3GPNA

Structure of the non-trimeric form of the e113g pcna mutant protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
253
structure length
253
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAGYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title A charged residue at the subunit interface of PCNA promotes trimer formation by destabilizing alternate subunit interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 57
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3gpnA00
1IZ5A 3P83A 2IZOB 3A1JC 2HIKB 3HI8A 3VKXA 3V61B 1W60A 2IX2A 3AIZC 4CS5A 1RXZA 5IXAA 3U60F 3HSLX 4D2GA 1PLQA 1B77A 2HIKA 4ZTDA 3GGRB 1ISQA 3A1JA 3A2FB 2OD8A 3AIZA 3P87A 1YYPA 3AIXB 1AXCA 2IZOC 2IJXA 3GGRA 1CZDA 3V60B 2HIKC 3P91A 3IFVA 5B7OA 1SXJF 1GE8A 2NTIB 2HIIB 3GGRC 2ZVLA 2ZVWA 1RWZA 1VYJA 5E0UA 2AWAA 2ZVVA 2ZVMA 2IO4B 2AVTA 2HIIA 3LX2A 5HACA 3V62B 3FDSD 5IWDA 1U7BA 3FDSC 5DA7A 3K4XA 1B8HA 2IO4A 4RJFA 2NTIC 3G65B 3LX1A 2HIIC 3AIXA 3GPNA 3TBLA 4TR6A 1UL1A 5DAIA 3U5ZF 5JNED 1PLRA 1UD9A 2ZVKA 3I2MX 5E0TA 2NTIA 2IX2B 1RXMA 5H0TA 4L60A 5AUJA 3F1WA 1U76A 3G65C 3U61F 3A1JB 1VYMA 5IY4A 5CFKA 1T6LA 3G65A 3GPMA 4YHRA 2IX2C 5E0VA 3WGWA 5A6DA 1DMLA 2Z0LA 1IZ4A 4HK1A 4L6PA
chains in the Genus database with same CATH superfamily
1IZ5A 3P83A 2IZOB 3A1JC 2HIKB 3HI8A 3VKXA 3V61B 1W60A 2IX2A 3AIZC 4CS5A 1RXZA 5IXAA 3U60F 3HSLX 4D2GA 1PLQA 1B77A 2HIKA 4ZTDA 3GGRB 1ISQA 3A1JA 3A2FB 2OD8A 3AIZA 3P87A 1YYPA 3AIXB 1AXCA 2IZOC 2IJXA 3GGRA 1CZDA 3V60B 2HIKC 3P91A 3IFVA 5B7OA 1SXJF 1GE8A 2NTIB 2HIIB 3GGRC 2ZVLA 2ZVWA 1RWZA 1VYJA 5E0UA 2AWAA 2ZVVA 2ZVMA 2IO4B 2AVTA 2HIIA 3LX2A 5HACA 3V62B 3FDSD 5IWDA 1U7BA 3FDSC 5DA7A 3K4XA 1B8HA 2IO4A 4RJFA 2NTIC 3G65B 3LX1A 2HIIC 3AIXA 3GPNA 3TBLA 4TR6A 1UL1A 5DAIA 3U5ZF 5JNED 1PLRA 1UD9A 2ZVKA 3I2MX 5E0TA 2NTIA 2IX2B 1RXMA 5H0TA 4L60A 5AUJA 3F1WA 1U76A 3G65C 3U61F 3A1JB 1VYMA 5IY4A 5CFKA 1T6LA 3G65A 3GPMA 4YHRA 2IX2C 5E0VA 3WGWA 5A6DA 1DMLA 2Z0LA 1IZ4A 4HK1A 4L6PA
chains in the Genus database with same CATH topology
1IZ5A 3P83A 2IZOB 3A1JC 2HIKB 3HI8A 3VKXA 3V61B 1W60A 2IX2A 3AIZC 4CS5A 1RXZA 5IXAA 3U60F 3HSLX 4D2GA 1PLQA 1B77A 2HIKA 4ZTDA 3GGRB 1ISQA 3A1JA 3A2FB 2OD8A 3AIZA 3P87A 1YYPA 3AIXB 1AXCA 2IZOC 2IJXA 3GGRA 1CZDA 3V60B 2HIKC 3P91A 3IFVA 5B7OA 1SXJF 1GE8A 2NTIB 2HIIB 3GGRC 2ZVLA 2ZVWA 1RWZA 1VYJA 5E0UA 2AWAA 2ZVVA 2ZVMA 2IO4B 2AVTA 2HIIA 3LX2A 5HACA 3V62B 3FDSD 5IWDA 1U7BA 3FDSC 5DA7A 3K4XA 1B8HA 2IO4A 4RJFA 2NTIC 3G65B 3LX1A 2HIIC 3AIXA 3GPNA 3TBLA 4TR6A 1UL1A 5DAIA 3U5ZF 5JNED 1PLRA 1UD9A 2ZVKA 3I2MX 5E0TA 2NTIA 2IX2B 1RXMA 5H0TA 4L60A 5AUJA 3F1WA 1U76A 3G65C 3U61F 3A1JB 1VYMA 5IY4A 5CFKA 1T6LA 3G65A 3GPMA 4YHRA 2IX2C 5E0VA 3WGWA 5A6DA 1DMLA 2Z0LA 1IZ4A 4HK1A 4L6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZ5 A;  3P83 A;  2IZO B;  3A1J C;  2HIK B;  3HI8 A;  3VKX A;  3V61 B;  1W60 A;  2IX2 A;  3AIZ C;  4CS5 A;  1RXZ A;  5IXA A;  3U60 F;  3HSL X;  4D2G A;  1PLQ A;  1B77 A;  2HIK A;  4ZTD A;  3GGR B;  1ISQ A;  3A1J A;  3A2F B;  2OD8 A;  3AIZ A;  3P87 A;  1YYP A;  3AIX B;  1AXC A;  2IZO C;  2IJX A;  3GGR A;  1CZD A;  3V60 B;  2HIK C;  3P91 A;  3IFV A;  5B7O A;  1SXJ F;  1GE8 A;  2NTI B;  2HII B;  3GGR C;  2ZVL A;  2ZVW A;  1RWZ A;  1VYJ A;  5E0U A;  2AWA A;  2ZVV A;  2ZVM A;  2IO4 B;  2AVT A;  2HII A;  3LX2 A;  5HAC A;  3V62 B;  3FDS D;  5IWD A;  1U7B A;  3FDS C;  5DA7 A;  3K4X A;  1B8H A;  2IO4 A;  4RJF A;  2NTI C;  3G65 B;  3LX1 A;  2HII C;  3AIX A;  3GPN A;  3TBL A;  4TR6 A;  1UL1 A;  5DAI A;  3U5Z F;  5JNE D;  1PLR A;  1UD9 A;  2ZVK A;  3I2M X;  5E0T A;  2NTI A;  2IX2 B;  1RXM A;  5H0T A;  4L60 A;  5AUJ A;  3F1W A;  1U76 A;  3G65 C;  3U61 F;  3A1J B;  1VYM A;  5IY4 A;  5CFK A;  1T6L A;  3G65 A;  3GPM A;  4YHR A;  2IX2 C;  5E0V A;  3WGW A;  5A6D A;  1DML A;  2Z0L A;  1IZ4 A;  4HK1 A;  4L6P A; 
#chains in the Genus database with same CATH topology
 1IZ5 A;  3P83 A;  2IZO B;  3A1J C;  2HIK B;  3HI8 A;  3VKX A;  3V61 B;  1W60 A;  2IX2 A;  3AIZ C;  4CS5 A;  1RXZ A;  5IXA A;  3U60 F;  3HSL X;  4D2G A;  1PLQ A;  1B77 A;  2HIK A;  4ZTD A;  3GGR B;  1ISQ A;  3A1J A;  3A2F B;  2OD8 A;  3AIZ A;  3P87 A;  1YYP A;  3AIX B;  1AXC A;  2IZO C;  2IJX A;  3GGR A;  1CZD A;  3V60 B;  2HIK C;  3P91 A;  3IFV A;  5B7O A;  1SXJ F;  1GE8 A;  2NTI B;  2HII B;  3GGR C;  2ZVL A;  2ZVW A;  1RWZ A;  1VYJ A;  5E0U A;  2AWA A;  2ZVV A;  2ZVM A;  2IO4 B;  2AVT A;  2HII A;  3LX2 A;  5HAC A;  3V62 B;  3FDS D;  5IWD A;  1U7B A;  3FDS C;  5DA7 A;  3K4X A;  1B8H A;  2IO4 A;  4RJF A;  2NTI C;  3G65 B;  3LX1 A;  2HII C;  3AIX A;  3GPN A;  3TBL A;  4TR6 A;  1UL1 A;  5DAI A;  3U5Z F;  5JNE D;  1PLR A;  1UD9 A;  2ZVK A;  3I2M X;  5E0T A;  2NTI A;  2IX2 B;  1RXM A;  5H0T A;  4L60 A;  5AUJ A;  3F1W A;  1U76 A;  3G65 C;  3U61 F;  3A1J B;  1VYM A;  5IY4 A;  5CFK A;  1T6L A;  3G65 A;  3GPM A;  4YHR A;  2IX2 C;  5E0V A;  3WGW A;  5A6D A;  1DML A;  2Z0L A;  1IZ4 A;  4HK1 A;  4L6P A; 
#chains in the Genus database with same CATH homology
 1IZ5 A;  3P83 A;  2IZO B;  3A1J C;  2HIK B;  3HI8 A;  3VKX A;  3V61 B;  1W60 A;  2IX2 A;  3AIZ C;  4CS5 A;  1RXZ A;  5IXA A;  3U60 F;  3HSL X;  4D2G A;  1PLQ A;  1B77 A;  2HIK A;  4ZTD A;  3GGR B;  1ISQ A;  3A1J A;  3A2F B;  2OD8 A;  3AIZ A;  3P87 A;  1YYP A;  3AIX B;  1AXC A;  2IZO C;  2IJX A;  3GGR A;  1CZD A;  3V60 B;  2HIK C;  3P91 A;  3IFV A;  5B7O A;  1SXJ F;  1GE8 A;  2NTI B;  2HII B;  3GGR C;  2ZVL A;  2ZVW A;  1RWZ A;  1VYJ A;  5E0U A;  2AWA A;  2ZVV A;  2ZVM A;  2IO4 B;  2AVT A;  2HII A;  3LX2 A;  5HAC A;  3V62 B;  3FDS D;  5IWD A;  1U7B A;  3FDS C;  5DA7 A;  3K4X A;  1B8H A;  2IO4 A;  4RJF A;  2NTI C;  3G65 B;  3LX1 A;  2HII C;  3AIX A;  3GPN A;  3TBL A;  4TR6 A;  1UL1 A;  5DAI A;  3U5Z F;  5JNE D;  1PLR A;  1UD9 A;  2ZVK A;  3I2M X;  5E0T A;  2NTI A;  2IX2 B;  1RXM A;  5H0T A;  4L60 A;  5AUJ A;  3F1W A;  1U76 A;  3G65 C;  3U61 F;  3A1J B;  1VYM A;  5IY4 A;  5CFK A;  1T6L A;  3G65 A;  3GPM A;  4YHR A;  2IX2 C;  5E0V A;  3WGW A;  5A6D A;  1DML A;  2Z0L A;  1IZ4 A;  4HK1 A;  4L6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...