The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
144
|
structure length |
142
|
Chain Sequence |
NIEKLEQSLTYEFKDKNLLIHALTHKSFKSYNNERLEFLGDAVLDLVVGEYLFHKFAKDAEGDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDALEAIIGAIHLEAGFEFAKTIALRLIEKNFPI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Flexibility in Region Involved in Dimer Formation of Nuclease Domain of Ribonuclase III (rnc) from Campylobacter jejuni.
rcsb |
molecule tags |
Hydrolase
|
source organism |
Campylobacter jejuni subsp. jejuni
|
molecule keywords |
Ribonuclease III
|
total genus |
60
|
structure length |
142
|
sequence length |
144
|
chains with identical sequence |
D
|
ec nomenclature |
ec
3.1.26.3: Ribonuclease III. |
pdb deposition date | 2010-07-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF14622 | Ribonucleas_3_3 | Ribonuclease-III-like |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Ribonuclease iii, N-terminal Endonuclease Domain; Chain A | Ribonuclease III domain |
#chains in the Genus database with same CATH superfamily 2QVW A; 1YYO A; 1O0W A; 2A11 A; 3RV0 A; 1YYW A; 3O2R A; 2NUE A; 2NUG A; 4OOG C; 3O2R B; 2FFL A; 3C4T A; 2EZ6 A; 1YZ9 A; 1RC7 A; 4M30 A; 3N3W A; 2GSL A; 2NUF A; 4OUN A; 4M2Z A; 1U61 A; 1JFZ A; 3C4B A; 3RV1 A; 1I4S A; 1RC5 A; 2EB1 A; 1YYK A; #chains in the Genus database with same CATH topology 2QVW A; 1YYO A; 1O0W A; 2A11 A; 1ZTD A; 3RV0 A; 1YYW A; 3O2R A; 2NUE A; 2NUG A; 4OOG C; 3O2R B; 2FFL A; 3C4T A; 2EZ6 A; 1YZ9 A; 1RC7 A; 4M30 A; 3N3W A; 2GSL A; 2NUF A; 4OUN A; 4M2Z A; 1U61 A; 1JFZ A; 3C4B A; 3RV1 A; 1I4S A; 1RC5 A; 2EB1 A; 1YYK A; #chains in the Genus database with same CATH homology 2QVW A; 1YYO A; 1O0W A; 2A11 A; 3RV0 A; 1YYW A; 3O2R A; 2NUE A; 2NUG A; 4OOG C; 3O2R B; 2FFL A; 3C4T A; 2EZ6 A; 1YZ9 A; 1RC7 A; 4M30 A; 3N3W A; 2GSL A; 2NUF A; 4OUN A; 4M2Z A; 1U61 A; 1JFZ A; 3C4B A; 3RV1 A; 1I4S A; 1RC5 A; 2EB1 A; 1YYK A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...