3P91A

Crystal structure of proliferating cellular nuclear antigen from entamoeba histolytica
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
254
structure length
245
Chain Sequence
MCAFHAKFKEAALFKRVVESLKSTIDKTNFDCSDAGIAVQCMDNSHVSLVSLLIETDAFDEFQCLKPITLGINLTHLSKILKALDNDCGLILDVKKVDDAVLSITSENKTMKFGLNLVDIEAESVEIPELQSDAIITLSSAEFLKITKDFSALGDDSITIGCTKNEVTLTTKGAMCETCMTLSAGLQIEHNKDVTASFALKQISEFAKSAPLADNVKLSLSGQAPLIMEFKGEACVLKFYLAPKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Structure and biochemical characterization of proliferating cellular nuclear antigen from a parasitic protozoon.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 52
structure length 245
sequence length 254
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3p91A00
1YYPA 1VYMA 1UL1A 3U61F 3F1WA 5H0TA 3AIXA 2HIIA 1IZ5A 1SXJF 3IFVA 1U76A 3LX1A 5IY4A 3HSLX 5DA7A 3P91A 2ZVVA 1GE8A 2HIIB 2IX2A 4YHRA 1PLQA 5IWDA 3AIZA 3I2MX 1B8HA 5E0UA 3VKXA 2ZVWA 3HI8A 1ISQA 2IX2C 3A2FB 2IX2B 3GPMA 3V60B 1CZDA 3AIZC 3V62B 2HIKA 3TBLA 1VYJA 3GGRA 2NTIA 1PLRA 1T6LA 2IO4A 1DMLA 3AIXB 1W60A 2IZOC 2HIIC 2IZOB 1B77A 2HIKB 3GGRB 3FDSD 4TR6A 2ZVLA 5DAIA 4L60A 2AVTA 2IO4B 2ZVMA 3LX2A 5E0VA 3A1JA 1RXMA 1IZ4A 3P83A 4HK1A 3V61B 5CFKA 5E0TA 1U7BA 4ZTDA 1AXCA 4RJFA 2Z0LA 3A1JB 4CS5A 4L6PA 3G65A 5A6DA 4D2GA 3K4XA 2HIKC 3GGRC 5HACA 2NTIC 2NTIB 1RXZA 1RWZA 3WGWA 5IXAA 2AWAA 1UD9A 3U60F 5AUJA 5B7OA 3G65C 3G65B 2IJXA 3U5ZF 3P87A 2ZVKA 3FDSC 2OD8A 3A1JC 3GPNA 5JNED
chains in the Genus database with same CATH superfamily
1YYPA 1VYMA 1UL1A 3U61F 3F1WA 5H0TA 3AIXA 2HIIA 1IZ5A 1SXJF 3IFVA 1U76A 3LX1A 5IY4A 3HSLX 5DA7A 3P91A 2ZVVA 1GE8A 2HIIB 2IX2A 4YHRA 1PLQA 5IWDA 3AIZA 3I2MX 1B8HA 5E0UA 3VKXA 2ZVWA 3HI8A 1ISQA 2IX2C 3A2FB 2IX2B 3GPMA 3V60B 1CZDA 3AIZC 3V62B 2HIKA 3TBLA 1VYJA 3GGRA 2NTIA 1PLRA 1T6LA 2IO4A 1DMLA 3AIXB 1W60A 2IZOC 2HIIC 2IZOB 1B77A 2HIKB 3GGRB 3FDSD 4TR6A 2ZVLA 5DAIA 4L60A 2AVTA 2IO4B 2ZVMA 3LX2A 5E0VA 3A1JA 1RXMA 1IZ4A 3P83A 4HK1A 3V61B 5CFKA 5E0TA 1U7BA 4ZTDA 1AXCA 4RJFA 2Z0LA 3A1JB 4CS5A 4L6PA 3G65A 5A6DA 4D2GA 3K4XA 2HIKC 3GGRC 5HACA 2NTIC 2NTIB 1RXZA 1RWZA 3WGWA 5IXAA 2AWAA 1UD9A 3U60F 5AUJA 5B7OA 3G65C 3G65B 2IJXA 3U5ZF 3P87A 2ZVKA 3FDSC 2OD8A 3A1JC 3GPNA 5JNED
chains in the Genus database with same CATH topology
1YYPA 1VYMA 1UL1A 3U61F 3F1WA 5H0TA 3AIXA 2HIIA 1IZ5A 1SXJF 3IFVA 1U76A 3LX1A 5IY4A 3HSLX 5DA7A 3P91A 2ZVVA 1GE8A 2HIIB 2IX2A 4YHRA 1PLQA 5IWDA 3AIZA 3I2MX 1B8HA 5E0UA 3VKXA 2ZVWA 3HI8A 1ISQA 2IX2C 3A2FB 2IX2B 3GPMA 3V60B 1CZDA 3AIZC 3V62B 2HIKA 3TBLA 1VYJA 3GGRA 2NTIA 1PLRA 1T6LA 2IO4A 1DMLA 3AIXB 1W60A 2IZOC 2HIIC 2IZOB 1B77A 2HIKB 3GGRB 3FDSD 4TR6A 2ZVLA 5DAIA 4L60A 2AVTA 2IO4B 2ZVMA 3LX2A 5E0VA 3A1JA 1RXMA 1IZ4A 3P83A 4HK1A 3V61B 5CFKA 5E0TA 1U7BA 4ZTDA 1AXCA 4RJFA 2Z0LA 3A1JB 4CS5A 4L6PA 3G65A 5A6DA 4D2GA 3K4XA 2HIKC 3GGRC 5HACA 2NTIC 2NTIB 1RXZA 1RWZA 3WGWA 5IXAA 2AWAA 1UD9A 3U60F 5AUJA 5B7OA 3G65C 3G65B 2IJXA 3U5ZF 3P87A 2ZVKA 3FDSC 2OD8A 3A1JC 3GPNA 5JNED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYP A;  1VYM A;  1UL1 A;  3U61 F;  3F1W A;  5H0T A;  3AIX A;  2HII A;  1IZ5 A;  1SXJ F;  3IFV A;  1U76 A;  3LX1 A;  5IY4 A;  3HSL X;  5DA7 A;  3P91 A;  2ZVV A;  1GE8 A;  2HII B;  2IX2 A;  4YHR A;  1PLQ A;  5IWD A;  3AIZ A;  3I2M X;  1B8H A;  5E0U A;  3VKX A;  2ZVW A;  3HI8 A;  1ISQ A;  2IX2 C;  3A2F B;  2IX2 B;  3GPM A;  3V60 B;  1CZD A;  3AIZ C;  3V62 B;  2HIK A;  3TBL A;  1VYJ A;  3GGR A;  2NTI A;  1PLR A;  1T6L A;  2IO4 A;  1DML A;  3AIX B;  1W60 A;  2IZO C;  2HII C;  2IZO B;  1B77 A;  2HIK B;  3GGR B;  3FDS D;  4TR6 A;  2ZVL A;  5DAI A;  4L60 A;  2AVT A;  2IO4 B;  2ZVM A;  3LX2 A;  5E0V A;  3A1J A;  1RXM A;  1IZ4 A;  3P83 A;  4HK1 A;  3V61 B;  5CFK A;  5E0T A;  1U7B A;  4ZTD A;  1AXC A;  4RJF A;  2Z0L A;  3A1J B;  4CS5 A;  4L6P A;  3G65 A;  5A6D A;  4D2G A;  3K4X A;  2HIK C;  3GGR C;  5HAC A;  2NTI C;  2NTI B;  1RXZ A;  1RWZ A;  3WGW A;  5IXA A;  2AWA A;  1UD9 A;  3U60 F;  5AUJ A;  5B7O A;  3G65 C;  3G65 B;  2IJX A;  3U5Z F;  3P87 A;  2ZVK A;  3FDS C;  2OD8 A;  3A1J C;  3GPN A;  5JNE D; 
#chains in the Genus database with same CATH topology
 1YYP A;  1VYM A;  1UL1 A;  3U61 F;  3F1W A;  5H0T A;  3AIX A;  2HII A;  1IZ5 A;  1SXJ F;  3IFV A;  1U76 A;  3LX1 A;  5IY4 A;  3HSL X;  5DA7 A;  3P91 A;  2ZVV A;  1GE8 A;  2HII B;  2IX2 A;  4YHR A;  1PLQ A;  5IWD A;  3AIZ A;  3I2M X;  1B8H A;  5E0U A;  3VKX A;  2ZVW A;  3HI8 A;  1ISQ A;  2IX2 C;  3A2F B;  2IX2 B;  3GPM A;  3V60 B;  1CZD A;  3AIZ C;  3V62 B;  2HIK A;  3TBL A;  1VYJ A;  3GGR A;  2NTI A;  1PLR A;  1T6L A;  2IO4 A;  1DML A;  3AIX B;  1W60 A;  2IZO C;  2HII C;  2IZO B;  1B77 A;  2HIK B;  3GGR B;  3FDS D;  4TR6 A;  2ZVL A;  5DAI A;  4L60 A;  2AVT A;  2IO4 B;  2ZVM A;  3LX2 A;  5E0V A;  3A1J A;  1RXM A;  1IZ4 A;  3P83 A;  4HK1 A;  3V61 B;  5CFK A;  5E0T A;  1U7B A;  4ZTD A;  1AXC A;  4RJF A;  2Z0L A;  3A1J B;  4CS5 A;  4L6P A;  3G65 A;  5A6D A;  4D2G A;  3K4X A;  2HIK C;  3GGR C;  5HAC A;  2NTI C;  2NTI B;  1RXZ A;  1RWZ A;  3WGW A;  5IXA A;  2AWA A;  1UD9 A;  3U60 F;  5AUJ A;  5B7O A;  3G65 C;  3G65 B;  2IJX A;  3U5Z F;  3P87 A;  2ZVK A;  3FDS C;  2OD8 A;  3A1J C;  3GPN A;  5JNE D; 
#chains in the Genus database with same CATH homology
 1YYP A;  1VYM A;  1UL1 A;  3U61 F;  3F1W A;  5H0T A;  3AIX A;  2HII A;  1IZ5 A;  1SXJ F;  3IFV A;  1U76 A;  3LX1 A;  5IY4 A;  3HSL X;  5DA7 A;  3P91 A;  2ZVV A;  1GE8 A;  2HII B;  2IX2 A;  4YHR A;  1PLQ A;  5IWD A;  3AIZ A;  3I2M X;  1B8H A;  5E0U A;  3VKX A;  2ZVW A;  3HI8 A;  1ISQ A;  2IX2 C;  3A2F B;  2IX2 B;  3GPM A;  3V60 B;  1CZD A;  3AIZ C;  3V62 B;  2HIK A;  3TBL A;  1VYJ A;  3GGR A;  2NTI A;  1PLR A;  1T6L A;  2IO4 A;  1DML A;  3AIX B;  1W60 A;  2IZO C;  2HII C;  2IZO B;  1B77 A;  2HIK B;  3GGR B;  3FDS D;  4TR6 A;  2ZVL A;  5DAI A;  4L60 A;  2AVT A;  2IO4 B;  2ZVM A;  3LX2 A;  5E0V A;  3A1J A;  1RXM A;  1IZ4 A;  3P83 A;  4HK1 A;  3V61 B;  5CFK A;  5E0T A;  1U7B A;  4ZTD A;  1AXC A;  4RJF A;  2Z0L A;  3A1J B;  4CS5 A;  4L6P A;  3G65 A;  5A6D A;  4D2G A;  3K4X A;  2HIK C;  3GGR C;  5HAC A;  2NTI C;  2NTI B;  1RXZ A;  1RWZ A;  3WGW A;  5IXA A;  2AWA A;  1UD9 A;  3U60 F;  5AUJ A;  5B7O A;  3G65 C;  3G65 B;  2IJX A;  3U5Z F;  3P87 A;  2ZVK A;  3FDS C;  2OD8 A;  3A1J C;  3GPN A;  5JNE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...