3IFVA

Crystal structure of the haloferax volcanii proliferating cell nuclear antigen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
242
structure length
216
Chain Sequence
FKAIVSAATLRDALDSVSVLVDECKIRESLSIRAVDPANVGMVDLTLDAAAFESYVIGVNLSRLEEVAGMALIHLTLNIRIDGLSYTLDPDSPDIPDLDLAANIVLEGTHLDRGIKAADMVSDHIRLRVDGAEETFHIEAEGDTDDVDLSLPPADLISIEAGAADSLFSLDYLKDMNKAIPTDAEVTVELGEEFPVKLHYQIAEGMGTITYMLAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords PCNA
publication title The crystal structure of Haloferax volcanii proliferating cell nuclear antigen reveals unique surface charge characteristics due to halophilic adaptation
pubmed doi rcsb
source organism Haloferax volcanii
total genus 51
structure length 216
sequence length 242
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3ifvA00
3G65C 4D2GA 2IJXA 3U60F 1VYJA 2Z0LA 1SXJF 5IWDA 3K4XA 2NTIA 3P91A 5E0UA 3GGRB 1DMLA 4RJFA 3P83A 2ZVMA 3AIZC 2OD8A 3FDSC 3LX1A 2IX2A 1RXZA 3GPNA 4YHRA 2HIKC 1T6LA 2ZVWA 5A6DA 1YYPA 2AVTA 1CZDA 3WGWA 3A1JC 3V62B 5IY4A 2IO4B 3U5ZF 1W60A 2HIIA 3G65A 1IZ5A 1B77A 3GGRC 2AWAA 1RXMA 3IFVA 5IXAA 1B8HA 2IX2B 3U61F 5JNED 3HSLX 2ZVKA 3I2MX 3AIZA 4ZTDA 4L6PA 2ZVVA 1IZ4A 3V61B 3GGRA 2ZVLA 3GPMA 2NTIB 5E0VA 1GE8A 3AIXA 2HIKA 3A2FB 1PLQA 4TR6A 1UD9A 3G65B 4HK1A 3LX2A 2IZOB 1AXCA 4L60A 4CS5A 1ISQA 3A1JA 3F1WA 3FDSD 5E0TA 5H0TA 1RWZA 2IZOC 3P87A 5AUJA 2IX2C 2IO4A 1U76A 3VKXA 5DA7A 3AIXB 2HIKB 5HACA 5B7OA 3HI8A 2HIIB 1VYMA 1UL1A 1PLRA 1U7BA 3TBLA 2NTIC 5DAIA 5CFKA 3A1JB 2HIIC 3V60B
chains in the Genus database with same CATH superfamily
3G65C 4D2GA 2IJXA 3U60F 1VYJA 2Z0LA 1SXJF 5IWDA 3K4XA 2NTIA 3P91A 5E0UA 3GGRB 1DMLA 4RJFA 3P83A 2ZVMA 3AIZC 2OD8A 3FDSC 3LX1A 2IX2A 1RXZA 3GPNA 4YHRA 2HIKC 1T6LA 2ZVWA 5A6DA 1YYPA 2AVTA 1CZDA 3WGWA 3A1JC 3V62B 5IY4A 2IO4B 3U5ZF 1W60A 2HIIA 3G65A 1IZ5A 1B77A 3GGRC 2AWAA 1RXMA 3IFVA 5IXAA 1B8HA 2IX2B 3U61F 5JNED 3HSLX 2ZVKA 3I2MX 3AIZA 4ZTDA 4L6PA 2ZVVA 1IZ4A 3V61B 3GGRA 2ZVLA 3GPMA 2NTIB 5E0VA 1GE8A 3AIXA 2HIKA 3A2FB 1PLQA 4TR6A 1UD9A 3G65B 4HK1A 3LX2A 2IZOB 1AXCA 4L60A 4CS5A 1ISQA 3A1JA 3F1WA 3FDSD 5E0TA 5H0TA 1RWZA 2IZOC 3P87A 5AUJA 2IX2C 2IO4A 1U76A 3VKXA 5DA7A 3AIXB 2HIKB 5HACA 5B7OA 3HI8A 2HIIB 1VYMA 1UL1A 1PLRA 1U7BA 3TBLA 2NTIC 5DAIA 5CFKA 3A1JB 2HIIC 3V60B
chains in the Genus database with same CATH topology
3G65C 4D2GA 2IJXA 3U60F 1VYJA 2Z0LA 1SXJF 5IWDA 3K4XA 2NTIA 3P91A 5E0UA 3GGRB 1DMLA 4RJFA 3P83A 2ZVMA 3AIZC 2OD8A 3FDSC 3LX1A 2IX2A 1RXZA 3GPNA 4YHRA 2HIKC 1T6LA 2ZVWA 5A6DA 1YYPA 2AVTA 1CZDA 3WGWA 3A1JC 3V62B 5IY4A 2IO4B 3U5ZF 1W60A 2HIIA 3G65A 1IZ5A 1B77A 3GGRC 2AWAA 1RXMA 3IFVA 5IXAA 1B8HA 2IX2B 3U61F 5JNED 3HSLX 2ZVKA 3I2MX 3AIZA 4ZTDA 4L6PA 2ZVVA 1IZ4A 3V61B 3GGRA 2ZVLA 3GPMA 2NTIB 5E0VA 1GE8A 3AIXA 2HIKA 3A2FB 1PLQA 4TR6A 1UD9A 3G65B 4HK1A 3LX2A 2IZOB 1AXCA 4L60A 4CS5A 1ISQA 3A1JA 3F1WA 3FDSD 5E0TA 5H0TA 1RWZA 2IZOC 3P87A 5AUJA 2IX2C 2IO4A 1U76A 3VKXA 5DA7A 3AIXB 2HIKB 5HACA 5B7OA 3HI8A 2HIIB 1VYMA 1UL1A 1PLRA 1U7BA 3TBLA 2NTIC 5DAIA 5CFKA 3A1JB 2HIIC 3V60B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G65 C;  4D2G A;  2IJX A;  3U60 F;  1VYJ A;  2Z0L A;  1SXJ F;  5IWD A;  3K4X A;  2NTI A;  3P91 A;  5E0U A;  3GGR B;  1DML A;  4RJF A;  3P83 A;  2ZVM A;  3AIZ C;  2OD8 A;  3FDS C;  3LX1 A;  2IX2 A;  1RXZ A;  3GPN A;  4YHR A;  2HIK C;  1T6L A;  2ZVW A;  5A6D A;  1YYP A;  2AVT A;  1CZD A;  3WGW A;  3A1J C;  3V62 B;  5IY4 A;  2IO4 B;  3U5Z F;  1W60 A;  2HII A;  3G65 A;  1IZ5 A;  1B77 A;  3GGR C;  2AWA A;  1RXM A;  3IFV A;  5IXA A;  1B8H A;  2IX2 B;  3U61 F;  5JNE D;  3HSL X;  2ZVK A;  3I2M X;  3AIZ A;  4ZTD A;  4L6P A;  2ZVV A;  1IZ4 A;  3V61 B;  3GGR A;  2ZVL A;  3GPM A;  2NTI B;  5E0V A;  1GE8 A;  3AIX A;  2HIK A;  3A2F B;  1PLQ A;  4TR6 A;  1UD9 A;  3G65 B;  4HK1 A;  3LX2 A;  2IZO B;  1AXC A;  4L60 A;  4CS5 A;  1ISQ A;  3A1J A;  3F1W A;  3FDS D;  5E0T A;  5H0T A;  1RWZ A;  2IZO C;  3P87 A;  5AUJ A;  2IX2 C;  2IO4 A;  1U76 A;  3VKX A;  5DA7 A;  3AIX B;  2HIK B;  5HAC A;  5B7O A;  3HI8 A;  2HII B;  1VYM A;  1UL1 A;  1PLR A;  1U7B A;  3TBL A;  2NTI C;  5DAI A;  5CFK A;  3A1J B;  2HII C;  3V60 B; 
#chains in the Genus database with same CATH topology
 3G65 C;  4D2G A;  2IJX A;  3U60 F;  1VYJ A;  2Z0L A;  1SXJ F;  5IWD A;  3K4X A;  2NTI A;  3P91 A;  5E0U A;  3GGR B;  1DML A;  4RJF A;  3P83 A;  2ZVM A;  3AIZ C;  2OD8 A;  3FDS C;  3LX1 A;  2IX2 A;  1RXZ A;  3GPN A;  4YHR A;  2HIK C;  1T6L A;  2ZVW A;  5A6D A;  1YYP A;  2AVT A;  1CZD A;  3WGW A;  3A1J C;  3V62 B;  5IY4 A;  2IO4 B;  3U5Z F;  1W60 A;  2HII A;  3G65 A;  1IZ5 A;  1B77 A;  3GGR C;  2AWA A;  1RXM A;  3IFV A;  5IXA A;  1B8H A;  2IX2 B;  3U61 F;  5JNE D;  3HSL X;  2ZVK A;  3I2M X;  3AIZ A;  4ZTD A;  4L6P A;  2ZVV A;  1IZ4 A;  3V61 B;  3GGR A;  2ZVL A;  3GPM A;  2NTI B;  5E0V A;  1GE8 A;  3AIX A;  2HIK A;  3A2F B;  1PLQ A;  4TR6 A;  1UD9 A;  3G65 B;  4HK1 A;  3LX2 A;  2IZO B;  1AXC A;  4L60 A;  4CS5 A;  1ISQ A;  3A1J A;  3F1W A;  3FDS D;  5E0T A;  5H0T A;  1RWZ A;  2IZO C;  3P87 A;  5AUJ A;  2IX2 C;  2IO4 A;  1U76 A;  3VKX A;  5DA7 A;  3AIX B;  2HIK B;  5HAC A;  5B7O A;  3HI8 A;  2HII B;  1VYM A;  1UL1 A;  1PLR A;  1U7B A;  3TBL A;  2NTI C;  5DAI A;  5CFK A;  3A1J B;  2HII C;  3V60 B; 
#chains in the Genus database with same CATH homology
 3G65 C;  4D2G A;  2IJX A;  3U60 F;  1VYJ A;  2Z0L A;  1SXJ F;  5IWD A;  3K4X A;  2NTI A;  3P91 A;  5E0U A;  3GGR B;  1DML A;  4RJF A;  3P83 A;  2ZVM A;  3AIZ C;  2OD8 A;  3FDS C;  3LX1 A;  2IX2 A;  1RXZ A;  3GPN A;  4YHR A;  2HIK C;  1T6L A;  2ZVW A;  5A6D A;  1YYP A;  2AVT A;  1CZD A;  3WGW A;  3A1J C;  3V62 B;  5IY4 A;  2IO4 B;  3U5Z F;  1W60 A;  2HII A;  3G65 A;  1IZ5 A;  1B77 A;  3GGR C;  2AWA A;  1RXM A;  3IFV A;  5IXA A;  1B8H A;  2IX2 B;  3U61 F;  5JNE D;  3HSL X;  2ZVK A;  3I2M X;  3AIZ A;  4ZTD A;  4L6P A;  2ZVV A;  1IZ4 A;  3V61 B;  3GGR A;  2ZVL A;  3GPM A;  2NTI B;  5E0V A;  1GE8 A;  3AIX A;  2HIK A;  3A2F B;  1PLQ A;  4TR6 A;  1UD9 A;  3G65 B;  4HK1 A;  3LX2 A;  2IZO B;  1AXC A;  4L60 A;  4CS5 A;  1ISQ A;  3A1J A;  3F1W A;  3FDS D;  5E0T A;  5H0T A;  1RWZ A;  2IZO C;  3P87 A;  5AUJ A;  2IX2 C;  2IO4 A;  1U76 A;  3VKX A;  5DA7 A;  3AIX B;  2HIK B;  5HAC A;  5B7O A;  3HI8 A;  2HII B;  1VYM A;  1UL1 A;  1PLR A;  1U7B A;  3TBL A;  2NTI C;  5DAI A;  5CFK A;  3A1J B;  2HII C;  3V60 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...