The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
55
|
sequence length |
144
|
structure length |
144
|
Chain Sequence |
MKNIEKLEQSLTYEFKDKNLLIHALTHKSFKKSYNNERLEFLGDAVLDLVVGEYLFHKFAKDAEGDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDALEAIIGAIHLEAGFEFAKTIALRLIEKNFP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
2.2 Angstrom Resolution Crystal Structure of Nuclease Domain of Ribonuclase III (rnc) from Campylobacter jejuni
rcsb |
| molecule keywords |
Ribonuclease III
|
| molecule tags |
Hydrolase
|
| source organism |
Campylobacter jejuni subsp. jejuni
|
| total genus |
55
|
| structure length |
144
|
| sequence length |
144
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.1.26.3: Ribonuclease III. |
| pdb deposition date | 2010-05-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00035 | dsrm | Double-stranded RNA binding motif |
| A | PF14622 | Ribonucleas_3_3 | Ribonuclease-III-like |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Ribonuclease iii, N-terminal Endonuclease Domain; Chain A | Ribonuclease III domain |
#chains in the Genus database with same CATH superfamily 3N3W A; 4M30 A; 2QVW A; 2NUG A; 3RV1 A; 3O2R B; 3C4B A; 4OOG C; 2EB1 A; 1RC7 A; 1YYK A; 1YYW A; 1JFZ A; 1RC5 A; 1YZ9 A; 1YYO A; 2FFL A; 2EZ6 A; 2NUE A; 2NUF A; 4M2Z A; 3O2R A; 1O0W A; 4OUN A; 2A11 A; 1I4S A; 3RV0 A; 2GSL A; 3C4T A; 1U61 A; #chains in the Genus database with same CATH topology 3N3W A; 4M30 A; 2QVW A; 2NUG A; 1ZTD A; 3RV1 A; 3O2R B; 3C4B A; 4OOG C; 2EB1 A; 1RC7 A; 1YYK A; 1YYW A; 1JFZ A; 1RC5 A; 1YZ9 A; 1YYO A; 2FFL A; 2EZ6 A; 2NUE A; 2NUF A; 4M2Z A; 3O2R A; 1O0W A; 4OUN A; 2A11 A; 1I4S A; 3RV0 A; 2GSL A; 3C4T A; 1U61 A; #chains in the Genus database with same CATH homology 3N3W A; 4M30 A; 2QVW A; 2NUG A; 3RV1 A; 3O2R B; 3C4B A; 4OOG C; 2EB1 A; 1RC7 A; 1YYK A; 1YYW A; 1JFZ A; 1RC5 A; 1YZ9 A; 1YYO A; 2FFL A; 2EZ6 A; 2NUE A; 2NUF A; 4M2Z A; 3O2R A; 1O0W A; 4OUN A; 2A11 A; 1I4S A; 3RV0 A; 2GSL A; 3C4T A; 1U61 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...