3HI8A

Crystal structure of proliferating cell nuclear antigen (pcna) from haloferax volcanii
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
247
structure length
247
Chain Sequence
MFKAIVSAATLRDALDSVSVLVDECKIRLNEESLSIRAVDPANVGMVDLTLDAAAFESYEAHGGVIGVNLSRLEEVAGMAGAGDLIHLTLDEETRKLNIRIDGLSYTLALIDPDSIRQEPDIPDLDLAANIVLEGTHLDRGIKAADMVSDHIRLRVDGAEETFHIEAEGDTDDVDLSLPPADLISIEAGAADSLFSLDYLKDMNKAIPTDAEVTVELGEEFPVKLHYQIAEGMGTITYMLAPRIQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Proliferating cell nuclear antigen PcnA
publication title Structural insights into the adaptation of proliferating cell nuclear antigen (PCNA) from Haloferax volcanii to a high-salt environment.
pubmed doi rcsb
source organism Haloferax volcanii
total genus 26
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3hi8A00
3V62B 3P83A 2ZVWA 5IY4A 2HIIA 5B7OA 4L6PA 2IX2A 3V61B 3FDSC 2HIKA 2OD8A 1DMLA 3IFVA 3F1WA 3V60B 2IJXA 5A6DA 1RWZA 4RJFA 1IZ5A 3G65A 1VYJA 2ZVLA 1YYPA 4CS5A 3LX2A 1U7BA 1VYMA 1SXJF 5IXAA 2IO4A 3TBLA 3K4XA 3GPNA 4TR6A 3U5ZF 4ZTDA 3LX1A 1RXZA 3VKXA 1B8HA 3A1JA 3WGWA 3P91A 3I2MX 2ZVMA 3P87A 2AVTA 1B77A 2NTIC 3U60F 1ISQA 3AIZC 3AIXA 1UL1A 3GGRA 2HIIC 5DA7A 2NTIB 1IZ4A 2IX2C 2HIKC 1T6LA 1RXMA 5E0UA 4YHRA 2HIIB 1AXCA 2IX2B 3G65C 2HIKB 3FDSD 5CFKA 2IZOC 4L60A 5HACA 5JNED 5IWDA 4HK1A 3G65B 2ZVVA 3A1JC 1U76A 2ZVKA 3U61F 2IZOB 2IO4B 3AIZA 1GE8A 1W60A 1PLRA 4D2GA 2Z0LA 1UD9A 3A1JB 2AWAA 3GGRC 3HSLX 5H0TA 3A2FB 5AUJA 3HI8A 5DAIA 5E0VA 1PLQA 3GPMA 3AIXB 3GGRB 1CZDA 5E0TA 2NTIA
chains in the Genus database with same CATH superfamily
3V62B 3P83A 2ZVWA 5IY4A 2HIIA 5B7OA 4L6PA 2IX2A 3V61B 3FDSC 2HIKA 2OD8A 1DMLA 3IFVA 3F1WA 3V60B 2IJXA 5A6DA 1RWZA 4RJFA 1IZ5A 3G65A 1VYJA 2ZVLA 1YYPA 4CS5A 3LX2A 1U7BA 1VYMA 1SXJF 5IXAA 2IO4A 3TBLA 3K4XA 3GPNA 4TR6A 3U5ZF 4ZTDA 3LX1A 1RXZA 3VKXA 1B8HA 3A1JA 3WGWA 3P91A 3I2MX 2ZVMA 3P87A 2AVTA 1B77A 2NTIC 3U60F 1ISQA 3AIZC 3AIXA 1UL1A 3GGRA 2HIIC 5DA7A 2NTIB 1IZ4A 2IX2C 2HIKC 1T6LA 1RXMA 5E0UA 4YHRA 2HIIB 1AXCA 2IX2B 3G65C 2HIKB 3FDSD 5CFKA 2IZOC 4L60A 5HACA 5JNED 5IWDA 4HK1A 3G65B 2ZVVA 3A1JC 1U76A 2ZVKA 3U61F 2IZOB 2IO4B 3AIZA 1GE8A 1W60A 1PLRA 4D2GA 2Z0LA 1UD9A 3A1JB 2AWAA 3GGRC 3HSLX 5H0TA 3A2FB 5AUJA 3HI8A 5DAIA 5E0VA 1PLQA 3GPMA 3AIXB 3GGRB 1CZDA 5E0TA 2NTIA
chains in the Genus database with same CATH topology
3V62B 3P83A 2ZVWA 5IY4A 2HIIA 5B7OA 4L6PA 2IX2A 3V61B 3FDSC 2HIKA 2OD8A 1DMLA 3IFVA 3F1WA 3V60B 2IJXA 5A6DA 1RWZA 4RJFA 1IZ5A 3G65A 1VYJA 2ZVLA 1YYPA 4CS5A 3LX2A 1U7BA 1VYMA 1SXJF 5IXAA 2IO4A 3TBLA 3K4XA 3GPNA 4TR6A 3U5ZF 4ZTDA 3LX1A 1RXZA 3VKXA 1B8HA 3A1JA 3WGWA 3P91A 3I2MX 2ZVMA 3P87A 2AVTA 1B77A 2NTIC 3U60F 1ISQA 3AIZC 3AIXA 1UL1A 3GGRA 2HIIC 5DA7A 2NTIB 1IZ4A 2IX2C 2HIKC 1T6LA 1RXMA 5E0UA 4YHRA 2HIIB 1AXCA 2IX2B 3G65C 2HIKB 3FDSD 5CFKA 2IZOC 4L60A 5HACA 5JNED 5IWDA 4HK1A 3G65B 2ZVVA 3A1JC 1U76A 2ZVKA 3U61F 2IZOB 2IO4B 3AIZA 1GE8A 1W60A 1PLRA 4D2GA 2Z0LA 1UD9A 3A1JB 2AWAA 3GGRC 3HSLX 5H0TA 3A2FB 5AUJA 3HI8A 5DAIA 5E0VA 1PLQA 3GPMA 3AIXB 3GGRB 1CZDA 5E0TA 2NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V62 B;  3P83 A;  2ZVW A;  5IY4 A;  2HII A;  5B7O A;  4L6P A;  2IX2 A;  3V61 B;  3FDS C;  2HIK A;  2OD8 A;  1DML A;  3IFV A;  3F1W A;  3V60 B;  2IJX A;  5A6D A;  1RWZ A;  4RJF A;  1IZ5 A;  3G65 A;  1VYJ A;  2ZVL A;  1YYP A;  4CS5 A;  3LX2 A;  1U7B A;  1VYM A;  1SXJ F;  5IXA A;  2IO4 A;  3TBL A;  3K4X A;  3GPN A;  4TR6 A;  3U5Z F;  4ZTD A;  3LX1 A;  1RXZ A;  3VKX A;  1B8H A;  3A1J A;  3WGW A;  3P91 A;  3I2M X;  2ZVM A;  3P87 A;  2AVT A;  1B77 A;  2NTI C;  3U60 F;  1ISQ A;  3AIZ C;  3AIX A;  1UL1 A;  3GGR A;  2HII C;  5DA7 A;  2NTI B;  1IZ4 A;  2IX2 C;  2HIK C;  1T6L A;  1RXM A;  5E0U A;  4YHR A;  2HII B;  1AXC A;  2IX2 B;  3G65 C;  2HIK B;  3FDS D;  5CFK A;  2IZO C;  4L60 A;  5HAC A;  5JNE D;  5IWD A;  4HK1 A;  3G65 B;  2ZVV A;  3A1J C;  1U76 A;  2ZVK A;  3U61 F;  2IZO B;  2IO4 B;  3AIZ A;  1GE8 A;  1W60 A;  1PLR A;  4D2G A;  2Z0L A;  1UD9 A;  3A1J B;  2AWA A;  3GGR C;  3HSL X;  5H0T A;  3A2F B;  5AUJ A;  3HI8 A;  5DAI A;  5E0V A;  1PLQ A;  3GPM A;  3AIX B;  3GGR B;  1CZD A;  5E0T A;  2NTI A; 
#chains in the Genus database with same CATH topology
 3V62 B;  3P83 A;  2ZVW A;  5IY4 A;  2HII A;  5B7O A;  4L6P A;  2IX2 A;  3V61 B;  3FDS C;  2HIK A;  2OD8 A;  1DML A;  3IFV A;  3F1W A;  3V60 B;  2IJX A;  5A6D A;  1RWZ A;  4RJF A;  1IZ5 A;  3G65 A;  1VYJ A;  2ZVL A;  1YYP A;  4CS5 A;  3LX2 A;  1U7B A;  1VYM A;  1SXJ F;  5IXA A;  2IO4 A;  3TBL A;  3K4X A;  3GPN A;  4TR6 A;  3U5Z F;  4ZTD A;  3LX1 A;  1RXZ A;  3VKX A;  1B8H A;  3A1J A;  3WGW A;  3P91 A;  3I2M X;  2ZVM A;  3P87 A;  2AVT A;  1B77 A;  2NTI C;  3U60 F;  1ISQ A;  3AIZ C;  3AIX A;  1UL1 A;  3GGR A;  2HII C;  5DA7 A;  2NTI B;  1IZ4 A;  2IX2 C;  2HIK C;  1T6L A;  1RXM A;  5E0U A;  4YHR A;  2HII B;  1AXC A;  2IX2 B;  3G65 C;  2HIK B;  3FDS D;  5CFK A;  2IZO C;  4L60 A;  5HAC A;  5JNE D;  5IWD A;  4HK1 A;  3G65 B;  2ZVV A;  3A1J C;  1U76 A;  2ZVK A;  3U61 F;  2IZO B;  2IO4 B;  3AIZ A;  1GE8 A;  1W60 A;  1PLR A;  4D2G A;  2Z0L A;  1UD9 A;  3A1J B;  2AWA A;  3GGR C;  3HSL X;  5H0T A;  3A2F B;  5AUJ A;  3HI8 A;  5DAI A;  5E0V A;  1PLQ A;  3GPM A;  3AIX B;  3GGR B;  1CZD A;  5E0T A;  2NTI A; 
#chains in the Genus database with same CATH homology
 3V62 B;  3P83 A;  2ZVW A;  5IY4 A;  2HII A;  5B7O A;  4L6P A;  2IX2 A;  3V61 B;  3FDS C;  2HIK A;  2OD8 A;  1DML A;  3IFV A;  3F1W A;  3V60 B;  2IJX A;  5A6D A;  1RWZ A;  4RJF A;  1IZ5 A;  3G65 A;  1VYJ A;  2ZVL A;  1YYP A;  4CS5 A;  3LX2 A;  1U7B A;  1VYM A;  1SXJ F;  5IXA A;  2IO4 A;  3TBL A;  3K4X A;  3GPN A;  4TR6 A;  3U5Z F;  4ZTD A;  3LX1 A;  1RXZ A;  3VKX A;  1B8H A;  3A1J A;  3WGW A;  3P91 A;  3I2M X;  2ZVM A;  3P87 A;  2AVT A;  1B77 A;  2NTI C;  3U60 F;  1ISQ A;  3AIZ C;  3AIX A;  1UL1 A;  3GGR A;  2HII C;  5DA7 A;  2NTI B;  1IZ4 A;  2IX2 C;  2HIK C;  1T6L A;  1RXM A;  5E0U A;  4YHR A;  2HII B;  1AXC A;  2IX2 B;  3G65 C;  2HIK B;  3FDS D;  5CFK A;  2IZO C;  4L60 A;  5HAC A;  5JNE D;  5IWD A;  4HK1 A;  3G65 B;  2ZVV A;  3A1J C;  1U76 A;  2ZVK A;  3U61 F;  2IZO B;  2IO4 B;  3AIZ A;  1GE8 A;  1W60 A;  1PLR A;  4D2G A;  2Z0L A;  1UD9 A;  3A1J B;  2AWA A;  3GGR C;  3HSL X;  5H0T A;  3A2F B;  5AUJ A;  3HI8 A;  5DAI A;  5E0V A;  1PLQ A;  3GPM A;  3AIX B;  3GGR B;  1CZD A;  5E0T A;  2NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...