3K4XA

Eukaryotic sliding clamp pcna bound to dna
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
786
structure length
758
Chain Sequence
LEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Proliferating cell nuclear antigen
publication title Analysis of the role of PCNA-DNA contacts during clamp loading.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 184
structure length 758
sequence length 786
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3k4xA02
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3k4xA01
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3k4xA03
5JNED 5HACA 2IO4B 5B7OA 2HIIA 3GPNA 3V60B 4TR6A 4L6PA 2HIKB 5A6DA 4HK1A 1DMLA 2ZVMA 3WGWA 2IX2B 3G65A 1U76A 5IWDA 4L60A 1YYPA 2OD8A 2IZOC 3U5ZF 2ZVVA 5E0TA 1RWZA 1CZDA 3G65C 1PLRA 3AIXB 3V62B 5E0UA 3P83A 3V61B 2NTIA 2AVTA 2HIIC 3F1WA 5AUJA 2IX2A 2IZOB 2ZVWA 3IFVA 3A1JA 3LX1A 3GGRA 5CFKA 3K4XA 5DAIA 2AWAA 2NTIC 4D2GA 2IO4A 3G65B 1IZ5A 1UD9A 3A2FB 3FDSC 1SXJF 1GE8A 3A1JC 3AIZA 4ZTDA 2HIKA 1W60A 3GGRC 1RXMA 3TBLA 1T6LA 5IY4A 1B77A 3VKXA 1UL1A 1AXCA 5IXAA 2ZVLA 1IZ4A 2HIIB 2ZVKA 2IJXA 1PLQA 1U7BA 3AIZC 1VYJA 2HIKC 3HSLX 3P91A 5E0VA 5DA7A 4RJFA 4YHRA 2IX2C 2NTIB 1RXZA 1ISQA 1VYMA 2Z0LA 3AIXA 3U61F 3GPMA 3U60F 3P87A 3LX2A 3A1JB 1B8HA 3GGRB 3HI8A 4CS5A 3FDSD 5H0TA 3I2MX
chains in the Genus database with same CATH superfamily
5JNED 5HACA 2IO4B 5B7OA 2HIIA 3GPNA 3V60B 4TR6A 4L6PA 2HIKB 5A6DA 4HK1A 1DMLA 2ZVMA 3WGWA 2IX2B 3G65A 1U76A 5IWDA 4L60A 1YYPA 2OD8A 2IZOC 3U5ZF 2ZVVA 5E0TA 1RWZA 1CZDA 3G65C 1PLRA 3AIXB 3V62B 5E0UA 3P83A 3V61B 2NTIA 2AVTA 2HIIC 3F1WA 5AUJA 2IX2A 2IZOB 2ZVWA 3IFVA 3A1JA 3LX1A 3GGRA 5CFKA 3K4XA 5DAIA 2AWAA 2NTIC 4D2GA 2IO4A 3G65B 1IZ5A 1UD9A 3A2FB 3FDSC 1SXJF 1GE8A 3A1JC 3AIZA 4ZTDA 2HIKA 1W60A 3GGRC 1RXMA 3TBLA 1T6LA 5IY4A 1B77A 3VKXA 1UL1A 1AXCA 5IXAA 2ZVLA 1IZ4A 2HIIB 2ZVKA 2IJXA 1PLQA 1U7BA 3AIZC 1VYJA 2HIKC 3HSLX 3P91A 5E0VA 5DA7A 4RJFA 4YHRA 2IX2C 2NTIB 1RXZA 1ISQA 1VYMA 2Z0LA 3AIXA 3U61F 3GPMA 3U60F 3P87A 3LX2A 3A1JB 1B8HA 3GGRB 3HI8A 4CS5A 3FDSD 5H0TA 3I2MX
chains in the Genus database with same CATH topology
5JNED 5HACA 2IO4B 5B7OA 2HIIA 3GPNA 3V60B 4TR6A 4L6PA 2HIKB 5A6DA 4HK1A 1DMLA 2ZVMA 3WGWA 2IX2B 3G65A 1U76A 5IWDA 4L60A 1YYPA 2OD8A 2IZOC 3U5ZF 2ZVVA 5E0TA 1RWZA 1CZDA 3G65C 1PLRA 3AIXB 3V62B 5E0UA 3P83A 3V61B 2NTIA 2AVTA 2HIIC 3F1WA 5AUJA 2IX2A 2IZOB 2ZVWA 3IFVA 3A1JA 3LX1A 3GGRA 5CFKA 3K4XA 5DAIA 2AWAA 2NTIC 4D2GA 2IO4A 3G65B 1IZ5A 1UD9A 3A2FB 3FDSC 1SXJF 1GE8A 3A1JC 3AIZA 4ZTDA 2HIKA 1W60A 3GGRC 1RXMA 3TBLA 1T6LA 5IY4A 1B77A 3VKXA 1UL1A 1AXCA 5IXAA 2ZVLA 1IZ4A 2HIIB 2ZVKA 2IJXA 1PLQA 1U7BA 3AIZC 1VYJA 2HIKC 3HSLX 3P91A 5E0VA 5DA7A 4RJFA 4YHRA 2IX2C 2NTIB 1RXZA 1ISQA 1VYMA 2Z0LA 3AIXA 3U61F 3GPMA 3U60F 3P87A 3LX2A 3A1JB 1B8HA 3GGRB 3HI8A 4CS5A 3FDSD 5H0TA 3I2MX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JNE D;  5HAC A;  2IO4 B;  5B7O A;  2HII A;  3GPN A;  3V60 B;  4TR6 A;  4L6P A;  2HIK B;  5A6D A;  4HK1 A;  1DML A;  2ZVM A;  3WGW A;  2IX2 B;  3G65 A;  1U76 A;  5IWD A;  4L60 A;  1YYP A;  2OD8 A;  2IZO C;  3U5Z F;  2ZVV A;  5E0T A;  1RWZ A;  1CZD A;  3G65 C;  1PLR A;  3AIX B;  3V62 B;  5E0U A;  3P83 A;  3V61 B;  2NTI A;  2AVT A;  2HII C;  3F1W A;  5AUJ A;  2IX2 A;  2IZO B;  2ZVW A;  3IFV A;  3A1J A;  3LX1 A;  3GGR A;  5CFK A;  3K4X A;  5DAI A;  2AWA A;  2NTI C;  4D2G A;  2IO4 A;  3G65 B;  1IZ5 A;  1UD9 A;  3A2F B;  3FDS C;  1SXJ F;  1GE8 A;  3A1J C;  3AIZ A;  4ZTD A;  2HIK A;  1W60 A;  3GGR C;  1RXM A;  3TBL A;  1T6L A;  5IY4 A;  1B77 A;  3VKX A;  1UL1 A;  1AXC A;  5IXA A;  2ZVL A;  1IZ4 A;  2HII B;  2ZVK A;  2IJX A;  1PLQ A;  1U7B A;  3AIZ C;  1VYJ A;  2HIK C;  3HSL X;  3P91 A;  5E0V A;  5DA7 A;  4RJF A;  4YHR A;  2IX2 C;  2NTI B;  1RXZ A;  1ISQ A;  1VYM A;  2Z0L A;  3AIX A;  3U61 F;  3GPM A;  3U60 F;  3P87 A;  3LX2 A;  3A1J B;  1B8H A;  3GGR B;  3HI8 A;  4CS5 A;  3FDS D;  5H0T A;  3I2M X; 
#chains in the Genus database with same CATH topology
 5JNE D;  5HAC A;  2IO4 B;  5B7O A;  2HII A;  3GPN A;  3V60 B;  4TR6 A;  4L6P A;  2HIK B;  5A6D A;  4HK1 A;  1DML A;  2ZVM A;  3WGW A;  2IX2 B;  3G65 A;  1U76 A;  5IWD A;  4L60 A;  1YYP A;  2OD8 A;  2IZO C;  3U5Z F;  2ZVV A;  5E0T A;  1RWZ A;  1CZD A;  3G65 C;  1PLR A;  3AIX B;  3V62 B;  5E0U A;  3P83 A;  3V61 B;  2NTI A;  2AVT A;  2HII C;  3F1W A;  5AUJ A;  2IX2 A;  2IZO B;  2ZVW A;  3IFV A;  3A1J A;  3LX1 A;  3GGR A;  5CFK A;  3K4X A;  5DAI A;  2AWA A;  2NTI C;  4D2G A;  2IO4 A;  3G65 B;  1IZ5 A;  1UD9 A;  3A2F B;  3FDS C;  1SXJ F;  1GE8 A;  3A1J C;  3AIZ A;  4ZTD A;  2HIK A;  1W60 A;  3GGR C;  1RXM A;  3TBL A;  1T6L A;  5IY4 A;  1B77 A;  3VKX A;  1UL1 A;  1AXC A;  5IXA A;  2ZVL A;  1IZ4 A;  2HII B;  2ZVK A;  2IJX A;  1PLQ A;  1U7B A;  3AIZ C;  1VYJ A;  2HIK C;  3HSL X;  3P91 A;  5E0V A;  5DA7 A;  4RJF A;  4YHR A;  2IX2 C;  2NTI B;  1RXZ A;  1ISQ A;  1VYM A;  2Z0L A;  3AIX A;  3U61 F;  3GPM A;  3U60 F;  3P87 A;  3LX2 A;  3A1J B;  1B8H A;  3GGR B;  3HI8 A;  4CS5 A;  3FDS D;  5H0T A;  3I2M X; 
#chains in the Genus database with same CATH homology
 5JNE D;  5HAC A;  2IO4 B;  5B7O A;  2HII A;  3GPN A;  3V60 B;  4TR6 A;  4L6P A;  2HIK B;  5A6D A;  4HK1 A;  1DML A;  2ZVM A;  3WGW A;  2IX2 B;  3G65 A;  1U76 A;  5IWD A;  4L60 A;  1YYP A;  2OD8 A;  2IZO C;  3U5Z F;  2ZVV A;  5E0T A;  1RWZ A;  1CZD A;  3G65 C;  1PLR A;  3AIX B;  3V62 B;  5E0U A;  3P83 A;  3V61 B;  2NTI A;  2AVT A;  2HII C;  3F1W A;  5AUJ A;  2IX2 A;  2IZO B;  2ZVW A;  3IFV A;  3A1J A;  3LX1 A;  3GGR A;  5CFK A;  3K4X A;  5DAI A;  2AWA A;  2NTI C;  4D2G A;  2IO4 A;  3G65 B;  1IZ5 A;  1UD9 A;  3A2F B;  3FDS C;  1SXJ F;  1GE8 A;  3A1J C;  3AIZ A;  4ZTD A;  2HIK A;  1W60 A;  3GGR C;  1RXM A;  3TBL A;  1T6L A;  5IY4 A;  1B77 A;  3VKX A;  1UL1 A;  1AXC A;  5IXA A;  2ZVL A;  1IZ4 A;  2HII B;  2ZVK A;  2IJX A;  1PLQ A;  1U7B A;  3AIZ C;  1VYJ A;  2HIK C;  3HSL X;  3P91 A;  5E0V A;  5DA7 A;  4RJF A;  4YHR A;  2IX2 C;  2NTI B;  1RXZ A;  1ISQ A;  1VYM A;  2Z0L A;  3AIX A;  3U61 F;  3GPM A;  3U60 F;  3P87 A;  3LX2 A;  3A1J B;  1B8H A;  3GGR B;  3HI8 A;  4CS5 A;  3FDS D;  5H0T A;  3I2M X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...