3P87A

Structure of human pcna bound to rnaseh2b pip box peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
256
structure length
245
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDDTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title PCNA directs type 2 RNase H activity on DNA replication and repair substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 245
sequence length 256
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3p87A00
3U60F 5E0VA 3AIXB 2ZVVA 3A1JB 1CZDA 2NTIA 4L60A 5CFKA 3V61B 3GGRB 3FDSD 1VYMA 5HACA 5B7OA 3K4XA 3P83A 3AIZA 5A6DA 2NTIC 3U61F 2IX2A 4L6PA 3FDSC 2HIIA 2OD8A 2IO4B 3IFVA 3AIZC 1RXZA 3A2FB 2IX2C 2ZVKA 2HIIC 3P87A 4RJFA 3VKXA 5IWDA 1IZ5A 2HIKA 3G65B 3P91A 1UL1A 2ZVWA 2AVTA 3U5ZF 2HIKC 1GE8A 3I2MX 3HI8A 1RXMA 5E0UA 3AIXA 5AUJA 1VYJA 3A1JA 3F1WA 2IZOC 5H0TA 3TBLA 1IZ4A 5JNED 3GGRA 2NTIB 3V62B 4TR6A 3GPMA 3V60B 1AXCA 2Z0LA 5DA7A 3A1JC 2ZVLA 1SXJF 2IX2B 2IZOB 1U7BA 2IO4A 2HIIB 1ISQA 1B8HA 2IJXA 2ZVMA 5DAIA 2AWAA 1W60A 3LX2A 1T6LA 1RWZA 1B77A 3HSLX 3GPNA 1U76A 4HK1A 1YYPA 4YHRA 3G65A 1UD9A 2HIKB 4D2GA 1DMLA 1PLQA 3GGRC 5E0TA 5IY4A 3G65C 5IXAA 3WGWA 1PLRA 4CS5A 4ZTDA 3LX1A
chains in the Genus database with same CATH superfamily
3U60F 5E0VA 3AIXB 2ZVVA 3A1JB 1CZDA 2NTIA 4L60A 5CFKA 3V61B 3GGRB 3FDSD 1VYMA 5HACA 5B7OA 3K4XA 3P83A 3AIZA 5A6DA 2NTIC 3U61F 2IX2A 4L6PA 3FDSC 2HIIA 2OD8A 2IO4B 3IFVA 3AIZC 1RXZA 3A2FB 2IX2C 2ZVKA 2HIIC 3P87A 4RJFA 3VKXA 5IWDA 1IZ5A 2HIKA 3G65B 3P91A 1UL1A 2ZVWA 2AVTA 3U5ZF 2HIKC 1GE8A 3I2MX 3HI8A 1RXMA 5E0UA 3AIXA 5AUJA 1VYJA 3A1JA 3F1WA 2IZOC 5H0TA 3TBLA 1IZ4A 5JNED 3GGRA 2NTIB 3V62B 4TR6A 3GPMA 3V60B 1AXCA 2Z0LA 5DA7A 3A1JC 2ZVLA 1SXJF 2IX2B 2IZOB 1U7BA 2IO4A 2HIIB 1ISQA 1B8HA 2IJXA 2ZVMA 5DAIA 2AWAA 1W60A 3LX2A 1T6LA 1RWZA 1B77A 3HSLX 3GPNA 1U76A 4HK1A 1YYPA 4YHRA 3G65A 1UD9A 2HIKB 4D2GA 1DMLA 1PLQA 3GGRC 5E0TA 5IY4A 3G65C 5IXAA 3WGWA 1PLRA 4CS5A 4ZTDA 3LX1A
chains in the Genus database with same CATH topology
3U60F 5E0VA 3AIXB 2ZVVA 3A1JB 1CZDA 2NTIA 4L60A 5CFKA 3V61B 3GGRB 3FDSD 1VYMA 5HACA 5B7OA 3K4XA 3P83A 3AIZA 5A6DA 2NTIC 3U61F 2IX2A 4L6PA 3FDSC 2HIIA 2OD8A 2IO4B 3IFVA 3AIZC 1RXZA 3A2FB 2IX2C 2ZVKA 2HIIC 3P87A 4RJFA 3VKXA 5IWDA 1IZ5A 2HIKA 3G65B 3P91A 1UL1A 2ZVWA 2AVTA 3U5ZF 2HIKC 1GE8A 3I2MX 3HI8A 1RXMA 5E0UA 3AIXA 5AUJA 1VYJA 3A1JA 3F1WA 2IZOC 5H0TA 3TBLA 1IZ4A 5JNED 3GGRA 2NTIB 3V62B 4TR6A 3GPMA 3V60B 1AXCA 2Z0LA 5DA7A 3A1JC 2ZVLA 1SXJF 2IX2B 2IZOB 1U7BA 2IO4A 2HIIB 1ISQA 1B8HA 2IJXA 2ZVMA 5DAIA 2AWAA 1W60A 3LX2A 1T6LA 1RWZA 1B77A 3HSLX 3GPNA 1U76A 4HK1A 1YYPA 4YHRA 3G65A 1UD9A 2HIKB 4D2GA 1DMLA 1PLQA 3GGRC 5E0TA 5IY4A 3G65C 5IXAA 3WGWA 1PLRA 4CS5A 4ZTDA 3LX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U60 F;  5E0V A;  3AIX B;  2ZVV A;  3A1J B;  1CZD A;  2NTI A;  4L60 A;  5CFK A;  3V61 B;  3GGR B;  3FDS D;  1VYM A;  5HAC A;  5B7O A;  3K4X A;  3P83 A;  3AIZ A;  5A6D A;  2NTI C;  3U61 F;  2IX2 A;  4L6P A;  3FDS C;  2HII A;  2OD8 A;  2IO4 B;  3IFV A;  3AIZ C;  1RXZ A;  3A2F B;  2IX2 C;  2ZVK A;  2HII C;  3P87 A;  4RJF A;  3VKX A;  5IWD A;  1IZ5 A;  2HIK A;  3G65 B;  3P91 A;  1UL1 A;  2ZVW A;  2AVT A;  3U5Z F;  2HIK C;  1GE8 A;  3I2M X;  3HI8 A;  1RXM A;  5E0U A;  3AIX A;  5AUJ A;  1VYJ A;  3A1J A;  3F1W A;  2IZO C;  5H0T A;  3TBL A;  1IZ4 A;  5JNE D;  3GGR A;  2NTI B;  3V62 B;  4TR6 A;  3GPM A;  3V60 B;  1AXC A;  2Z0L A;  5DA7 A;  3A1J C;  2ZVL A;  1SXJ F;  2IX2 B;  2IZO B;  1U7B A;  2IO4 A;  2HII B;  1ISQ A;  1B8H A;  2IJX A;  2ZVM A;  5DAI A;  2AWA A;  1W60 A;  3LX2 A;  1T6L A;  1RWZ A;  1B77 A;  3HSL X;  3GPN A;  1U76 A;  4HK1 A;  1YYP A;  4YHR A;  3G65 A;  1UD9 A;  2HIK B;  4D2G A;  1DML A;  1PLQ A;  3GGR C;  5E0T A;  5IY4 A;  3G65 C;  5IXA A;  3WGW A;  1PLR A;  4CS5 A;  4ZTD A;  3LX1 A; 
#chains in the Genus database with same CATH topology
 3U60 F;  5E0V A;  3AIX B;  2ZVV A;  3A1J B;  1CZD A;  2NTI A;  4L60 A;  5CFK A;  3V61 B;  3GGR B;  3FDS D;  1VYM A;  5HAC A;  5B7O A;  3K4X A;  3P83 A;  3AIZ A;  5A6D A;  2NTI C;  3U61 F;  2IX2 A;  4L6P A;  3FDS C;  2HII A;  2OD8 A;  2IO4 B;  3IFV A;  3AIZ C;  1RXZ A;  3A2F B;  2IX2 C;  2ZVK A;  2HII C;  3P87 A;  4RJF A;  3VKX A;  5IWD A;  1IZ5 A;  2HIK A;  3G65 B;  3P91 A;  1UL1 A;  2ZVW A;  2AVT A;  3U5Z F;  2HIK C;  1GE8 A;  3I2M X;  3HI8 A;  1RXM A;  5E0U A;  3AIX A;  5AUJ A;  1VYJ A;  3A1J A;  3F1W A;  2IZO C;  5H0T A;  3TBL A;  1IZ4 A;  5JNE D;  3GGR A;  2NTI B;  3V62 B;  4TR6 A;  3GPM A;  3V60 B;  1AXC A;  2Z0L A;  5DA7 A;  3A1J C;  2ZVL A;  1SXJ F;  2IX2 B;  2IZO B;  1U7B A;  2IO4 A;  2HII B;  1ISQ A;  1B8H A;  2IJX A;  2ZVM A;  5DAI A;  2AWA A;  1W60 A;  3LX2 A;  1T6L A;  1RWZ A;  1B77 A;  3HSL X;  3GPN A;  1U76 A;  4HK1 A;  1YYP A;  4YHR A;  3G65 A;  1UD9 A;  2HIK B;  4D2G A;  1DML A;  1PLQ A;  3GGR C;  5E0T A;  5IY4 A;  3G65 C;  5IXA A;  3WGW A;  1PLR A;  4CS5 A;  4ZTD A;  3LX1 A; 
#chains in the Genus database with same CATH homology
 3U60 F;  5E0V A;  3AIX B;  2ZVV A;  3A1J B;  1CZD A;  2NTI A;  4L60 A;  5CFK A;  3V61 B;  3GGR B;  3FDS D;  1VYM A;  5HAC A;  5B7O A;  3K4X A;  3P83 A;  3AIZ A;  5A6D A;  2NTI C;  3U61 F;  2IX2 A;  4L6P A;  3FDS C;  2HII A;  2OD8 A;  2IO4 B;  3IFV A;  3AIZ C;  1RXZ A;  3A2F B;  2IX2 C;  2ZVK A;  2HII C;  3P87 A;  4RJF A;  3VKX A;  5IWD A;  1IZ5 A;  2HIK A;  3G65 B;  3P91 A;  1UL1 A;  2ZVW A;  2AVT A;  3U5Z F;  2HIK C;  1GE8 A;  3I2M X;  3HI8 A;  1RXM A;  5E0U A;  3AIX A;  5AUJ A;  1VYJ A;  3A1J A;  3F1W A;  2IZO C;  5H0T A;  3TBL A;  1IZ4 A;  5JNE D;  3GGR A;  2NTI B;  3V62 B;  4TR6 A;  3GPM A;  3V60 B;  1AXC A;  2Z0L A;  5DA7 A;  3A1J C;  2ZVL A;  1SXJ F;  2IX2 B;  2IZO B;  1U7B A;  2IO4 A;  2HII B;  1ISQ A;  1B8H A;  2IJX A;  2ZVM A;  5DAI A;  2AWA A;  1W60 A;  3LX2 A;  1T6L A;  1RWZ A;  1B77 A;  3HSL X;  3GPN A;  1U76 A;  4HK1 A;  1YYP A;  4YHR A;  3G65 A;  1UD9 A;  2HIK B;  4D2G A;  1DML A;  1PLQ A;  3GGR C;  5E0T A;  5IY4 A;  3G65 C;  5IXA A;  3WGW A;  1PLR A;  4CS5 A;  4ZTD A;  3LX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...