3G65A

Crystal structure of the human rad9-rad1-hus1 dna damage checkpoint complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
254
Chain Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQALRCKILMKSFLSVFRSLAMVEKCCISLNGRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHETAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLSDTDSGTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell cycle checkpoint control protein RAD9A
publication title Crystal structure of the rad9-rad1-hus1 DNA damage checkpoint complex--implications for clamp loading and regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 254
sequence length 273
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04139 Rad9 Rad9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3g65A00
1VYMA 2IJXA 5IWDA 3P83A 2ZVVA 4D2GA 3A2FB 5E0VA 2ZVMA 3WGWA 2NTIC 4CS5A 2NTIB 2NTIA 3A1JC 5IY4A 3TBLA 3A1JA 3P91A 1RXMA 3GPNA 3LX1A 3GGRC 3GGRB 3GGRA 2HIKC 1IZ4A 3P87A 2IZOC 4TR6A 2IZOB 1U7BA 1VYJA 1RXZA 5AUJA 1CZDA 5H0TA 3K4XA 3F1WA 3V60B 3VKXA 5IXAA 1IZ5A 3IFVA 3AIZC 3AIZA 2OD8A 3FDSC 2HIIB 4HK1A 3GPMA 1T6LA 5DA7A 2AWAA 2Z0LA 3U60F 1PLQA 1B8HA 2ZVLA 5B7OA 3U61F 4YHRA 3G65B 3G65A 3HI8A 1B77A 1SXJF 3AIXB 3AIXA 3V62B 3I2MX 3FDSD 1W60A 1RWZA 1PLRA 5DAIA 4L60A 2ZVKA 2HIIC 5E0UA 1YYPA 2HIIA 2IX2B 2IX2A 2ZVWA 5A6DA 3LX2A 1UL1A 4L6PA 3G65C 3V61B 5HACA 1AXCA 5JNED 4RJFA 1UD9A 1GE8A 3HSLX 3A1JB 4ZTDA 5E0TA 1DMLA 2IO4B 2IO4A 2AVTA 5CFKA 2IX2C 3U5ZF 2HIKB 2HIKA 1U76A 1ISQA
chains in the Genus database with same CATH superfamily
1VYMA 2IJXA 5IWDA 3P83A 2ZVVA 4D2GA 3A2FB 5E0VA 2ZVMA 3WGWA 2NTIC 4CS5A 2NTIB 2NTIA 3A1JC 5IY4A 3TBLA 3A1JA 3P91A 1RXMA 3GPNA 3LX1A 3GGRC 3GGRB 3GGRA 2HIKC 1IZ4A 3P87A 2IZOC 4TR6A 2IZOB 1U7BA 1VYJA 1RXZA 5AUJA 1CZDA 5H0TA 3K4XA 3F1WA 3V60B 3VKXA 5IXAA 1IZ5A 3IFVA 3AIZC 3AIZA 2OD8A 3FDSC 2HIIB 4HK1A 3GPMA 1T6LA 5DA7A 2AWAA 2Z0LA 3U60F 1PLQA 1B8HA 2ZVLA 5B7OA 3U61F 4YHRA 3G65B 3G65A 3HI8A 1B77A 1SXJF 3AIXB 3AIXA 3V62B 3I2MX 3FDSD 1W60A 1RWZA 1PLRA 5DAIA 4L60A 2ZVKA 2HIIC 5E0UA 1YYPA 2HIIA 2IX2B 2IX2A 2ZVWA 5A6DA 3LX2A 1UL1A 4L6PA 3G65C 3V61B 5HACA 1AXCA 5JNED 4RJFA 1UD9A 1GE8A 3HSLX 3A1JB 4ZTDA 5E0TA 1DMLA 2IO4B 2IO4A 2AVTA 5CFKA 2IX2C 3U5ZF 2HIKB 2HIKA 1U76A 1ISQA
chains in the Genus database with same CATH topology
1VYMA 2IJXA 5IWDA 3P83A 2ZVVA 4D2GA 3A2FB 5E0VA 2ZVMA 3WGWA 2NTIC 4CS5A 2NTIB 2NTIA 3A1JC 5IY4A 3TBLA 3A1JA 3P91A 1RXMA 3GPNA 3LX1A 3GGRC 3GGRB 3GGRA 2HIKC 1IZ4A 3P87A 2IZOC 4TR6A 2IZOB 1U7BA 1VYJA 1RXZA 5AUJA 1CZDA 5H0TA 3K4XA 3F1WA 3V60B 3VKXA 5IXAA 1IZ5A 3IFVA 3AIZC 3AIZA 2OD8A 3FDSC 2HIIB 4HK1A 3GPMA 1T6LA 5DA7A 2AWAA 2Z0LA 3U60F 1PLQA 1B8HA 2ZVLA 5B7OA 3U61F 4YHRA 3G65B 3G65A 3HI8A 1B77A 1SXJF 3AIXB 3AIXA 3V62B 3I2MX 3FDSD 1W60A 1RWZA 1PLRA 5DAIA 4L60A 2ZVKA 2HIIC 5E0UA 1YYPA 2HIIA 2IX2B 2IX2A 2ZVWA 5A6DA 3LX2A 1UL1A 4L6PA 3G65C 3V61B 5HACA 1AXCA 5JNED 4RJFA 1UD9A 1GE8A 3HSLX 3A1JB 4ZTDA 5E0TA 1DMLA 2IO4B 2IO4A 2AVTA 5CFKA 2IX2C 3U5ZF 2HIKB 2HIKA 1U76A 1ISQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYM A;  2IJX A;  5IWD A;  3P83 A;  2ZVV A;  4D2G A;  3A2F B;  5E0V A;  2ZVM A;  3WGW A;  2NTI C;  4CS5 A;  2NTI B;  2NTI A;  3A1J C;  5IY4 A;  3TBL A;  3A1J A;  3P91 A;  1RXM A;  3GPN A;  3LX1 A;  3GGR C;  3GGR B;  3GGR A;  2HIK C;  1IZ4 A;  3P87 A;  2IZO C;  4TR6 A;  2IZO B;  1U7B A;  1VYJ A;  1RXZ A;  5AUJ A;  1CZD A;  5H0T A;  3K4X A;  3F1W A;  3V60 B;  3VKX A;  5IXA A;  1IZ5 A;  3IFV A;  3AIZ C;  3AIZ A;  2OD8 A;  3FDS C;  2HII B;  4HK1 A;  3GPM A;  1T6L A;  5DA7 A;  2AWA A;  2Z0L A;  3U60 F;  1PLQ A;  1B8H A;  2ZVL A;  5B7O A;  3U61 F;  4YHR A;  3G65 B;  3G65 A;  3HI8 A;  1B77 A;  1SXJ F;  3AIX B;  3AIX A;  3V62 B;  3I2M X;  3FDS D;  1W60 A;  1RWZ A;  1PLR A;  5DAI A;  4L60 A;  2ZVK A;  2HII C;  5E0U A;  1YYP A;  2HII A;  2IX2 B;  2IX2 A;  2ZVW A;  5A6D A;  3LX2 A;  1UL1 A;  4L6P A;  3G65 C;  3V61 B;  5HAC A;  1AXC A;  5JNE D;  4RJF A;  1UD9 A;  1GE8 A;  3HSL X;  3A1J B;  4ZTD A;  5E0T A;  1DML A;  2IO4 B;  2IO4 A;  2AVT A;  5CFK A;  2IX2 C;  3U5Z F;  2HIK B;  2HIK A;  1U76 A;  1ISQ A; 
#chains in the Genus database with same CATH topology
 1VYM A;  2IJX A;  5IWD A;  3P83 A;  2ZVV A;  4D2G A;  3A2F B;  5E0V A;  2ZVM A;  3WGW A;  2NTI C;  4CS5 A;  2NTI B;  2NTI A;  3A1J C;  5IY4 A;  3TBL A;  3A1J A;  3P91 A;  1RXM A;  3GPN A;  3LX1 A;  3GGR C;  3GGR B;  3GGR A;  2HIK C;  1IZ4 A;  3P87 A;  2IZO C;  4TR6 A;  2IZO B;  1U7B A;  1VYJ A;  1RXZ A;  5AUJ A;  1CZD A;  5H0T A;  3K4X A;  3F1W A;  3V60 B;  3VKX A;  5IXA A;  1IZ5 A;  3IFV A;  3AIZ C;  3AIZ A;  2OD8 A;  3FDS C;  2HII B;  4HK1 A;  3GPM A;  1T6L A;  5DA7 A;  2AWA A;  2Z0L A;  3U60 F;  1PLQ A;  1B8H A;  2ZVL A;  5B7O A;  3U61 F;  4YHR A;  3G65 B;  3G65 A;  3HI8 A;  1B77 A;  1SXJ F;  3AIX B;  3AIX A;  3V62 B;  3I2M X;  3FDS D;  1W60 A;  1RWZ A;  1PLR A;  5DAI A;  4L60 A;  2ZVK A;  2HII C;  5E0U A;  1YYP A;  2HII A;  2IX2 B;  2IX2 A;  2ZVW A;  5A6D A;  3LX2 A;  1UL1 A;  4L6P A;  3G65 C;  3V61 B;  5HAC A;  1AXC A;  5JNE D;  4RJF A;  1UD9 A;  1GE8 A;  3HSL X;  3A1J B;  4ZTD A;  5E0T A;  1DML A;  2IO4 B;  2IO4 A;  2AVT A;  5CFK A;  2IX2 C;  3U5Z F;  2HIK B;  2HIK A;  1U76 A;  1ISQ A; 
#chains in the Genus database with same CATH homology
 1VYM A;  2IJX A;  5IWD A;  3P83 A;  2ZVV A;  4D2G A;  3A2F B;  5E0V A;  2ZVM A;  3WGW A;  2NTI C;  4CS5 A;  2NTI B;  2NTI A;  3A1J C;  5IY4 A;  3TBL A;  3A1J A;  3P91 A;  1RXM A;  3GPN A;  3LX1 A;  3GGR C;  3GGR B;  3GGR A;  2HIK C;  1IZ4 A;  3P87 A;  2IZO C;  4TR6 A;  2IZO B;  1U7B A;  1VYJ A;  1RXZ A;  5AUJ A;  1CZD A;  5H0T A;  3K4X A;  3F1W A;  3V60 B;  3VKX A;  5IXA A;  1IZ5 A;  3IFV A;  3AIZ C;  3AIZ A;  2OD8 A;  3FDS C;  2HII B;  4HK1 A;  3GPM A;  1T6L A;  5DA7 A;  2AWA A;  2Z0L A;  3U60 F;  1PLQ A;  1B8H A;  2ZVL A;  5B7O A;  3U61 F;  4YHR A;  3G65 B;  3G65 A;  3HI8 A;  1B77 A;  1SXJ F;  3AIX B;  3AIX A;  3V62 B;  3I2M X;  3FDS D;  1W60 A;  1RWZ A;  1PLR A;  5DAI A;  4L60 A;  2ZVK A;  2HII C;  5E0U A;  1YYP A;  2HII A;  2IX2 B;  2IX2 A;  2ZVW A;  5A6D A;  3LX2 A;  1UL1 A;  4L6P A;  3G65 C;  3V61 B;  5HAC A;  1AXC A;  5JNE D;  4RJF A;  1UD9 A;  1GE8 A;  3HSL X;  3A1J B;  4ZTD A;  5E0T A;  1DML A;  2IO4 B;  2IO4 A;  2AVT A;  5CFK A;  2IX2 C;  3U5Z F;  2HIK B;  2HIK A;  1U76 A;  1ISQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...