3GPMA

Structure of the trimeric form of the e113g pcna mutant protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
254
structure length
254
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAGYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title A charged residue at the subunit interface of PCNA promotes trimer formation by destabilizing alternate subunit interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3gpmA00
1CZDA 5IXAA 3V61B 3FDSC 2IO4A 3A2FB 2IJXA 2OD8A 3WGWA 3GGRC 3GGRB 2AWAA 3V62B 2HIIC 3GPNA 2IX2C 2HIIB 5JNED 2IX2B 3VKXA 1IZ4A 4TR6A 3AIXA 2HIKC 4L60A 4RJFA 2HIKB 1UD9A 3I2MX 3AIZA 1SXJF 1W60A 2IZOC 2IZOB 3IFVA 3GGRA 3K4XA 3AIZC 2HIIA 2IX2A 1RXZA 1RWZA 1B8HA 3G65C 3P91A 2NTIC 3G65B 1IZ5A 2HIKA 2NTIB 4ZTDA 5H0TA 3V60B 1VYMA 1AXCA 1PLQA 5HACA 4YHRA 1ISQA 1U7BA 3A1JC 5A6DA 5CFKA 5IWDA 3A1JB 2Z0LA 2ZVMA 1PLRA 3U5ZF 1B77A 3G65A 2NTIA 2AVTA 5E0UA 3F1WA 3HI8A 1UL1A 3U61F 3GPMA 3HSLX 1U76A 1RXMA 2ZVLA 3A1JA 2ZVWA 2ZVVA 3U60F 3P83A 5E0VA 5DAIA 5E0TA 1DMLA 2ZVKA 3LX2A 1GE8A 1VYJA 1T6LA 2IO4B 4CS5A 3TBLA 3LX1A 5DA7A 4D2GA 5AUJA 4HK1A 3P87A 1YYPA 3FDSD 5B7OA 5IY4A 4L6PA 3AIXB
chains in the Genus database with same CATH superfamily
1CZDA 5IXAA 3V61B 3FDSC 2IO4A 3A2FB 2IJXA 2OD8A 3WGWA 3GGRC 3GGRB 2AWAA 3V62B 2HIIC 3GPNA 2IX2C 2HIIB 5JNED 2IX2B 3VKXA 1IZ4A 4TR6A 3AIXA 2HIKC 4L60A 4RJFA 2HIKB 1UD9A 3I2MX 3AIZA 1SXJF 1W60A 2IZOC 2IZOB 3IFVA 3GGRA 3K4XA 3AIZC 2HIIA 2IX2A 1RXZA 1RWZA 1B8HA 3G65C 3P91A 2NTIC 3G65B 1IZ5A 2HIKA 2NTIB 4ZTDA 5H0TA 3V60B 1VYMA 1AXCA 1PLQA 5HACA 4YHRA 1ISQA 1U7BA 3A1JC 5A6DA 5CFKA 5IWDA 3A1JB 2Z0LA 2ZVMA 1PLRA 3U5ZF 1B77A 3G65A 2NTIA 2AVTA 5E0UA 3F1WA 3HI8A 1UL1A 3U61F 3GPMA 3HSLX 1U76A 1RXMA 2ZVLA 3A1JA 2ZVWA 2ZVVA 3U60F 3P83A 5E0VA 5DAIA 5E0TA 1DMLA 2ZVKA 3LX2A 1GE8A 1VYJA 1T6LA 2IO4B 4CS5A 3TBLA 3LX1A 5DA7A 4D2GA 5AUJA 4HK1A 3P87A 1YYPA 3FDSD 5B7OA 5IY4A 4L6PA 3AIXB
chains in the Genus database with same CATH topology
1CZDA 5IXAA 3V61B 3FDSC 2IO4A 3A2FB 2IJXA 2OD8A 3WGWA 3GGRC 3GGRB 2AWAA 3V62B 2HIIC 3GPNA 2IX2C 2HIIB 5JNED 2IX2B 3VKXA 1IZ4A 4TR6A 3AIXA 2HIKC 4L60A 4RJFA 2HIKB 1UD9A 3I2MX 3AIZA 1SXJF 1W60A 2IZOC 2IZOB 3IFVA 3GGRA 3K4XA 3AIZC 2HIIA 2IX2A 1RXZA 1RWZA 1B8HA 3G65C 3P91A 2NTIC 3G65B 1IZ5A 2HIKA 2NTIB 4ZTDA 5H0TA 3V60B 1VYMA 1AXCA 1PLQA 5HACA 4YHRA 1ISQA 1U7BA 3A1JC 5A6DA 5CFKA 5IWDA 3A1JB 2Z0LA 2ZVMA 1PLRA 3U5ZF 1B77A 3G65A 2NTIA 2AVTA 5E0UA 3F1WA 3HI8A 1UL1A 3U61F 3GPMA 3HSLX 1U76A 1RXMA 2ZVLA 3A1JA 2ZVWA 2ZVVA 3U60F 3P83A 5E0VA 5DAIA 5E0TA 1DMLA 2ZVKA 3LX2A 1GE8A 1VYJA 1T6LA 2IO4B 4CS5A 3TBLA 3LX1A 5DA7A 4D2GA 5AUJA 4HK1A 3P87A 1YYPA 3FDSD 5B7OA 5IY4A 4L6PA 3AIXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZD A;  5IXA A;  3V61 B;  3FDS C;  2IO4 A;  3A2F B;  2IJX A;  2OD8 A;  3WGW A;  3GGR C;  3GGR B;  2AWA A;  3V62 B;  2HII C;  3GPN A;  2IX2 C;  2HII B;  5JNE D;  2IX2 B;  3VKX A;  1IZ4 A;  4TR6 A;  3AIX A;  2HIK C;  4L60 A;  4RJF A;  2HIK B;  1UD9 A;  3I2M X;  3AIZ A;  1SXJ F;  1W60 A;  2IZO C;  2IZO B;  3IFV A;  3GGR A;  3K4X A;  3AIZ C;  2HII A;  2IX2 A;  1RXZ A;  1RWZ A;  1B8H A;  3G65 C;  3P91 A;  2NTI C;  3G65 B;  1IZ5 A;  2HIK A;  2NTI B;  4ZTD A;  5H0T A;  3V60 B;  1VYM A;  1AXC A;  1PLQ A;  5HAC A;  4YHR A;  1ISQ A;  1U7B A;  3A1J C;  5A6D A;  5CFK A;  5IWD A;  3A1J B;  2Z0L A;  2ZVM A;  1PLR A;  3U5Z F;  1B77 A;  3G65 A;  2NTI A;  2AVT A;  5E0U A;  3F1W A;  3HI8 A;  1UL1 A;  3U61 F;  3GPM A;  3HSL X;  1U76 A;  1RXM A;  2ZVL A;  3A1J A;  2ZVW A;  2ZVV A;  3U60 F;  3P83 A;  5E0V A;  5DAI A;  5E0T A;  1DML A;  2ZVK A;  3LX2 A;  1GE8 A;  1VYJ A;  1T6L A;  2IO4 B;  4CS5 A;  3TBL A;  3LX1 A;  5DA7 A;  4D2G A;  5AUJ A;  4HK1 A;  3P87 A;  1YYP A;  3FDS D;  5B7O A;  5IY4 A;  4L6P A;  3AIX B; 
#chains in the Genus database with same CATH topology
 1CZD A;  5IXA A;  3V61 B;  3FDS C;  2IO4 A;  3A2F B;  2IJX A;  2OD8 A;  3WGW A;  3GGR C;  3GGR B;  2AWA A;  3V62 B;  2HII C;  3GPN A;  2IX2 C;  2HII B;  5JNE D;  2IX2 B;  3VKX A;  1IZ4 A;  4TR6 A;  3AIX A;  2HIK C;  4L60 A;  4RJF A;  2HIK B;  1UD9 A;  3I2M X;  3AIZ A;  1SXJ F;  1W60 A;  2IZO C;  2IZO B;  3IFV A;  3GGR A;  3K4X A;  3AIZ C;  2HII A;  2IX2 A;  1RXZ A;  1RWZ A;  1B8H A;  3G65 C;  3P91 A;  2NTI C;  3G65 B;  1IZ5 A;  2HIK A;  2NTI B;  4ZTD A;  5H0T A;  3V60 B;  1VYM A;  1AXC A;  1PLQ A;  5HAC A;  4YHR A;  1ISQ A;  1U7B A;  3A1J C;  5A6D A;  5CFK A;  5IWD A;  3A1J B;  2Z0L A;  2ZVM A;  1PLR A;  3U5Z F;  1B77 A;  3G65 A;  2NTI A;  2AVT A;  5E0U A;  3F1W A;  3HI8 A;  1UL1 A;  3U61 F;  3GPM A;  3HSL X;  1U76 A;  1RXM A;  2ZVL A;  3A1J A;  2ZVW A;  2ZVV A;  3U60 F;  3P83 A;  5E0V A;  5DAI A;  5E0T A;  1DML A;  2ZVK A;  3LX2 A;  1GE8 A;  1VYJ A;  1T6L A;  2IO4 B;  4CS5 A;  3TBL A;  3LX1 A;  5DA7 A;  4D2G A;  5AUJ A;  4HK1 A;  3P87 A;  1YYP A;  3FDS D;  5B7O A;  5IY4 A;  4L6P A;  3AIX B; 
#chains in the Genus database with same CATH homology
 1CZD A;  5IXA A;  3V61 B;  3FDS C;  2IO4 A;  3A2F B;  2IJX A;  2OD8 A;  3WGW A;  3GGR C;  3GGR B;  2AWA A;  3V62 B;  2HII C;  3GPN A;  2IX2 C;  2HII B;  5JNE D;  2IX2 B;  3VKX A;  1IZ4 A;  4TR6 A;  3AIX A;  2HIK C;  4L60 A;  4RJF A;  2HIK B;  1UD9 A;  3I2M X;  3AIZ A;  1SXJ F;  1W60 A;  2IZO C;  2IZO B;  3IFV A;  3GGR A;  3K4X A;  3AIZ C;  2HII A;  2IX2 A;  1RXZ A;  1RWZ A;  1B8H A;  3G65 C;  3P91 A;  2NTI C;  3G65 B;  1IZ5 A;  2HIK A;  2NTI B;  4ZTD A;  5H0T A;  3V60 B;  1VYM A;  1AXC A;  1PLQ A;  5HAC A;  4YHR A;  1ISQ A;  1U7B A;  3A1J C;  5A6D A;  5CFK A;  5IWD A;  3A1J B;  2Z0L A;  2ZVM A;  1PLR A;  3U5Z F;  1B77 A;  3G65 A;  2NTI A;  2AVT A;  5E0U A;  3F1W A;  3HI8 A;  1UL1 A;  3U61 F;  3GPM A;  3HSL X;  1U76 A;  1RXM A;  2ZVL A;  3A1J A;  2ZVW A;  2ZVV A;  3U60 F;  3P83 A;  5E0V A;  5DAI A;  5E0T A;  1DML A;  2ZVK A;  3LX2 A;  1GE8 A;  1VYJ A;  1T6L A;  2IO4 B;  4CS5 A;  3TBL A;  3LX1 A;  5DA7 A;  4D2G A;  5AUJ A;  4HK1 A;  3P87 A;  1YYP A;  3FDS D;  5B7O A;  5IY4 A;  4L6P A;  3AIX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...