3TBLA

Structure of mono-ubiquitinated pcna: implications for dna polymerase switching and okazaki fragment maturation
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
256
structure length
250
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Proliferating cell nuclear antigen
publication title Structure of monoubiquitinated PCNA: Implications for DNA polymerase switching and Okazaki fragment maturation.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 250
sequence length 256
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3tblA00
2IJXA 5DAIA 2ZVMA 4D2GA 1GE8A 1RXMA 1PLQA 3HSLX 3A1JB 3GPNA 2ZVVA 1SXJF 2HIIA 3LX2A 3G65B 3V61B 2AVTA 3WGWA 3GGRB 2IX2A 2NTIC 4L60A 2IZOC 2IX2C 1VYMA 3V60B 1IZ4A 1IZ5A 1W60A 1UD9A 3AIXB 3GPMA 5CFKA 2ZVWA 2HIKB 3TBLA 3U5ZF 4RJFA 5H0TA 5A6DA 5E0TA 1RWZA 3HI8A 3P87A 2HIIC 3FDSC 1ISQA 3U60F 1CZDA 4CS5A 3FDSD 3V62B 1AXCA 5IXAA 4YHRA 3VKXA 3AIXA 3A1JA 1B8HA 2IO4B 1YYPA 2ZVLA 4TR6A 4ZTDA 2ZVKA 3A1JC 3G65A 2NTIB 2AWAA 1PLRA 3LX1A 3AIZA 5B7OA 2IZOB 2IX2B 2OD8A 3P83A 5E0UA 3U61F 3GGRA 5IWDA 3AIZC 3F1WA 1U76A 1B77A 3K4XA 1RXZA 5AUJA 3GGRC 2Z0LA 5IY4A 1T6LA 5JNED 3I2MX 1U7BA 5E0VA 4L6PA 5HACA 2HIIB 2IO4A 2HIKA 1DMLA 4HK1A 2HIKC 2NTIA 1VYJA 3A2FB 3G65C 3P91A 3IFVA 5DA7A 1UL1A
chains in the Genus database with same CATH superfamily
2IJXA 5DAIA 2ZVMA 4D2GA 1GE8A 1RXMA 1PLQA 3HSLX 3A1JB 3GPNA 2ZVVA 1SXJF 2HIIA 3LX2A 3G65B 3V61B 2AVTA 3WGWA 3GGRB 2IX2A 2NTIC 4L60A 2IZOC 2IX2C 1VYMA 3V60B 1IZ4A 1IZ5A 1W60A 1UD9A 3AIXB 3GPMA 5CFKA 2ZVWA 2HIKB 3TBLA 3U5ZF 4RJFA 5H0TA 5A6DA 5E0TA 1RWZA 3HI8A 3P87A 2HIIC 3FDSC 1ISQA 3U60F 1CZDA 4CS5A 3FDSD 3V62B 1AXCA 5IXAA 4YHRA 3VKXA 3AIXA 3A1JA 1B8HA 2IO4B 1YYPA 2ZVLA 4TR6A 4ZTDA 2ZVKA 3A1JC 3G65A 2NTIB 2AWAA 1PLRA 3LX1A 3AIZA 5B7OA 2IZOB 2IX2B 2OD8A 3P83A 5E0UA 3U61F 3GGRA 5IWDA 3AIZC 3F1WA 1U76A 1B77A 3K4XA 1RXZA 5AUJA 3GGRC 2Z0LA 5IY4A 1T6LA 5JNED 3I2MX 1U7BA 5E0VA 4L6PA 5HACA 2HIIB 2IO4A 2HIKA 1DMLA 4HK1A 2HIKC 2NTIA 1VYJA 3A2FB 3G65C 3P91A 3IFVA 5DA7A 1UL1A
chains in the Genus database with same CATH topology
2IJXA 5DAIA 2ZVMA 4D2GA 1GE8A 1RXMA 1PLQA 3HSLX 3A1JB 3GPNA 2ZVVA 1SXJF 2HIIA 3LX2A 3G65B 3V61B 2AVTA 3WGWA 3GGRB 2IX2A 2NTIC 4L60A 2IZOC 2IX2C 1VYMA 3V60B 1IZ4A 1IZ5A 1W60A 1UD9A 3AIXB 3GPMA 5CFKA 2ZVWA 2HIKB 3TBLA 3U5ZF 4RJFA 5H0TA 5A6DA 5E0TA 1RWZA 3HI8A 3P87A 2HIIC 3FDSC 1ISQA 3U60F 1CZDA 4CS5A 3FDSD 3V62B 1AXCA 5IXAA 4YHRA 3VKXA 3AIXA 3A1JA 1B8HA 2IO4B 1YYPA 2ZVLA 4TR6A 4ZTDA 2ZVKA 3A1JC 3G65A 2NTIB 2AWAA 1PLRA 3LX1A 3AIZA 5B7OA 2IZOB 2IX2B 2OD8A 3P83A 5E0UA 3U61F 3GGRA 5IWDA 3AIZC 3F1WA 1U76A 1B77A 3K4XA 1RXZA 5AUJA 3GGRC 2Z0LA 5IY4A 1T6LA 5JNED 3I2MX 1U7BA 5E0VA 4L6PA 5HACA 2HIIB 2IO4A 2HIKA 1DMLA 4HK1A 2HIKC 2NTIA 1VYJA 3A2FB 3G65C 3P91A 3IFVA 5DA7A 1UL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJX A;  5DAI A;  2ZVM A;  4D2G A;  1GE8 A;  1RXM A;  1PLQ A;  3HSL X;  3A1J B;  3GPN A;  2ZVV A;  1SXJ F;  2HII A;  3LX2 A;  3G65 B;  3V61 B;  2AVT A;  3WGW A;  3GGR B;  2IX2 A;  2NTI C;  4L60 A;  2IZO C;  2IX2 C;  1VYM A;  3V60 B;  1IZ4 A;  1IZ5 A;  1W60 A;  1UD9 A;  3AIX B;  3GPM A;  5CFK A;  2ZVW A;  2HIK B;  3TBL A;  3U5Z F;  4RJF A;  5H0T A;  5A6D A;  5E0T A;  1RWZ A;  3HI8 A;  3P87 A;  2HII C;  3FDS C;  1ISQ A;  3U60 F;  1CZD A;  4CS5 A;  3FDS D;  3V62 B;  1AXC A;  5IXA A;  4YHR A;  3VKX A;  3AIX A;  3A1J A;  1B8H A;  2IO4 B;  1YYP A;  2ZVL A;  4TR6 A;  4ZTD A;  2ZVK A;  3A1J C;  3G65 A;  2NTI B;  2AWA A;  1PLR A;  3LX1 A;  3AIZ A;  5B7O A;  2IZO B;  2IX2 B;  2OD8 A;  3P83 A;  5E0U A;  3U61 F;  3GGR A;  5IWD A;  3AIZ C;  3F1W A;  1U76 A;  1B77 A;  3K4X A;  1RXZ A;  5AUJ A;  3GGR C;  2Z0L A;  5IY4 A;  1T6L A;  5JNE D;  3I2M X;  1U7B A;  5E0V A;  4L6P A;  5HAC A;  2HII B;  2IO4 A;  2HIK A;  1DML A;  4HK1 A;  2HIK C;  2NTI A;  1VYJ A;  3A2F B;  3G65 C;  3P91 A;  3IFV A;  5DA7 A;  1UL1 A; 
#chains in the Genus database with same CATH topology
 2IJX A;  5DAI A;  2ZVM A;  4D2G A;  1GE8 A;  1RXM A;  1PLQ A;  3HSL X;  3A1J B;  3GPN A;  2ZVV A;  1SXJ F;  2HII A;  3LX2 A;  3G65 B;  3V61 B;  2AVT A;  3WGW A;  3GGR B;  2IX2 A;  2NTI C;  4L60 A;  2IZO C;  2IX2 C;  1VYM A;  3V60 B;  1IZ4 A;  1IZ5 A;  1W60 A;  1UD9 A;  3AIX B;  3GPM A;  5CFK A;  2ZVW A;  2HIK B;  3TBL A;  3U5Z F;  4RJF A;  5H0T A;  5A6D A;  5E0T A;  1RWZ A;  3HI8 A;  3P87 A;  2HII C;  3FDS C;  1ISQ A;  3U60 F;  1CZD A;  4CS5 A;  3FDS D;  3V62 B;  1AXC A;  5IXA A;  4YHR A;  3VKX A;  3AIX A;  3A1J A;  1B8H A;  2IO4 B;  1YYP A;  2ZVL A;  4TR6 A;  4ZTD A;  2ZVK A;  3A1J C;  3G65 A;  2NTI B;  2AWA A;  1PLR A;  3LX1 A;  3AIZ A;  5B7O A;  2IZO B;  2IX2 B;  2OD8 A;  3P83 A;  5E0U A;  3U61 F;  3GGR A;  5IWD A;  3AIZ C;  3F1W A;  1U76 A;  1B77 A;  3K4X A;  1RXZ A;  5AUJ A;  3GGR C;  2Z0L A;  5IY4 A;  1T6L A;  5JNE D;  3I2M X;  1U7B A;  5E0V A;  4L6P A;  5HAC A;  2HII B;  2IO4 A;  2HIK A;  1DML A;  4HK1 A;  2HIK C;  2NTI A;  1VYJ A;  3A2F B;  3G65 C;  3P91 A;  3IFV A;  5DA7 A;  1UL1 A; 
#chains in the Genus database with same CATH homology
 2IJX A;  5DAI A;  2ZVM A;  4D2G A;  1GE8 A;  1RXM A;  1PLQ A;  3HSL X;  3A1J B;  3GPN A;  2ZVV A;  1SXJ F;  2HII A;  3LX2 A;  3G65 B;  3V61 B;  2AVT A;  3WGW A;  3GGR B;  2IX2 A;  2NTI C;  4L60 A;  2IZO C;  2IX2 C;  1VYM A;  3V60 B;  1IZ4 A;  1IZ5 A;  1W60 A;  1UD9 A;  3AIX B;  3GPM A;  5CFK A;  2ZVW A;  2HIK B;  3TBL A;  3U5Z F;  4RJF A;  5H0T A;  5A6D A;  5E0T A;  1RWZ A;  3HI8 A;  3P87 A;  2HII C;  3FDS C;  1ISQ A;  3U60 F;  1CZD A;  4CS5 A;  3FDS D;  3V62 B;  1AXC A;  5IXA A;  4YHR A;  3VKX A;  3AIX A;  3A1J A;  1B8H A;  2IO4 B;  1YYP A;  2ZVL A;  4TR6 A;  4ZTD A;  2ZVK A;  3A1J C;  3G65 A;  2NTI B;  2AWA A;  1PLR A;  3LX1 A;  3AIZ A;  5B7O A;  2IZO B;  2IX2 B;  2OD8 A;  3P83 A;  5E0U A;  3U61 F;  3GGR A;  5IWD A;  3AIZ C;  3F1W A;  1U76 A;  1B77 A;  3K4X A;  1RXZ A;  5AUJ A;  3GGR C;  2Z0L A;  5IY4 A;  1T6L A;  5JNE D;  3I2M X;  1U7B A;  5E0V A;  4L6P A;  5HAC A;  2HII B;  2IO4 A;  2HIK A;  1DML A;  4HK1 A;  2HIK C;  2NTI A;  1VYJ A;  3A2F B;  3G65 C;  3P91 A;  3IFV A;  5DA7 A;  1UL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...