4WXWA 2YNIA 4IG3A 4JWMA 4F4KA 4DSFA 2PFNA 5KFKA 4RQ3A 2DPJA 2HWIA 5KFMA 2W9BA 2NRXA 1RT1B 3C1ZA 2ASJA 3DM2A 1LWCB 3BSOA 1JLEA 3N6LA 9ICVA 1K1QA 2B21A 1D9DA 2RKIB 5J2FA 1U47A 3KLGB 4J9MA 3RAXA 4EO8A 4MFFA 4DL2A 2IHNA 2BRKA 3FFIB 5J2HA 1TKXB 4DLGA 8ICTA 3TVKA 3K75D 3KHGA 5KFQA 4I2BA 2WONB 4X2BA 9ICSA 4DOBA 3KK3A 3KLGA 4Z6DA 2FLNA 2ZTEA 4DSEA 4J9LA 5IILA 9ICMA 5CYQA 3T5LA 8ICHA 4QZIA 3HVAA 5DB7A 3V6HA 2IJNA 4LSLA 3FFIA 3LP0A 3KMSA 3OLAA 2ZE2B 1REVA 4BXOA 1HNIB 1ZYQA 3V7LA 3E01B 1B43A 3LP1A 4HKQA 4ELTA 4IR9A 4BWMA 3ICLA 1HUOA 1RTDA 5F8HA 5I42A 3HVWA 2P66A 4J9SA 5IIOA 1J5OB 4YMOA 3Q8MA 3OL9A 1IKXB 4XRHA 4EBCA 3QIDA 3MR5A 3OHAA 4K50A 5IIMA 4XQ8A 4F5PA 9ICBA 3V6KA 4RW6A 3C6UB 2PFPA 9ICJA 7ICHA 4ZVFA 5DGBA 1C1BB 1L3VA 4WXOA 4TUQA 1ZQAA 4LSNB 1NK8A 3JYTA 4B3OA 4H4MB 1RA7A 9ICNA 2IC3B 4C8MA 1ZQTA 4NM2A 4QZBA 2C2EA 2KZ3A 8ICOA 5CJ7A 1BQNB 4NLNA 4KLHA 5CWRA 4PUOB 4DOCA 4NLVA 1IM4A 3NBPB 4J9OA 4RNFA 3UXPA 4NLTA 3RJFA 4GC6A 4DQIA 4M0AA 3M8SA 3N4MB 2HMIA 5HMMA 4LSNA 3JYTB 3DI6A 4ZVGA 4IDKA 5KTQA 1LW0B 4ECWA 1S1WA 4I2QB 5KT6A 2C2DA 1QSSA 4IQTA 3Q8RB 5J2NA 8ICMA 1ZQCA 3KK3B 9ICWA 4RNHA 1QSLA 5JUMA 2V9WA 1U09A 1DTTA 4I29A 4K4GA 1C0UB 1TVAA 3QO9B 4M94A 2E9TA 4H4OB 4DFJA 4RNMA 5HP1B 4G1QA 2ASDA 4XA5A 4DL5A 2Y1IA 4YN4A 4RW8B 4ZP9A 4HYKA 4DL4A 4LZGA 1KLNA 4QZ9A 1EETA 2RKIA 1XR5A 3MR3A 8ICBA 4O5CA 3IS9B 2E9RX 1MU2A 3KMQA 3V6JA 4YR3A 3CJ2A 4XO0A 4ICLA 4KMUA 5CR0A 4J9PA 1NK4A 4KFBA 3PVXA 2QV6A 3GV7B 3QE9Y 1OS5A 5CP2A 4IQUA 1UWBA 4RNNA 3RB4A 2C2RA 1NHVA 5J0OA 1WCNA 3KHLA 3BQ1A 3AU2A 3D5MA 2C28A 4ICLB 3V7JA 4O5KA 4I2QA 4YXJA 4RZRA 3DM2B 4F91B 3MFIA 2JEJA 2JZBA 1NNDA 3HKWA 4MF2A 5DG9A 4F5OA 4FS2A 1ZQKA 4ELVA 1TKDA 3RB3A 1VRTB 5KFOA 3BGRA 4RPYA 4YQWA 3HT3A 3CDEA 1CSJA 3KTQA 1S10A 4WFZA 1CEZA 1ZTTA 4J9QA 3DLGB 4UB1A 1NK0A 2FPMA 4IH7A 3RJJA 3Q8LA 4DS5A 1TL3B 4EZ9A 1RT3B 2F8EX 4TQSA 2R8GA 4ED7A 2HNZA 3CJ5A 1JN3A 1KFSA 1L5UA 2I1RA 4RW4A 1SH2A 2IM0A 1TKTB 5J0UA 3M8QB 7ICNA 2GIRA 1JLGB 7ICRA 5DLGA 3G6XA 4R0EA 5EWGA 3ITHA 4KLOA 4I2PB 1HUZA 5KT3A 1L3UA 4F4ZA 4Q43A 3KLHB 4NLQA 1LW2B 3UPFA 4MFBA 1JLAA 3JPQA 5KT2A 3DDKA 1KSPA 4MK8A 3C6UA 4RNOA 4KBIA 5DQIA 3NBPA 2PFOA 2WOMB 2OPQA 1Y88A 1RT6A 7ICMA 2XY7A 4GXIA 1T8EA 5BOLA 3MGHA 3LWLA 3UQSA 1ZQZA 5DBCA 4XPEA 3ZDAA 3VQSA 3GV5B 1ZJMA 3H5YA 2UVWA 1RT6B 1UA0A 3H8SA 3MR2A 3M9MB 2PXIA 4DQSA 4NY8A 2CJQA 1RTHB 3H59A 7ICSA 3EPIA 4C8OA 1XR7A 4BWJA 3T5HA 1BPYA 4EYHB 9ICQA 4FO6A 4M9HA 4K4HA 1S49A 4ZPCA 1XU4A 3M8RA 3TAPA 1TQLA 4NLZA 1XSNA 5KFAA 2JEIA 1I6JA 4MKBA 2IHMA 4LSLB 4NLKA 4I2PA 4NLDA 2XGPA 4DG1A 5KFLA 1S1XA 2HNDA 3UPQA 5J2JA 2HHQA 3ETLA 1HYSB 5C42B 4QZFA 4KLIA 3MEGB 4F4YA 3C2LA 1K1SA 2YKMA 3IM1A 2FJWA 2FVCA 3BR9A 1JLQA 4KHMA 4R63A 4MFCA 5I42B 5FDLB 4MEXA 4R66A 3SV4A 3MDCA 1N5YB 4KN4A 3TAMB 4DG1B 2MUTB 4KKOA 4B9NA 3KLVA 1HQUB 2FVSA 2BCUA 3TANA 1RT5B 2HNDB 1FK9A 7ICQA 3LP0B 2V4RA 4IG0A 1RT2B 3M9OB 4K4YA 4J9NA 5J0PA 8ICJA 4ECSA 5KT4A 4WYWA 4O3NA 5KT5A 2W8KA 4RW7B 3QGGA 1T05A 4UAYA 4KHRA 4ECYA 4ZHRB 1RZTA 3OJSA 4Y3CA 4ECTA 5DG8A 5KG3A 3DRRB 1SUQB 5HROB 5TZVA 2IBKA 1EXNA 1RT2A 2ZKUA 3CJ4A 3H40A 3GYNA 4UB4A 3I5AA 1XSLA 2IM3A 4RPZA 1DOQA 1W25A 1MQ3A 4DFMA 4KLMA 4KLQA 4QWAA 1HNVA 3CJ0A 3CIZA 1NJZA 1S97A 8ICFA 4O3RA 4NLXA 2YNFA 5HBMB 2IAJB 4M2YA 4ZMMA 5J2MB 1XC9A 1RTIB 1LWEB 3V4IA 1ZQGA 4QZ8A 1S4FA 3BGRB 4G1QB 2YKNB 2B5JA 3HHKA 4R64A 4B9LA 4DQPA 2YNHA 3N97B 4IFYB 4DWIA 4O3SA 5CA7A 4G3IA 2NRVA 2BDPA 9ICPA 2ZUDA 3OHBA 4DSJA 4RU9A 3E01A 3EZUA 4PGQA 2BGWA 3HVTB 2ZJ8A 5F9NA 5KFPA 5CYMB 1JLFB 3DYAA 2VG6B 2YKMB 1NJWA 3PO5A 5C24A 1RTJA 3RRGA 4ZH4A 4DL7A 5HMLA 4IRCA 3Q8KA 5L1KA 3RR8A 4UBBA 4NLRA 3I0RA 4YXMA 3IRXB 2IM2A 3QIPA 4Z6EA 4KITB 4DF4A 1NKEA 8ICYA 3SFUA 4LVSA 1RTJB 3Q8SB 8ICCA 4IG0B 3KHHA 3DMJA 5DQGA 4KLUA 4WE1B 7ICUA 3I0RB 3HW8A 2BR0A 2JC0A 2HW3A 4YD1A 3IG1A 3I5BA 4F4XA 2J6SA 3HPOA 2MUTA 4MIAA 1KLMA 5KFIA 2YNHB 2BPCA 5EWFA 2FMSA 1HQUA 4TY8B 1X9WA 2NRTA 1EETB 1ZQIA 3H5XA 1S48A 4PH5A 3RH5A 1KFDA 3V81B 4K4IA 5C25A 3BDPA 2FVPA 2UVRA 4EEYA 4ZPBA 4TUPA 1S6QA 3LP2A 1JLCB 1UWBB 2EC0A 4J9RA 2AQ0A 2I1QA 4CCHA 1S9GA 4DFPA 4M6WA 1C1CB 4F2SA 3ISND 3BQTA 3Q8QB 4MIBA 2W9CA 5C25B 1RPLA 4RQ5A 5DLFA 3IG1B 3QGHA 3ISCA 2Y1JA 3THVA 1NOMA 2F1JA 1DTTB 4KV8A 2DPIA 4NM1A 2ISOA 3IS9A 2XC9A 3LANA 3OLBA 3MBYA 4P4PA 3FYHA 3KLFA 1IKYB 2OPPB 2P6RA 1C1CA 3MEDB 2BKEA 2LYHA 3DOLA 5KFTA 2IM1A 4K4WA 3I0SA 3RJGA 1HQEA 1TVRA 1RT4A 5HP1A 2VG5B 4O3PA 3H5UA 4NLUA 4RW9A 4YG2A 4QWEA 4GC7A 1RT3A 4F5QA 1S77D 3DOKA 3OJUA 4M9JA 3RJKA 4R5PA 4KV8B 2R2RA 7ICKA 4EBEA 4GXKA 1JXLA 1IKVB 2HWHA 3SV3A 8ICRA 4KN7A 4QWBA 4RT2A 1JMSA 1RT5A 7ICEA 3H8JA 4IR1A 1R0AA 4XUSA 3PV8A 5T14A 3PMNA 1TVRB 1IKVA 2OH2A 1RYSA 3QZ7A 4DF8A 4TQRA 4O4GB 1T03A 4DL3A 5KFHA 3BJYA 1S0MA 3H98A 3NAHA 3T3FA 7ICFA 4PHDA 1HNVB 4MK7A 4K4SA 2B43A 3E51A 4RW6B 1ZQUA 2XI2A 2KFZA 2HVHA 3KK1A 3H4DA 3IGVA 1S1TA 5HLFB 2NRWA 2KTQA 2C22A 3PMLA 2AQ4A 4NLWA 4WFXA 5KFDA 1ZQNA 3NL0A 1MC8A 1MMLA 4O44A 3NMAA 5KG0A 5J0TA 2KZZA 3PW7A 2J6UA 4KTQA 2VANA 5HBMA 1LWEA 3V4IB 2QE5A 4K4ZA 3RRHA 2BE2A 1TFRA 1N6QB 1XO1A 5HHIA 5J2MA 2BCSA 1IKXA 2ASLA 2Q0ZX 4F92B 1TK8A 4M6WB 1FKPB 3RAQA 1MSWD 5J2KA 1JKHB 3RJHA 1VRUA 4ID5A 2RF2A 2WONA 4PUOA 4WE1A 4DSKA 4ECXA 4F2RA 5KFFA 2YNGB 4WZQA 4ECRA 3QZ8A 3DLEA 1RYRA 1IKWA 2ZJ5A 2M9NA 5L1JA 3DI6B 4F5RA 2KN7A 1S9GB 9ICOA 4RQ6A 8ICIA 3RH4A 4LQ3A 4RW7A 1BVSA 1BPBA 3DRSB 2UUWA 3TFSA 5J2QA 4QZCA 3PW5A 9ICRA 1S1TB 4P4MA 1PZNA 3UQ0A 2WCXA 4I2HA 1VRUB 3LALA 3QIPB 8ICSA 1UT8A 4ZP6A 8ICAA 1A76A 2XGQA 3PX0A 9ICIA 1TK0A 3QGIA 1SV5B 2BQUA 8ICLA 1WNEA 3G6YA 3SFGA 1S1VB 1S0OA 2FJVA 3ZDEA 4PGXA 1KFTA 1KHWA 3PJXA 4KLDA 3DRSA 5IIKA 1ZQRA 4K4XA 2OPRB 3MF5A 4DO9A 4TURA 4P2HA 3AU6A 2ZUCA 1JKHA 4IQWA 1BQMA 4QZDA 1NK7A 5EOZA 3MECB 4YMEA 4TN2A 3QO9A 4TUSA 4ED6A 3BSCA 4IDKB 1S1VA 3DLKB 1N48A 2PI5A 4ZVEA 1FKOA 4KSEB 2AGOA 4B9MA 3M8PB 1SUQA 4Q8EA 5HROA 4KO0A 4DEZA 1ZQEA 5KFZA 4KLFA 3T5KA 5F8NA 1S9EA 4KLJA 2BQ3A 2ZD1A 4EBDA 4O9MA 2WRMA 4URSA 3GDXA 2ILZA 4PWDB 1RT4B 1T4GA 3KK2B 1NJXA 3DOLB 2R2UA 3KLIA 5DBAA 2OPPA 8ICUA 4KLLA 2HHSA 3RJEA 4P4OA 1ZTWA 3QYYA 4JV1A 2HNYB 5J0WA 5L9XA 4Q45A 3FSIA 2ZD1B 1QE1A 1RT7A 1HQEB 1JLBA 4RQ2A 3KJVB 5D3GB 4YR0A 2BANA 1T94A 3NTUA 4NLYA 3QEBZ 1BPZA 4RUCA 3KK2A 3H2LA 4YD2A 4Y34A 4ZP8A 3BREA 1U48A 1RT7B 4I2GA 3T5JA 4ZPDA 5DDYA 4K4TA 3TFRA 1ZQWA 3T1AA 3RR7A 4MK9A 8ICEA 2MAXA 1ZQDA 3DRRA 3GFKB 1ZQJA 5J2BA 3RBEA 3M8QA 1S6PA 3JPSA 4R8UA 5L1LA 5EDWA 5KG6A 4Y2AA 4X5VA 2V4QA 8ICXA 2RDIA 4FS1A 2YNGA 2AGPA 4J9KA 2IA6A 1D0EA 3PNCA 5EWEA 5KFUA 1NJYA 4PWDA 3ISBA 3TAQA 4IQVA 1HNIA 4B9SA 4JUZA 5KFGA 4MKAA 2GC8A 2JZBB 9ICHA 1DGSA 2I9GA 4ECZA 3IRXA 3GQCA 9ICCA 3NAIA 2R8HA 4UB2A 5D49A 4JV2A 3DRPB 5F9LA 4BGDA 4MH8A 4ED1A 3MECA 1NHUA 5J2CA 3MABA 4NCGA 1JLFA 2BCQA 5KFSA 3SI8A 4YP3A 8ICZA 1ZETA 1MQ2A 4DS4A 3UXNA 4JWNA 1U4BA 4IOBA 3FRZA 1IKWB 5IINA 2AX0A 3C6TA 4ED2A 4I2IA 1LB2B 5HP4A 1BPDA 3NGDA 4MF8A 3JPNA 3KJVA 1MU2B 1ZQFA 4H54A 5KFWA 4M04A 4IFVB 1T3NA 1TAUA 2I5JA 2VG7A 1U45A 1LWFA 1SH3A 1ZQMA 2W7PA 1XR6A 4C8KA 2O5DA 1TK5A 3ZDDA 4B9VA 4PGYA 2WK4A 1DTQA 1DLOB 3LDAA 2P6UA 4YMMA 1S0VA 5C5JA 3PW2A 5D4BA 4F5NA 3C2MA 1BGXT 5CYMA 2XI3A 4I28A 3C23A 1TKZA 7ICJA 9ICKA 2PI4A 4Z6CA 2BRLA 2AGQA 5KG1A 3PW0A 1C0UA 1LWFB 2VG5A 2DFLA 2E9ZA 1NKCA 1ZQSA 5J2DA 4O4GA 3I0SB 3TI0A 3PO4A 4I7FA 3C2KA 5J1EB 5KFNA 7ICOA 1S1UA 5HHHA 5DDMA 4B3OB 1R0AB 1UA1A 3MR6A 9ICUA 1TKZB 4B9TA 1D1UA 5KG5A 1FK9B 2A1JA 3CO9A 3MFHA 1JXEA 2VA8A 2W9MA 4DFKA 2OWOA 4I7FB 5I3UB 4O0IA 3MDAA 2ILYA 4M9NA 4H4MA 1QE1B 5KFEA 5J29A 1DTQB 3G86A 4TY8A 5KT7A 5KFXA
chains in the Genus database with same CATH superfamily
1AXQA 3N7PD 4RT3A 4G1PA 4R65A 3K2YA 5IOLA 5H9FJ 3ALRA 2EZYA 3OSPA 3V7KA 4K5RA 4ED8A 2QLJB 2R7TA 2KNJA 3PSFA 3LPEA 4P73A 4X84A 2HQDA 2ZTDA 4LR7A 3J81U 1TL3A 4E0DA 3C14A 3I6PA 1HWKA 4OL8A 3ETRA 1IKYA 3P49B 1QAJA 1Z00B 1X2IA 5CYJA 2V68A 3LSCA 5FD1A 2PFQA 5K20B 3QLHA 2Q3PA 1X60A 5ALOA 2CRXA 2KXFA 2KL8A 5AM4A 2PA8D 3PY8A 1GO3F 3BQ2A 2WF8A 5E7OB 1TP7A 2FTRA 2CNNB 1X7VA 4ANCA 5K14A 5C7PA 4YMNA 5IWAJ 3TJ9A 3H90A 2KN4A 3KHRA 1FWHC 2CPJA 2HOIA 5KFYA 1XSPA 3M2VA 5EGYA 4CNSA 2NZ4A 3V81A 2Y3YA 4OZ1A 3Q8YA 4ECQA 1T3OA 2FMPA 3FQKA 3A13A 1FNMA 3VGVA 2XCPA 5BJRA 2E66A 2R7VA 4UAWA 2W04A 4PXEA 2GV1A 3UXOA 1O6XA 1NB7A 4PQUA 3LH2S 4O4RA 4U95A 3G71S 3MM9A 4A48A 3W9IA 3D2WA 1GX6A 2NSBA 4I67A 1VBYA 5CHGA 5J2AA 1DQAA 3M9NB 2XWYA 1RTHA 1WCLA 4OYIA 2N3OA 3ZZ0A 4HACB 1Y0HA 1KN6A 2CWXA 4PHAA 3MM5A 9ICAA 3W62A 1HMVA 3AQEA 1C0TB 4FPRA 3M8PA 1T05B 2HVDA 4GFJA 2RVJA 3KLEA 3GMGA 3BBBA 4RQ4A 2RU3A 1WG4A 1B0TA 2ROEA 2XMMA 3NCQA 1U0SA 2RF2B 2BQRA 1C7YA 2Z2LA 4LVOP 4DSIA 1JLAB 5J1NA 1FX2A 1TUVA 1BUXA 4P52A 4QU6A 3R7BB 2GOKA 1HMVB 1BE4A 1XMQF 5ALGA 2W25A 3CNHA 4KGKA 5DDPC 2IMWP 2IAJA 7ICGA 2DJWA 1A5KC 4DR2F 5J1EA 4ZVSB 1I94F 1SGGA 4DXLA 3PIOQ 5E41A 4YB5A 5FLXY 2F3JA 4KH0B 4GLXA 2ZBPA 2YKPA 3C16B 2OSQA 4DHVA 3OSNA 3RH6A 5DKWA 1GKRA 2D3DA 1PCAA 1FWPA 4Y2QA 1WEZA 1XMOF 1ZQXA 1HPZB 2ZTCA 2CPZA 2B9YA 9ICXA 2E1AA 3G87A 2NO4A 1IM6A 3JQJA 1J5OA 3ILLA 3UR0A 2QG9B 1EJRC 3VV2B 3GV8B 2RH3A 4IRDA 2E8NA 3N01A 2BOAA 2HGLA 5DDQC 1LXJA 1RB0A 1YRTA 3DLEB 3Q22A 2JEFA 3MDUA 2P9EA 1K44A 2LFVA 3VCDA 4Y2YA 3B82A 4KO0B 4HTIA 2K4IA 3E2EA 4Y00A 1RXVA 1RCXB 3AUOA 1MMNA 2FPKA 4IOAQ 4JI8J 4LRFA 4A8WA 3CDUA 3GGMA 4N8OA 3RB0A 4YR2A 4AP9A 5A0YA 2ZWPA 4TXSA 2DD8S 3MEKA 1S9FA 5J0XA 2VJ4A 2HHXA 4BJQA 3LW5C 4DR5J 1B7FA 4NYPA 4LJXA 4YEAA 3G82B 3SDEA 4IQMA 4JI3F 4NCGB 4C8YA 3PFOA 2V67A 2RRDA 4RDWA 1E6VA 1IBLJ 4PG8A 3OFGA 4OJLA 2OPQB 1Y9OA 2XCAA 2FPLA 4Z7CA 4Q8FA 3A0BU 1LK7A 5H9EJ 2ZZMA 4QPXA 1M7JA 1RHRB 2GIFA 3NP5A 3EPGA 5ETMA 5H1SV 4Q44A 3H7IA 2VUNA 3W66A 3OXFA 2MQPA 1SXEA 3C5FA 1FDBA 3N6NA 1EKRA 2AJ1A 1DLOA 4DPOA 4ECUA 4MMOA 2HMIB 5MLCV 1SPBP 2ZWOA 2GIQA 4C97A 5IM0B 1HI8A 2QC3A 1FTCA 4WFYA 4AQLA 3MMAA 2CADA 4QU7A 2DEJA 2FHKA 1EQ0A 3K4GA 3QU5A 3UNGC 5F8MA 3LP2B 3NKYA 2GWNA 4IH6A 4OZ2A 3JPPA 1DRGA 3JSMA 1N63A 5J1PA 3L3FX 1QTMA 4NXMF 2PFFB 4U6PA 4K2JA 4FF3A 2CPIA 8ICWA 3DXSX 2X3GA 4ED3A 2WAQD 3C1YA 3HP6A 1N54B 2VA3A 3MEEB 4B02A 2L9NA 3MGIA 4USWA 4C98A 1RAGB 4BJHA 2CQ4A 3AOBA 3J7YU 4A8KA 1NZPA 5H9FK 1Q79A 1IWGA 4HT7A 1PYOB 2XLIA 3MURP 2KVIA 2IJFA 1M5KC 1YBQB 3RRKA 4RW9B 3FC9A 2BOPA 4OHZA 2CQ2A 4GVBB 7ICPA 2Z56B 2C2ZB 4I68A 4ZLJA 1RAAB 4DDFA 3W2WA 1RBOB 5D4LA 4U9RA 3CIMA 1BMQB 5DS7A 5J2GA 3Q89A 1RTDB 5G4DA 4R5PB 1NK6A 4NI2A 3SQGB 2HBRB 4IYQA 1CUKA 3PYGA 3K57A 1JLEB 2B6GA 4PYDA 2XYGB 1SQFA 2FMQA 2BANB 2FLLA 5ALZA 2ZC4A 4F0RA 3SDEB 5IIIA 2AD9A 3UDLA 4C6AA 2CJAA 2MSTA 3GU0A 5H9EK 2KT2A 1RTIA 2Z8QA 2RDDA 4F50A 1V4YA 3BGUA 3D3BJ 1JLGA 3MZIA 1ZJNA 3R5BA 2K7KA 3K17A 4LBHA 3DC2A 4RQNA 5KAKA 2FHOB 2H1YA 2Y8WA 4HL9A 3DLKA 1WG5A 3E3XA 3LAKA 1RT1A 1R31A 2DY9A 4XIUA 3KDNA 1RA5A 2KU7A 3C6TB 3CCJS 1KRPA 3LQVA 2XYPB 4FZNA 4S0MA 2VIXA 4EYIB 1X9SA 1GKQA 5FLXU 2J0QD 5BR8F 4OX7A 4QPTA 2GWSA 4X65J 5U47A 3GFZA 1O51A 4URQU 4ZITA 3KUEA 4LFBF 4FBUA 3UMBA 2H51B 3ZDCA 2CNLB 2E1EA 4DOAA 1SL0A 3I9V9 1FEHA 2WF5A 1SC1B 4RR5A 4ANEA 2B6AA 2J0XA 4C4SA 3WK7A 4BDPA 5FP0A 1U49A 2J7WA 1NDPA 1Q7YT 4EZ6A 7ICVA 2GQQA 3AJ2A 4Z6FA 1XS9D 1SV0A 2AQVA 1K1DA 1XRFA 5F3TA 4ZCKA 4DR1J 4OYAA 4JWMA 1M6YA 4DI6A 3VAHA 2HWIA 5AXKA 2W9BA 1JQGA 1MA7A 1T0TV 4CM2A 1JLEA 3OR2A 9ICVA 1N2XA 2KD1A 4R88A 5J2FA 4EENA 4YB1P 1U47A 2A1AA 1R89A 4FVMA 2IHNA 3FFIB 3NVVA 4C3MA 2IYGA 3KHGA 5KFQA 2ZIXB 3EMTA 1U1LA 3KK3A 1RDFA 4Z6DA 2FLNA 1QVGR 2D74B 5HJXA 1GEHA 3T5LA 1V5VA 5F3XB 2IOFA 2QB0A 4RL1A 3V6HA 4OYZA 4PWUA 3AXKA 3KMSA 2K4PA 1SJ1A 3ZTQA 2G07A 2FB0A 2YWFA 1ZYQA 3GSIA 1K47A 3K7RA 2ASYA 1DK2A 4ZN3A 4CDGA 1HA1A 1ED1A 3IXQA 4IR9A 5GTHU 3CJQA 5I42A 2E5LF 3IGHX 3HF5A 3T6BA 2ATCB 2RAQA 3AOAA 2AJ4A 4DPTA 1SIJA 3OL9A 1IKXB 2D3O1 4XRHA 3OHAA 2JFDA 1RJJA 4B3TJ 2VFVA 1QQ5A 5KOWA 2K89A 1XO0A 4UUXA 1EJXC 2B4UA 3WC2A 3V6KA 4J9VA 4MKYA 2MXYA 4ZVFA 1MN7A 5CD4A 5DGBA 2Z7JA 2A10A 1L3VA 2GHVC 2DH9A 4LSNB 2L48A 4B3OA 2EG1A 1LQ9A 2M52A 1VGYA 5AXLA 2XMVA 3AN1A 3HFZB 3HSZA 4C8MA 4DPYA 4EGLA 4K8RA 2G5HB 4LFCJ 3ZZTA 1RK8A 2KFYA 1V38A 4AL7A 2B9XA 3HHDA 2ZXHA 1FWDC 3DLJA 4WK3A 2V8GA 4PUOB 4DOCA 4NLVA 5HJYA 1JMTA 2HQFA 3EE3A 3HZGA 3R7SB 4LSNA 3NCRA 4TU7A 3LTOA 4BC9A 2MDAA 4ZVGA 4WHBA 3AD9C 4FXVA 1S1WA 4ECWA 4I2QB 1HWUA 2C2DA 5J2NA 4I4BA 3KKAC 1QSLA 1U09A 1DTTA 3D1OA 4K4GA 3M8YA 3QO9B 2E9TA 2O01C 4DFJA 2PAJA 4RNMA 2RUSA 2ASDA 5AE1A 4IC9A 1W2IA 1N34F 3K1ZA 2NXCA 2Q1LA 4ZP9A 4DL4A 2GVDB 3OVAA 1XR5A 3FRYA 2PA3A 3EVWA 1X42A 2GA7A 3PRVA 2Q79A 4YHHF 4P71A 3V6JA 1HHTP 2HIYA 4DUTA 4XO0A 2KJ8A 1PO9A 4ICLA 4KMUA 2L5YA 5ALUA 4DV5J 1N62A 4KFBA 4DX5A 1ZAVA 1U2RA 5BR8J 1A6LA 1OS5A 1UWBA 4Y0FA 2XLJA 4LF2A 1VQSA 1S7HA 2PSZA 3BQ1A 1HWIA 3AU2A 3V7JA 3L4PA 3TZYA 2XTJP 5ALJA 2G0IA 1VFJA 2CA9A 2AF6A 2JZBA 4P2MA 5ADZA 2UU9F 1Q0NA 4FS2A 3OQ2A 1B70B 1PVQA 1TKDA 3IWNC 4Y2RA 5KFOA 2WF7A 4RUBA 3HT3A 3W61A 2B51A 1G3OA 4WFZA 3DLGB 1NK0A 2FPMA 4FXWA 4AUKA 3RJJA 4WWSA 5B0GA 5M2UA 4P72A 4AE5A 2KO1A 2ZXIA 3EGJA 1R6YA 4TQSA 2HNZA 1EQMA 2DUYA 2CXEA 5IC6B 1D09B 5AXMA 3IR7B 4PKDB 2I1RA 4RW4A 4NYOA 3CF5Q 2CUYA 3G82A 2GIRA 1PJ7A 2FHMA 3SD7A 1YBAA 2HBMA 3G6XA 1M1KT 4KLOA 4I2PB 2JLGA 5EX3A 2HAFA 1S79A 1L3UA 1IUJA 3H42A 3QATA 4F4ZA 4NLQA 4QR1A 1LW2B 3DDHA 5KT2A 1S5ZA 3C6UA 4RNOA 3Q8UA 2IVFB 1FX4A 1YT3A 1UZHA 2J7KA 3NBPA 3KJNB 2WOMB 1Y88A 2HHHJ 7ICMA 1EJTC 4KPCA 2FDNA 1T8EA 2EK1A 5CQGA 2JJ4D 4ZPWR 4JYAJ 3MGHA 3H25A 3J7Z5 3W64A 5DBCA 2XEXA 2WB1F 4L3KA 4PZOA 1ZJMA 8RUCA 3AH6A 2UXBF 3M9MB 2BJ9A 3H59A 2CJQA 1XR7A 1VQYA 3T5HA 1BPYA 1KBUA 1XNRF 5ETOA 5IT9Y 5D4NA 2CJXB 3M8RA 1R0BG 2J9EA 1VQ9S 4UBPC 2OEJA 2MQLA 1WYGA 4F7VA 4EMDA 2QTWA 2E8OA 2XGPA 3GJSB 3D0HE 2MZSA 3MEGB 1R7IA 2R7XA 2KM8C 1URRA 1K1SA 2MQOA 3M30A 4OJGA 2ZH4A 3BR9A 1JLQA 2ZJRQ 1SJQA 2XS2A 2ZOGA 5FDLB 1GMVA 3U1MA 4LFCF 2G0JA 4I6WA 2E8PA 5ALRA 3M7VA 1N5YB 4DR4F 1IN0A 3Q0AA 3J80U 4DV6J 1WC1A 2MUTB 3R7NB 3O0FA 2QT3A 4N77A 3B8HA 2FVSA 3TANA 4Q2LA 1RISA 3DUGA 2K60A 1XRTA 1CG2A 3AD8C 7ICQA 1RT2B 2GVDA 3M9OB 1K6WA 4K4YA 4J9NA 1OQ3A 5J0PA 3TEGA 4WYWA 5AIAA 5ALWA 1TZ0A 4RW7B 3QGGA 2ODGA 1RZTA 5AKKA 2DK2A 4WJBA 3OBIA 1SUQB 1EXNA 2ZKUA 3I5AA 1WWUA 2MQMA 2IM3A 4WP8A 4JI7F 3MR7A 1W25A 2F3NA 4DFMA 3W3SA 4OX9F 5D77A 1W2BR 3UVJB 2EW9A 2YNFA 1DJ0A 1ROFA 2DBYA 2RNEA 3MM8B 1RJRA 1RK6A 3V4IA 2KJVA 2WAQC 2AV5A 4HT5A 1Q81T 2YKNB 4R7WA 2KXNB 3PSIA 1FWKA 2M8DB 4DQPA 2MSNA 2YNHA 2DB1A 2BYCA 2G3FA 2NRVA 3FJ2A 1U1RA 5ALNA 2ZBQA 1ZAWA 1U2FA 3HVTB 2ZJ8A 1T95A 3T8LA 1OW5A 1K73T 5B5EU 4Y2IA 2YKMB 3BE7A 3IRUA 2CDRB 4X4UA 1NSKL 3PTWA 1V6HA 3RN6A 4DL7A 5B08A 3GWCA 1MWYA 1POKA 2YY6A 1R8PA 3U27A 3IRXB 1K0TA 2IM2A 3QIPA 3LGHA 4Z6EA 2VOOA 1NKEA 3SFUA 4KQNA 4DX8H 4ZJQA 1G2EA 3Q8SB 2RQ5A 4QR0A 1YJNS 4P0QA 5A8KB 5DQGA 2QA2A 3I0RB 3HW8A 4J03A 5CEHA 2VV5A 2JC0A 1SC3B 2VPZB 5HVFA 2MHEA 3QUCA 2I38A 3GJTB 2IRXA 2MUTA 5LMUF 1UJ5A 1HHQA 1KLMA 4OZLA 5KFIA 5BXIA 3PCOB 4TY8B 1AUDA 4NXNJ 2R7RA 3MTWA 2FVPA 4CE6A 3QGKC 4TUPA 3CB4A 3GP9A 1UWBB 2EC0A 2AQ0A 2JL9A 1S9GA 3TZZA 2LKYA 2V2ZA 4GKKF 4F2SA 1VHFA 1T9WA 4DR5F 3Q8QB 3G8SA 4MIBA 3DLLQ 4I64A 3CJKB 4N7TA 2W9CA 5C25B 5D6GA 3ISCA 2Y1JA 3FBCA 2C3YA 3GPAA 3THVA 1U02A 3K5MA 1DTTB 4JI3J 4KV8A 2LQ5A 1FXDA 2ISOA 1WF2A 2XC9A 4YY3F 2R7SA 3W5XA 2X1BA 3PJ9A 3L3CA 1WWHA 3KLFA 4EWTA 2P6RA 1C1CA 3MEDB 2BKEA 2AEJA 3GLJA 4U96A 2Y1LB 1X4EA 1X4GA 1Q78A 5CCLA 3MMCA 4O3PA 3N9UC 4GC7A 1X40A 1YHQS 1RT3A 3CJSA 1S77D 2X51A 5LJ3Y 4DR2J 2XNRA 3G96A 4R5PA 2HBLA 1HR0F 1XNQJ 3GJRB 2C42A 4EBEA 3TUJC 3BKUA 2QYGA 2V4JA 2HWHA 4KN7A 2E5HA 5ALEA 3W9JA 1YI2S 2FQQB 1RHJB 1JMSA 4C5YA 3L7OA 4G9BA 3RJMB 4UY85 3PMNA 4I1TA 1IKVA 2YQEA 4L76A 4YB7A 2ZC3A 4UY8T 1RWUA 3H2UB 4UW2A 5AKJA 1ZOTA 4M5IA 1X4DA 3CRXA 1HNVB 4MK7A 4K4SA 2B43A 1DZ5A 4NWIA 2DHHA 2R7UA 2I5HA 2HVHA 1U1PA 1DGJA 1HL6A 2E8MA 4ZJOA 1FWEC 2FGCA 2H48B 2NRWA 2KTQA 2I2YA 2IYIA 1TE2A 2AQ4A 5KFDA 2ZITA 1KOOA 4KHPJ 1ZQNA 3NL0A 1MC8A 1V51A 1MMLA 2HEKA 1P1LA 4RPFA 1IIPA 3NMAA 5KG0A 1SXDA 4G7EB 3PW7A 2VANA 1HIYA 3V4IB 3RRHA 4H9MA 5HHIA 1IKXA 2ASLA 4FF1A 3OT9A 2KG1A 3RAQA 2ZZTA 3CSKA 4JI6J 5DRKA 4DSKA 4C7ZA 2QLXA 4OX9J 1RJQA 1JJ4A 4AYBC 1IR0A 2GAHC 3IG8A 2K3IA 3R5CA 2M9NA 2PMZD 3LPYA 3D0GE 4FF2A 3DI6B 1FFGB 3ZI4A 3S6EA 1JALA 1BVSA 2G06A 1F3FA 3VAMA 4GO5X 1X4FA 9ICRA 1ZM9A 2VICA 3UQ0A 3MUMP 4I2HA 1VRUB 3QIPB 4ZP6A 2V34A 2X7IA 9ICIA 1TK0A 2QX0A 3QGIA 3F53A 3MC1A 2BQUA 1WNEA 3G6YA 2FJBB 1Q95G 3OVSA 1X0FA 3SFGA 1XNSA 1S0OA 2ZBIA 2OTLS 2OD4A 1KHWA 3PJXA 2ZJQQ 1I5OB 3LF0A 4K4XA 1U0HB 4GBDA 3MPYA 1NPPA 4P2HA 2LDIA 1HBOA 4ZVPB 2ZUCA 5E33A 1JKHA 1X66A 4F67A 5A6TC 3N0VA 4EX6A 2VZ9A 1HW8A 3FEQA 4GRSA 3F41A 3EX7B 2ZVSA 4YMEA 4TUSA 4ED6A 3DU6A 4ATNA 5A6PA 4Z42C 2H5IB 2BA9A 2HFZA 4ZLNA 3NWRA 2AGOA 4B9MA 3M8PB 4OIXA 1Y7PA 2YWGA 3EDQB 1WG8A 4KO0A 3THPA 4AXJA 4P0PB 2JZ5A 4CGZA 2EAMA 5ALLA 3D2NA 1H0HB 4Z37A 2DVIA 4HHJA 1WEYA 4CRXA 3QAUA 5E3CA 2ILZA 2M4MA 1FCAA 1T4GA 1NJXA 2B8QA 3EM1A 2LHTA 2GLEA 4Y6IA 3S1TA 3KLIA 1T9UA 2E7VA 3LUYA 4P4OA 3QYYA 1F5AA 4JV1A 2HNYB 2K1RB 3SQOP 2OP5A 1NNLA 2Z2YB 5ETPA 3ZO7A 1T9YA 3CC4S 3KK2A 3WIUA 1URJA 4YD2A 1UVJA 4ZP8A 3VHQA 1X6JA 1RT7B 3QFHA 1G6BA 5B0AA 3NRBA 3T1AA 3RR7A 1Y00A 3DRRA 1WD6A 1NPRA 5L46A 4R8UA 5EDWA 5KG6A 4Y2AA 4X5VA 2KYXA 5B09A 2HLUA 5F0UA 2PDAA 4UT4A 2AGPA 1D0EA 3PNCA 1VDHA 1KRCC 1J2MA 4JUZA 5GAHU 5B0FA 3J81j 3TP2A 2BABA 1IQTA 5FSEC 4NX9A 4MJKA 5JRTA 2I9GA 3O7UA 3A12A 1X0PA 2UUBJ 4UB2A 5D49A 3R8YA 3CW2C 4ZS6A 5JTIA 2M2BA 3DRPB 3OOQA 3HM9A 4BGDA 3HHLD 1L3KA 3WZ0A 4QJFB 2HQ3A 2DF4B 4NCGA 3I55S 2DGQA 2A18A 4GKJJ 1MQ2A 1CRXA 2YMQA 3F2BA 4ZVOB 4YOEA 3UXNA 2N3LA 1YJVA 1CJTB 3DRXA 4NLBA 3FRZA 2AX0A 1HHSA 1RAKA 4MF8A 3JPNA 2P53A 1MU2B 4KMOB 5AXNA 4WJ3B 3FMBA 1SH3A 3UDVA 4E98A 2LU1A 3QU4A 1ZQMA 2EXUA 3AJDA 1XR6A 3D66A 1TK5A 5C2GA 4PGYA 1R8HA 5JMNA 4DCOB 3M4XA 1YITS 2AYGA 4F5NA 2QA1A 4QIVA 4PR6A 2MLYA 3C23A 5GAHI 3B6BA 2A6OA 2KVCA 2M7SA 2PI4A 4RDVA 4Z6CA 4DUYF 4RJVA 3PW0A 2W2PP 4EU0A 1CQNA 1RWOB 2ACYA 1SV4A 2VIHA 3TADA 3C2KA 4PYAA 5KFNA 1S1UA 2NUUG 5DDMA 1R0AB 1LK5A 1TKZB 1D1UA 2UUCF 4ED5A 2EKYA 1JXEA 3QFWA 1S4EA 2W9MA 1VDVA 4P74A 2BKPA 1XN9A 3QSYB 2VJ5A 2HBYB 4RX6A 4KPYA 5KFEA 3D6MB 4E2FB 1DTQB 4CLKA 5KT7A 4R0JA 5KFXA 3MDFA 5DB6A 5K8NA 4WIIA 4UAZA 1GTHA 1EP4A 2R18A 2HVEA 1OY8A 1F2HA 3PZPA 2FLPA 2JH1A 2D3UA 4I2DA 1JLQB 1HARA 4O3QA 4OLOA 2D7SA 8ICGA 1SKRA 4IO1A 1HNXJ 2EAPA 1POJA 4L73A 4XPCA 2ZE2A 2F4FA 1RAJA 2EVZA 2IVMA 4WKRA 2WAQF 2L9DA 3L09A 1SL1A 4ZP7A 3D54A 3FGVA 1FRKA 2CIMA 1X8DA 4CLWA 2WVFA 3VZHA 3ZZZA 4R8UB 1M5SA 1GQEA 2QN6B 3SSQA 3PX6A 1WORA 2ACMA 2Y8YA 3OTCA 2WHEA 1WDTA 2HSEB 3IN5A 3WKBA 2DNMA 3TQ1A 2IBOA 2F8LA 5J2PA 2GMJA 3C29A 2BJ1A 5J0SA 2YKNA 4Q0BA 1RDRA 5GAGI 3PW4A 3HHEA 1KDHA 9ICGA 1RAHB 1ZOLA 1R27B 1VK8A 3OV7A 1V97A 1UW4A 4UATA 2HI0A 3K0JA 1JXVA 1OWXA 3DEEA 2M88A 3EWGA 2DXEA 4ED0A 2FHJA 2GS8A 1SH0A 5B66U 3AM9A 1KR4A 2FJEB 4K4VA 4LR8A 1ZQHA 5A6WA 3OL8A 3D0IE 3KJQB 2B5JB 1YVFA 4X64J 4HH0A 1Y5IB 4IFYA 3JPRA 4FYWB 2VL1A 2KM8B 2H54B 2HZCA 5KL8B 4OZNA 3RF9A 3HVTA 3WQPA 2IHR1 1RLCL 3ORYA 2Y9HA 1Y5LB 1D9AA 3WKDA 3UW1A 3T1HF 3V6DA 4WBFA 1YK9A 1VLBA 3MDWA 3C14B 4WF9Q 5ETSA 4B17A 3MCOA 1UKUA 2R2TA 3GTYX 3G9CA 2EI5A 5JVHQ 9ICEA 1A77A 2DR9A 1DQ8A 1RQLA 3TEHB 4FNIA 2ZEJA 4Q5VA 1SJRA 1IV8A 2B0CA 4RQ7A 2P5VA 3CMAS 4KFBB 5DBBA 4QNLA 4BXOB 4LF8J 4TU8A 4YFKA 3ZD9A 2AKWB 2DGXA 3PEHA 2HPUA 1T9VA 2DKZA 4YDXA 2VPXB 5GADU 3DFEA 4UAUA 1F60B 4RUAA 5ETKA 3PRBA 4DV6F 2ZIXA 3ZDBA 3IBCB 3FCWA 1FFVA 4O5EA 1FERA 2DH7A 1RA6A 4U7UK 2AXTU 1ZPWX 1MN9A 3HJEA 3CWJA 3KLHA 3C19A 1EZZB 5AI9A 5J2IA 4L3NA 3AQFA 1T7PA 2M8HA 2F9JA 5AKEA 4Y2VA 2YNIB 2GJIA 1ZQQA 3FQLA 2W9AA 3NY0A 3HMJG 1V3RA 2ZBRA 3OTBA 3MXHP 1Q4RA 1JJCB 9ICLA 4ZIVA 4USIA 3KOAA 1PVPA 2V0NA 1APSA 1C4AA 2DISA 3PYFA 4RU2A 1KC8T 3VGTA 4QYZK 2RE1A 1HJPA 2F1IA 1UJ4A 2F1FA 1Q86T 4PPXA 1RAIB 2CXYA 4JI7J 4JV0A 3K58A 4EP8C 1REGX 1UVLA 3AT1B 1Z3EB 2I5JB 1Q8KA 1F3VA 1NAQA 4NRUA 2LEBA 5AKZA 1S99A 3TRGA 3QRRA 4NLOA 4EEKA 2FVRA 2HFSA 3UFCX 1SQGA 3OFEA 1RYUA 1YQHA 5D4PA 3TARA 3W2VB 2ZOMA 1RJPA 1VBKA 2ZVIA 4CLPA 5IXUA 5DB9A 1NMEB 2HS4A 1B0PA 3UQ2A 2C2NA 3CDBA 3BZKA 2L3MA 3BH7B 3T19A 4EUVA 2F1HA 2F40A 2YWEA 3BPSP 5IV3A 2HYIB 4M5HA 1OUQA 1N56A 2UVUA 4NL9C 4M5DA 4CNUA 4K2XA 2XLKA 4K0KJ 3QWUA 4ELUA 4C11B 2ADCA 2RQ4A 1X9MA 5IQQA 5IT4A 2A1JB 3PKMA 4W90B 2V8PA 3CCLS 3PHTA 3OL7A 3N7SC 1V5IB 2V94A 4GY7A 4KH1B 4KIRA 3ETMA 1GXTA 4LF9F 2JLEA 4ENOA 4NASA 1UW9A 5ALFA 1N5YA 7ICLA 2X1FA 3GILA 1SCJB 2GJ2A 2XBPA 5FDLA 2CPXA 5KFVA 2PD1A 4H4OA 1V9PA 5E0OA 1A5NC 1BQXA 2KG5A 4DLEA 1NSAA 1JLBB 3SEOA 5J2EA 2W03A 2HNZB 2W54A 2OFGX 4UB8U 1NBEB 1VRTA 1NUEA 3OTOJ 1YSJA 3D6TB 1TAQA 5AK3A 1KTQA 3UWTA 2N7CA 5ALQA 5ETQA 4OI4A 1D8LA 3EWAA 5IQ6A 3H2VE 3DOKB 1MNEA 4ZVUB 5H2FU 4U67Q 4QZGA 2VG7B 2ALYB 1S59A 4O23A 1X5PA 4NZ6A 4L75A 1RADB 2DWQA 3T1YF 1N4LA 4ZPAA 1LWXA 4O44B 1WHVA 1S72S 2YX4A 2JEGA 1O03A 4LR9A 1Q82T 1NXIA 2C1EB 2MJUA 5GAGU 3EVMA 5AICA 3DYAB 3MAAB 4QZHA 5K8OA 1FWJC 3PACA 1UPMB 1AZSA 2Y0BB 4K4UA 1LWCA 1TFYA 4CTAA 2K7JA 1WC3A 3G8TA 4AC7C 5KFRA 4OQJA 2KICA 5E3RA 2D3OR 2OPRA 3ZNJ1 2W8LA 2OELA 3CJKA 5EE3A 3KKAA 1TL1B 3KK1B 1JIHA 4FBTA 1RWMB 1XBWA 1JB0C 4WZMA 1FJCA 3D68A 1SV5A 2QZ8A 3EDRB 2WVBA 1T03B 3KNAA 1EB0A 5ALMA 2QA4S 2HVIA 4W98A 3RBZA 2OPSA 1N88A 2KRRA 3D9BA 4C8NA 1S9EB 2HOFA 2H4WB 2WOMA 2RHQB 3DLGA 1Y3JA 4GXJA 2B6AB 5ALKA 2KHCA 1PBAA 2JRSA 4KJIA 1S1WB 1WC6A 1UVNA 3V6DB 3SYZA 5A2QY 1VQLS 3PJWA 1VQ4S 2UVVA 3ZZYA 2XO7A 1JWWA 2DRDA 4OLPA 2G5IB 1YZ6A 2OEHA 4ZOHC 4C4WA 1YLXA 2Z58B 5DB8A 3D67A 4JI6F 2Q09A 4KE5A 5LXYA 3FSYA 4NLGA 2W9BB 4X4SA 2B8PA 5TISU 4WXWA 1WC0A 3W63A 3MOZA 4EK2A 1RGVA 4W92B 4RQ3A 2OCEA 4OHVA 1Q5YA 5KFMA 1RT1B 4OYBA 1NZAA 3U1NA 1LOUA 5DDOC 3OD2A 1VQKS 1ZH5A 3JSBA 4CRJA 1K1QA 2B21A 5IC4B 1RG6A 4J9MA 3RAXA 2DITA 3HVRA 3C15B 4MIWA 1YDLA 4PJ0U 2HWTA 1U8SA 3BS5A 5CA5A 4JI5F 2IMRA 2DKOB 3NLCA 3K75D 3A3PB 2Y0SD 3JSYA 2AEFA 4TKTA 3WX8A 1NZ8A 3N4WA 3KLGA 5IILA 1HKAA 1WHWA 1U1KA 4C80A 8ICHA 4QZIA 3E8OA 2HFNA 3HVAA 2PIIA 3KDOA 2GZOA 2GHPA 5CZXA 1EJ7L 4ZCIA 3OLAA 2UXCF 1REVA 4BXOA 1FNXH 3CD0A 3V7LA 3IDWA 3AL0B 3E01B 3VR1A 4CQ1A 1B43A 2FZGB 3P5TL 2CN1A 4ACOA 4ES3A 1NCLA 2HG4A 3GFHA 2AJ0A 1HUOA 2HKEA 2KB2A 1RTDA 2R4FA 4J9SA 4ERDA 3FK4A 4UZCA 1J5OB 4YMOA 4PAAA 3QJPA 1J2VA 4CNQA 5JJBA 3QIDA 2QMXA 3R0DA 2ZIWB 1SJ4P 1H98A 4NA2A 4F04B 1N36J 1UVKA 3MKVA 2YPZA 4F3MA 3MI7X 1RUSA 4UB9A 2YVSA 1SIZA 2LQJA 5HAOA 2N4DA 2JH3A 2HQIA 3DLBA 1FRIA 1WOOA 2OJ3A 2R7OA 1SJ3P 1RAEB 2KV2A 4DU8A 2IVYA 4HDHA 3BF4A 2W2MP 1UFLA 2LPEA 2OMLA 3FUYA 8ICOA 1A5MC 2XB2D 3BN4A 3MWBA 3VAJA 4YUDA 1FKAF 1UFKA 4AL6A 2YB4A 5CAAA 2JHDA 3WK8A 1IM4A 2CWKA 1N8RT 2UUAJ 3UXPA 2MTLA 2RSQA 2YPYA 4M0AA 3FBFA 2HMIA 4YFUA 2P6SA 1DQ9A 2KSOA 3DI6A 3MM7B 1HEKA 3DHWC 3G77A 2F44A 4IUFA 2CG8A 2OI2A 3ISZA 1ZQCA 2O66A 9ICWA 5JUMA 1C0UB 5HVGA 1TVAA 4M94A 2C3UA 4EI2A 4BUGA 3BR8A 3HJVA 2QSFA 2FHJD 4XA5A 3K59A 1GXLA 4HYKA 1NFGA 3GYGA 2N4CA 3VCBA 4QZ9A 2MKSA 4O3MA 8ICBA 3WIVA 1RAOA 3KMQA 2OIHA 2G4BA 3OTEA 3SR6A 1ZD3A 4AT1B 3OFHA 2PN6A 3PVXA 2QV6A 2I6WA 3GV7B 4RBUA 2JHEA 4IQUA 1FDDA 3NNCA 3PSPA 4RNNA 2H5EA 3WBZA 3RZAA 2LVWA 1N60A 1KD1T 1HBMA 5DM7Q 2FD2A 2LMIA 3NG8A 2HLTA 4I2QA 3BKFA 4YXJA 1YJUA 1TELA 4LIRA 4XK8C 3IMQJ 3QPIA 3H0PA 2DGUA 4FYDA 4JI4J 1KVIA 2CQIA 4MF2A 2B7BB 5DG9A 4F5OA 4CEUC 3FZ2A 2K8AA 3MMCB 3PYEA 3MUTP 2B3TB 4RPYA 1KP6A 2M0NA 2NXEA 3F0NA 1CSJA 1NPKA 4LBPA 2J8AA 1S10A 4D3GA 1KKHA 4CQBA 1M5VC 1ECWA 4J9QA 4DV1J 2J76E 1R8AA 3CT9A 3Q8LA 2VDHA 1TFWA 1TL3B 4EZ9A 2BMBA 1ULRA 2F8EX 4AQYF 5IWAF 5AKLA 3HD1A 2NPIA 3CJ5A 1L5UA 2V6AA 1J2NA 2G0AA 5C2CA 1A5OC 2FC9A 2DGWA 1JLGB 2KT3A 5DLGA 4DX7A 1JUDA 2MA1A 1GNKA 3UN2A 4WFBQ 1HUZA 5AK4A 4Q43A 3KLHB 2V9KA 3L7UA 4ZIWA 2HBZB 1KSPA 2H3EB 3NS5A 3SEIA 2J0SD 2VPWB 2A3VA 3R97A 2VC1A 3NASA 4KGVB 2K8GA 1RT6A 2XY7A 5BOLA 2UXBJ 3UQSA 1VK3A 3ZDAA 3Q2TC 3GV5B 3H5YA 1VOMA 3I76A 3PG9A 3T9NA 3MR2A 2W4DA 1KWMA 3EICA 3O5TB 4BWJA 1H73A 5ETLA 3UN3A 1RWKB 3OPKA 4EYHB 9ICQA 2DYAA 2F8KA 1S6OA 4F72A 1ZZFA 1UAWA 1S49A 4ZPCA 1XU4A 3TAPA 1TQLA 2Y9TA 1XSNA 3DCAA 2JEIA 4OV1A 3C2PA 4MKBA 4LSLB 1CULB 5THWA 2DGZA 5KFLA 3NCPA 1S1XA 3UPQA 5J2JA 5HMEA 1PYTA 3D6HB 1HYSB 1F9FA 3JQKA 2JNJA 3IM1A 4X66F 4M5KA 3G4SS 1LFWA 2KG0A 1PILA 4R63A 3SCIE 1JROA 5DDRC 3MDCA 1X4AA 4DUYJ 3T9ZA 4KN4A 4KKOA 2OEKA 3N7RC 2RS8A 4B9NA 1HQUB 3ICXA 4DOZA 4EX7A 3TADC 2XNQA 1RT5B 2CYYA 2HNDB 2WBMA 1PJ6A 1FJEB 2HDOA 3CUNA 1NEEA 2QARA 4PXCA 1MWQA 5K4LA 3TWZA 4ECSA 5KT4A 3IRWP 2VFRA 5AKYA 5AI0A 2RQCA 2DHSA 2W8KA 5B7WA 1UZDA 1H2VZ 2A3JA 1T05A 4DV7F 5HANA 2JVOA 3L95X 4ZHRB 5AI8A 3OJSA 2ZH1A 5DG8A 1F5BA 5HROB 2XZTB 2YKQA 2G0CA 2G2YA 2PMHA 4DR7J 4UB4A 5AKGA 3BN7A 4LJMA 2CDQA 1SIWB 4KLMA 1PAEX 3R6GB 2QRRA 3CD5A 1K5OA 4J9UE 2LI6A 4NMXA 4KLQA 1HNVA 2JSXA 3CJ0A 4MTPA 4KY3A 1KNZA 4O3RA 3GZ7A 2F8HA 1Y4ZB 1TL5A 1R6VA 2IAJB 1ZQ1C 2P2CB 1I3OB 4ZMMA 2CVIA 1RTIB 1RKIA 1LWEB 4QZ8A 4MYTA 4G1QB 3HHKA 2ICSA 5A0YB 3N97B 1HLWA 5AM3A 4O3SA 3DOMA 1W7WA 3BGLA 4OI3A 3OHBA 2YMLA 2QLFB 4RU9A 3D4JA 3EZUA 4PGQA 2HQCA 1X4BA 2WF9A 2BGWA 5KFPA 5CYMB 3DYAA 2IOHA 4M5DB 3WKCA 3I31A 2VC0A 3P5BP 2F2AB 4DV4F 1S12A 5A76A 3PO5A 3RRGA 4NPOA 4IRCA 1F0MA 1VC5A 1ZAXA 2G1DA 4P75A 1R8CA 2LA4A 3G8QA 2OHFA 2MB0B 1P6TA 4KITB 3K1RB 8ICYA 8ICCA 3AJ1A 4ID8A 4IG0B 1E9ZB 3CCVS 2HZVA 1R43A 7ICUA 2BR0A 2E5IA 2HW3A 3IG1A 3TJ8A 4C4TA 1ZM3A 2V2QA 2LMRA 4MIAA 4Y2UA 4NA1A 3AA9A 2YNHB 2BPCA 1QCKA 2FMSA 1HQUA 2NRTA 2VDIA 1EETB 3H5XA 1KFDA 5C25A 2WW4A 2W55A 1S6QA 3LP2A 4J9RA 2I1QA 5E3QA 2MRLA 3VALA 1C1CB 2HS0A 2M5YA 4G1IA 2EAOA 1FFUA 2OGJA 1FI4A 1RPLA 1CS4B 3IG1B 2MSSA 1NOMA 1VQ8S 4WU3A 2DPIA 1JNZB 4NM1A 3P6YC 4OX8A 3LANA 4LF7F 2H3QA 3OLBA 3MBYA 2QIFA 2OPPB 5G5GA 3DOLA 3I0SA 3RJGA 2BE7D 2ZIUA 2DL0A 1HR0J 5L8RC 4ZCLA 2VG5B 4NLUA 2MZQA 4QWEA 1DK3A 3K8WA 4HLBA 1WSVA 2VPYB 2FZCB 2QLWA 3RJKA 4WGXA 2R2RA 4WU2A 2LM1A 3MGJA 4GXKA 3HHLC 1XIQA 1IKVB 1BXNA 2MZRA 3CCSS 3SV3A 8ICRA 3WK4A 4RWWA 4CIOA 3AXMA 1DXSA 3K8VA 7ICEA 3H8JA 3PV8A 2ZIUB 3FZBA 2OH2A 5GADI 2R42A 1RWVB 1BC6A 4DL3A 1AFJA 3N28A 4WFAQ 2XZWA 4WP3A 2HBKA 4M51A 2NS1B 3NAHA 3T3FA 4QJVA 4G6VB 4UOCA 1IBMF 2JVRA 3E51A 3AQOA 3PEJA 3GR1A 2KFZA 2AMCB 2Z30B 3SMVA 2DXDA 4C7YA 1FJGF 1BNOA 1S1TA 1PK1B 5HLFB 2W2QP 4RKUC 1DBDA 2L9WA 4CLTA 5ALIA 2V50A 4O44A 1K9MT 3R1LA 1FA0A 2FY8A 1CBKA 5HBMA 1NHKL 2Z2ZA 4F3QA 3CCWA 3HLUA 4N56A 1XO1A 4AXIA 4KHPF 3C15A 5F3ZA 4M6WB 3SQIA 3HJFA 4UUWA 3OW2R 5KOXA 5J2KA 1ITPA 2JWNA 1ZD5A 3DDNA 3R1HA 4PUOA 3U1LA 4F2RA 2MLZA 5KFFA 3H7HB 2R7QA 1WF0A 1YKWA 1WOPA 2FVMA 4WZQA 3DXBA 2JMGA 1RYRA 1IKWA 3CCQS 3HX9A 5L1JA 2CJBA 4F5RA 2CQPA 1GMUA 2IMOA 1CJUA 1OPZA 2AJFE 5HVHA 2HURA 3TFSA 5J2QA 3PW5A 1YBTA 5HMDA 1U0HA 2XGQA 1U1MA 4NL9A 1ZM2A 3M32B 5JVGQ 2MEWA 3JSRA 4USJC 3H0LB 1KQSR 2HSZA 4QZVB 3HI9A 2ZIWA 5IIKA 1GK8A 1PKUA 3QJLA 1ZQRA 4NLCA 3E0LA 3MF5A 4DO9A 4TURA 1P9QC 4ZPVR 2OKQA 2LXUA 4BBYA 2P9GA 1YJWS 2EWHA 1N33J 4QZDA 3BS9A 5EOZA 3MECB 4TN2A 2DTJA 3MM6A 4B3RJ 3DLKB 1N48A 4CDIA 2RRAA 4DX6A 1FKOA 1EX8A 3DKDA 5HROA 4Q8EA 2HRYA 2VOPA 1H6KX 4KLFA 5IT0A 5F8NA 3FEXB 3GCWP 4KLJA 3U02A 4EBDA 3Q83A 3CULA 2HVZA 4V1XA 4ED4A 1RT4B 2H3ZA 2YTUA 1B3TA 2DGVA 2JX2A 1Q1KA 4ZLPA 4DR6F 8ICUA 1I1GA 5L9XA 4Q45A 1RT7A 1HQEB 1DURA 3CJTA 4XDDA 2BANA 4BKNA 1T94A 1A9NB 3QEBZ 4KX5A 3SAHA 3GE9A 3T5JA 5DDYA 1Q3VA 4P7VA 1PC5A 4NZ7A 3TFRA 4PG4A 4FF4A 2FUG9 2OSRA 3FKBA 4CH0S 2FJDB 4X4TA 2BM1A 3TO8A 3NS6A 1S6PA 2K4HA 2FVKA 3VGUA 4CNZA 5J8YC 4CO5A 4M8LA 3IG5A 2HIQA 4JI5J 1AQ6A 5KFUA 1NJYA 1VQMS 4PRFA 2G2OA 4IQVA 3ULHA 2JR5A 2GC8A 3T6JA 2JZBB 9ICHA 1K0VA 1DGSA 3P3DA 2J5AA 4LIWA 1HNWF 9ICCA 4WPAA 5GAEU 4JV2A 2YWHA 5F9LA 1N34J 4MH8A 2OYYA 4QIWC 3OUYB 1J97A 4PG7A 1TL7A 2UUBF 1PVRA 2GO7A 2BCQA 2GGPB 4V1Ak 2FI1A 3VGSA 5E3AA 3SI8A 4YP3A 2PT0A 3T81A 2XMJA 4C11A 4DV5F 1FJ7A 4IOBA 2G13A 4K59A 1IKWB 4P10A 3C6TA 4ED2A 5T7LA 1S8OA 1M5HA 3VTIA 5HP4A 4C0BA 5L39A 1BPDA 2RQMA 3HO1A 1SB6A 4H54A 3WDOA 3OUYA 3KZXA 5KFWA 3ENAA 2ZH5A 1T3NA 4E8UA 1TAUA 4DPXA 1NB2A 3VWSA 3NWGA 4C8KA 4FKYA 3O2IA 1PAUB 2DEIA 1U2CA 1ZA1B 2KIWA 1S0VA 1WSRA 1FVSA 1T11A 1S6UA 1BGXT 4ILRA 2XI3A 3LYSA 2RB7A 2K8CB 9ICKA 4UOGA 2AGQA 2BRLA 5KG1A 1MN8A 2IA0A 3TW0A 3UO0A 3Q8VA 7ICOA 3SFWA 1E6YA 5HHHA 4B3OB 3KWMA 9ICUA 4B9TA 1FK9B 1I51B 1NDLA 3O3LA 4C7QA 3CO9A 1BY9A 2VA8A 2QS8A 3UR3C 4DV3F 4DFKA 2ZUGA 5AKIA 1QD1A 4O0IA 4M9NA 4H4MA 3G86A 3RU0A 3IV8A 4UAVA 3KKFA 2F63A 4M5LA 4ZHRA 4A46A 2GX8A 3V2UC 3IGNA 4DPWA 3BQ0A 1UT5A 2AEMA 3W5ZA 3RJIA 2AP6A 4KB7A 4Q2MA 2HQGA 3PIPQ 5D46A 1RZMA 2PO4A 4C48A 2VBZA 3MAAA 1EF2A 3UMGA 4AL5A 3GG1A 4QWCA 2UUTA 2W7OA 4URGA 1IBLF 4QW8A 3CJ3A 4FZLA 1SV0C 2D41A 1VRQC 4OCZA 2CAJA 1COOA 4B9UA 4UB3A 3C46A 5HMXA 2X1GA 4ZVHA 2GO8A 2RD5C 3HX0A 1HYSA 3SCLE 1B4SA 2AU0A 2Q4TA 3NGTA 1S5LU 1QUVA 3CC2S 2BKOA 3AHPA 2COLA 2ZJAA 2ZUAA 2Z0GA 2WSCC 5D8HB 4RZBA 1C1BA 1ZQLA 4DV1F 2CNOB 3P96A 2DR8A 2XYHB 3M32A 4LQ9A 2WTFA 3C5GA 4KLEA 5J2NB 4UB5A 1FO4A 1ZRMA 5J8YA 1GXUA 1S1XB 5K9FA 2OHDA 4PHPA 5F8IA 1KLMB 2GQCA 3V72A 1IXRA 3DV9A 4DL0C 3FBBA 3KLIB 1Z4OA 4LSZB 1Y5NB 3MEGA 3L4BC 4UBCA 2K1RA 1NI3A 2KEYA 1QM9A 1UEVA 4J91A 3KBBA 2RP5A 1FRMA 1SKWA 4A4JA 4IO9Q 3A3OB 2LBOA 2OM6A 2BPGA 2LEPA 2XSJB 4N5SA 2BM0A 4NYZA 1VQOS 4WK1A 5E79U 3QX7A 2VHLA 4PWWA 1LW2A 3OR1B 4YDDB 5IIJA 2DNZA 2CQ0A 2C2KB 2AWZA 4I6AA 2W01A 1BQMB 3EW9A 5LJ5Y 2QL7B 3A8EA 2YXLA 4NXNF 2CPFA 2OAUA 2A2CA 1WDDA 4I2JA 4WYLA 3N79A 4ZJLA 3WK6A 1L3TA 1Q16B 3BSNA 1XEZA 2Q43A 2CPEA 2J8SA 3BPDA 4OJ3A 4ZDNA 3M2UA 4I2EA 3EGWB 3C21A 2XY5A 2HRTA 1L7MA 1RAFB 1SKUB 5J0QA 2I0XA 5KG2A 4LRCA 4JMUA 4DQRA 2EH9A 2B56A 1LNQA 4I2CA 2PUZA 2ZBCA 5D78A 1B7YB 1CVJA 3WK9A 3CDWA 4ZKAA 1FFWB 4YS2A 1N61A 2PEHA 8ICNA 5DGAA 3PX4A 1B0XA 3M05A 3IM8A 4IG3B 5J2PB 1P7DA 3ISNC 2KXHA 3RBDA 3S8SA 1U26A 2J6TA 1GX5A 5AM5A 2E5SA 3IFEA 4NZ0A 3FVYA 5HLFA 1QQ6A 1YNYA 1ZQBA 1UEKA 2B4PA 3NGUA 5I3UA 8ICKA 2KZMA 3QU7A 4PL1A 3SQGA 4R85A 1HBNB 1C2PA 5F41A 3UDEA 2Q6CA 2E1FA 2ZJPQ 4RW4B 5J0RA 2Z00A 2XS7A 2X1AA 2WZ1A 3UMCA 1PIEA 3QLHB 2OUGA 4H4KC 1UEUA 5A2QU 2MHNA 3EUNA 1SKSA 2H4YB 4JK1A 2WB1D 1WKJA 2E5JA 4DZ6A 4G7EA 2V8VA 5AKQA 3CE8A 4NXZA 2AHOB 4A8SA 2UXDF 4DCCA 3CTRA 3SIPB 4DL6A 1KQKA 3OGUA 4DV3J 2QJ3A 1VQ6S 4IH5A 9ICFA 2E1CA 2DKXA 1LKYB 1TKTA 2OFHX 9ICTA 3B0XA 3I4PA 5CB1A 4JV5J 3MGVA 1BQNA 2W3RA 2G9OA 5J2QB 1KDNA 3MTKA 5LSRA 4OD0A 5G4HC 2W4PA 1FRHA 2ZH9A 3K5NA 2ZH8A 3B0YA 3F5AA 3OVBA 1TV6B 3MPWA 2DBBA 3LK9A 4QWDA 2HNYA 5CABA 3QEAZ 1IR2A 1TL4A 5HNKA 1FHTA 4F3OA 1NH7A 2BCVA 3RW7A 3NMRA 1ZRNA 4OJOA 2ESEA 5GMKa 1X5OA 1SVDA 2C2MB 4ZA1A 4DUZJ 4CLZA 2LXIA 1OSCA 3M1YA 1ZQYA 2ALZA 3D6NA 4AYBD 1CC7A 3HRDD 3TX0A 4RQ0A 5HO4A 4F4WA 4OYMA 4CT8A 2YQ0A 1IE7C 1C0TA 8ATCB 1FEZA 4LF6J 3BO4A 2WSFC 4X66J 3F44A 3R5AA 1VS3A 2ZHBA 4Y2CA 4F25A 2DO4A 3SSRA 2DT9A 1F1BB 2P9CA 5ETTA 1FWLA 4USKA 1NKBA 1H7XA 1NLKL 3JPOA 2I9UA 2FY1A 3R2CJ 1YRUA 1KOHA 3PR4A 3KLFB 3F56A 2RMLA 4LF9J 1ACMB 4C0OC 3ISDA 2P35A 4KGXB 1U8WA 5CHCB 3MM9B 4ETXA 2QLTA 1TUGB 1N0UA 1ZQVA 4DFDA 1FIQA 2RILA 2AYBA 4OYXA 1W26A 3UD4P 1ZS6A 3FDSA 1XERA 2VASA 3IHQB 5HQMA 4OI0A 3LAMA 5D0EA 1HI0P 3LWMA 2A6MA 1KVJA 2DNRA 3TUIC 2HBQB 1A0PA 1Z1BA 4DSLA 5E3PA 5B0DA 2KKVA 1DARA 2ZH6A 3FBEA 3D1QA 2R2SA 3HKZD 4DR7F 4TLRA 1QAYA 4M5GA 2KH9A 1HQ2A 4I27A 1D8ZA 1N5XA 3JTOA 1UBPC 3H5SA 2BBEA 4ZVRB 5L1IA 4Z2XA 2MQ8A 2AYMA 1NK9A 2KFNA 3SXLA 1CC8A 3LP1B 1S1UB 4C8ZA 2JC1A 8ICQA 4YN3B 1ZBTA 1TV9A 2D3ZA 1SL2A 4OZ5A 4C9DA 3B54A 3BGOP 4ID5B 3C16A 3THTA 1HPZA 3H4BA 1FKOB 2GGPA 2EFPA 2EBEA 1Q53A 4U7CA 3RGIA 4DV4J 8ICVA 2JOQA 2FVQA 3GIIA 2QL5B 1S6QB 1PK1A 2ROGA 4Y2TA 2BZFA 1KONA 1YRXA 3NOCA 1BD6A 1QAIA 4TU9A 1HWLA 2IPOB 2YNFB 5I3PA 4P0QB 2B0GA 1M5PC 4IRKA 4ZLLA 2EC2A 2V5HG 4WIQA 3I82A 5F8LA 4B3ZA 1X5TA 2Z57B 1FEEA 5BYSA 4F8RA 4X62J 1WOSA 3BM7A 5D3GA 4PXDA 5KFJA 3SAGA 2EG2A 5AI5A 1UETA 3DRYA 2NYIA 2PMZF 1TV6A 2ZZNA 1B4FA 1QDUB 3IC1A 1WUUA 2KKPA 5JXSA 1Z4UA 2JFKA 1FKPA 2IY5B 4GKJF 1BWVA 1LW0A 2MGZA 3D3CJ 1JX4A 3GRIA 1SQEA 2ZFHA 2HMXA 2Z2MA 1N52B 3C28A 2OPSB 3HZEA 4RLEA 3QYPA 1A6SA 2VQEF 2BCRA 3WK5A 1V3SA 4NCAA 4BX9C 4LZDA 5J0YA 4P9SA 4FP9A 2NRZA 3GCXP 3SCJE 4WTOB 1KEKA 7ICIA 3AD7C 2ZH7A 1IBKF 4M47A 4IFVA 4TLQA 1OXJA 3EXCX 3CC7S 2YNIA 4IG3A 2LU2A 2IDLA 2PFNA 5KFKA 1M1GA 3GYXB 4MYUA 1AB8A 2NRXA 3C1ZA 3DM2A 3BSOA 1LWCB 1LVHA 3N6LA 5ETRA 3O1LA 4F71A 5K5MA 1XJWB 4JB3A 3ONQA 3NS7B 2ZNZA 5ALHA 3KLGB 5CZVA 3UM9A 2BRKA 5J2HA 2CPDA 4D3HA 4DLGA 2HFUA 4CYUA 4ER8A 2JH7A 3TUPA 5ETVA 4DOBA 4WFNQ 2AZ3A 1P9YA 3AAWB 1WKLA 2LQBA 1RBLA 4J9LA 9ICMA 5CYQA 2J7UA 3B4MA 5L1MA 2IJNA 4LSLA 2QB1A 4DMZA 5AE2A 2ZE2B 4FPIA 3IAM9 1IBMJ 5HQ8A 4HDGA 1X5SA 4KIAA 2MYFA 4NXMJ 1CJKB 4JYAF 4ELTA 2KVQE 2Q66A 5LM7E 2UXCJ 3R9LA 3HVWA 2P66A 3BV8A 5IIOA 1N5TA 3Q8MA 1KCXA 3MR5A 5D0GA 3QGAC 1V9OA 3AB2B 4K50A 3N5FA 2LDYA 4P2FA 1P27B 5AKHA 1XNRJ 5RUBA 3BBFA 1NDKA 2XMWA 2VUGA 4LRDA 2BX6A 2YX7A 2PFPA 4PG6A 1C1BB 3NNHA 4WXOA 4TUQA 2A0FB 3JYTA 1YZ7A 3AQPA 2P6TA 9ICNA 4USUA 5LL6d 2GFFA 1NM2A 1YJ7A 3PKYA 2KMDA 1ZQTA 3A4TA 2VODA 1RQNA 4NM2A 1PC4A 1VJ5A 2KZ3A 2J9DE 1BQNB 4NLNA 3JAMY 4KLHA 2QA4G 2XVTA 3LGMA 5CWRA 5A0LA 3NBPB 4RNFA 4NLTA 2VFUA 2VBYA 4DQIA 3TZXA 3M8SA 3N4MB 5HMMA 2CVEA 3JYTB 1XMBA 2BDUA 3FAHA 4LUBA 2DR5A 3GSDA 4IDKA 3CD6S 2F9DA 5KTQA 3TA2A 4A8FA 4ANDA 4GO7X 8ICMA 2KIVA 1L7NA 3KK3B 4OI1A 2V9WA 1HNWJ 5FJ4A 4I29A 1Y11A 2V63A 3ELHA 3A8KA 3W5YA 1HWJA 4ES1A 5HP1B 1JI7A 4G1QA 2EFVA 3ZTSA 4DL5A 2QEXS 4RW8B 2ZOFA 3TUZC 2MKKA 4LZGA 4KGZB 1KLNA 1EETA 3MR3A 2GSEA 3CCZA 2DCLA 2BJ8A 1MU2A 3I32A 1HBMB 3BDEA 2DQNB 1SJFA 3FC4A 5CR0A 3V5RA 4A8XA 4PPDA 1MW7A 2K06A 3QE9Y 2BACA 5CP2A 4MHVA 1RTZA 4KYZA 2C2RA 1NHVA 1WCNA 3D5MA 2C28A 4NI2B 4O5KA 2I6XA 1O0PA 3DM2B 4F91B 3MFIA 2JEJA 5ALDA 3CYMA 3ZNUA 4ELVA 1ZQKA 2C3OA 1XQIA 3RB3A 1VRTB 3WU2U 1IJFB 2NQPA 4DZDA 2NYVA 2ABYA 4YQWA 3CDEA 4JI4F 4AQYJ 3PNIA 1ZTTA 1AYEA 1VMBA 3CMES 4IH7A 5C0YA 2BJEA 3K5OA 4DS5A 1GTEA 3X3UA 2F5GA 1RT3B 3CEDA 4ED7A 1YGYA 1KFSA 3F2CA 2PFDA 3C66A 3J81Y 2IM0A 3HKZF 5J0UA 3M8QB 7ICNA 2QL9B 1FRJA 5DM6Q 7ICRA 4R0EA 4DN0A 5EWGA 3ITHA 2PMWA 1CI4A 4HHHA 3ZTOA 4ZK7M 1VR6A 1MG7A 4MFBA 1VJWA 1JLAA 3JPQA 3ZFVA 1KRAC 1HFEL 1P1TA 4MK8A 1UVIA 1Q8BA 1K70A 3MMBA 3W2VA 4LF4J 2XSJA 1KVKA 1U1QA 1WELA 3VQSA 4CLYA 5HMYA 3V4MA 1SBRA 2W4CA 4X4QA 2DNHA 2UVWA 1ICEB 1RT6B 3H8SA 4NY8A 3LS9A 1RTHB 7ICSA 3EPIA 3MHYA 3BS7A 1OY6A 4HACA 2EZXA 1U25A 4A8QA 4NLZA 2ZDOA 2IHMA 1ZD2P 1NH8A 4NLKA 1F9EB 2KP7A 4NLDA 4DG1A 3NNAA 3ETLA 2RLTA 3IA0A 5C42B 3HDSA 1EARA 3EGZA 4HTJA 2YKMA 3POTB 2FVCA 3KJFB 1YMYA 2E7XA 4MFCA 4R66A 2OOFA 2KJ5A 3Q86A 1CULA 1R0CB 3AFGA 3LVWA 3TAMB 4P2XA 4ZCMA 4JI1F 3KLVA 2POKA 4OHXA 3FSXA 4XTTA 1WEXA 4FVCA 1SWVA 1N32F 2ZHAA 3RG6A 2FYXA 8ICJA 4DV7J 3NRWA 4DN9A 2F4VF 2MZ1A 5KT5A 3LNPA 1UHUA 2YQ3A 4ILLA 4BLGA 1X4CA 3KNGA 2LCWA 4ECYA 4F0LA 3I56S 2CRLA 1AT1B 4Y3CA 4ECTA 3DRRB 4LBIA 5KAFU 2HS3A 3R5JB 1RT2A 3M2RB 1UCNA 2MQNA 3H40A 3JAMU 3C8YA 4P0PA 4QIFA 3NRZA 2LECA 4RPZA 4Y2JA 2V4JB 1DOQA 1GH8A 3VZIA 2YB1A 1ONWA 4LFAF 8ICFA 4HH1A 4NLXA 1L7PA 3ENQA 2RRBA 2E3TA 3W2WB 4F0HA 3MPGA 1H74A 5J2MB 1XC9A 5FIIA 1E9YB 3NQBA 3BBCA 1T9XA 9ATCB 2DR6A 1FO1A 2B5JA 4R64A 4B9LA 4IFYB 2OTJS 5CA7A 4G3IA 4HVZA 3E01A 3OR1A 5F9NA 1JLFB 4JP8A 3CXCR 4M5JA 3SCKE 2K4EA 3PSTA 3MMAB 3QUBA 2I9SA 4OO1J 3RR8A 4UBBA 5EE0A 2BE9B 4NLRA 1RK5A 4BHQA 1U1OA 3V7PA 3QT6A 4LVSA 1VIXA 5B0EA 1RTJB 6FDRA 4FDFA 3KHHA 4QIWF 4KLUA 4C5ZA 4YD1A 2J0WA 5HL7Q 1UMJA 2E1PA 1OPIA 4JBCA 2J6SA 1OYEA 3HPOA 1S57A 4CEXC 2MY8A 2KK0A 1X9WA 5A8RA 1F5SA 2NXNA 1ZQIA 4PH5A 3V81B 3BDPA 2UVRA 4EEYA 1DHMA 4ZPBA 1U6BA 2DNKA 4CZCA 1WC4A 1JJHA 4NJ8A 3GFYA 2DIUA 2GHWA 3MCSA 5A8KA 5M2RA 5DZ7A 2MZTA 1B99A 4WTYA 3QGHA 2MLXA 5AJ3F 2F1JA 1TMMA 3OXLA 4DCPB 2NO5A 1YRRA 1OQ6A 1RU2A 3IS9A 3ZTRA 4B08A 4CQCA 2WFAA 1NRKA 4P4PA 2BZ2A 1IKYB 4B3SJ 3NGKA 1RWPB 5EE9A 2EFQA 4K4WA 2IDEA 1RT4A 1FWAC 3HSJA 3H5UA 4QYRA 4U7UD 1G4CA 3W7BA 4US8A 2QGFB 4F5QA 5HATA 3DOKA 3GG0A 3I28A 3SBMA 4QCLA 1VQNS 3ED5A 1OY9A 4KV8B 2LXFA 2O3DA 5T7LB 3JQMA 4QWBA 2KT5A 2AJ2A 2LM4A 2N7YA 1FD2A 2OLWA 4IR1A 2VU5A 4XUSA 4UOHA 3J7ZT 2GNKA 2FDRA 4LF5F 1RYSA 1OMSA 3KG0A 4DF8A 2VHGA 2MY7A 5KFHA 3R5DA 3BJYA 4K7QA 1IVZA 1FRLA 1FJGJ 2N82B 4JB8B 4PHDA 2UXDJ 3CDAA 4RW6B 1GMWD 2XI2A 2W1BA 4PZVA 1RHKB 3A1YG 3BQ7A 3H4DA 2QFIA 2OXOA 7FDRA 4JI8F 5A8WA 4X4VA 2C22A 2BVZA 2CQDA 1YBUA 4ZPTR 4WFXA 4JV5F 1WTBA 1WUDA 3DGPB 2D1CA 5CRXA 5AE3A 5J0TA 4X4RA 2KZZA 4C0ZA 2J6UA 2V2KA 4K4ZA 2BE2A 1TFRA 1N6QB 5J2MA 1SXLA 3HHLB 3M6KA 2Q0ZX 4HI2A 3BH6B 1FKPB 2BEFA 1FVQA 3ILIA 1VRUA 3CJ8A 2RF2A 4ECXA 4QBUA 4USAA 2YNGB 1WACA 4ECRA 3J7A1 3QZ8A 3OTQA 9RUBA 3GIQA 2QO3A 2EQYA 3LOUA 1V85A 2CPRA 1AA1B 1S9GB </