3V60B

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
256
structure length
256
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLGIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
B PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3v60B00
3FDSD 2HIKC 5A6DA 2HIKA 3WGWA 1B8HA 5H0TA 5HACA 3HI8A 1RXMA 3G65C 2ZVMA 3G65A 3HSLX 1U76A 2ZVWA 4ZTDA 1SXJF 1W60A 5IWDA 3FDSC 5E0TA 3GPNA 3K4XA 2IZOC 3GGRC 3GGRA 3P91A 3TBLA 3A2FB 4YHRA 5DA7A 2IZOB 3V60B 3P83A 3GGRB 4L60A 1T6LA 2Z0LA 3GPMA 5JNED 1GE8A 2ZVVA 1VYJA 4RJFA 4CS5A 2ZVKA 3LX2A 3F1WA 2HIIC 2HIIA 5AUJA 3LX1A 3V61B 3A1JC 3AIZC 3A1JA 3AIZA 1ISQA 3V62B 2ZVLA 2HIIB 1YYPA 3IFVA 1AXCA 1IZ4A 3U5ZF 5IXAA 2NTIC 3A1JB 2NTIA 5E0UA 2OD8A 1UD9A 1CZDA 1U7BA 4TR6A 2NTIB 3AIXA 1PLRA 1RWZA 1PLQA 2IO4A 3AIXB 1DMLA 5CFKA 5DAIA 2AVTA 1IZ5A 5E0VA 3VKXA 2IO4B 5IY4A 1VYMA 2HIKB 4L6PA 2IX2C 2IX2A 4D2GA 3U61F 3U60F 3G65B 1RXZA 2IX2B 3I2MX 1UL1A 2IJXA 1B77A 2AWAA 3P87A 4HK1A 5B7OA
chains in the Genus database with same CATH superfamily
3FDSD 2HIKC 5A6DA 2HIKA 3WGWA 1B8HA 5H0TA 5HACA 3HI8A 1RXMA 3G65C 2ZVMA 3G65A 3HSLX 1U76A 2ZVWA 4ZTDA 1SXJF 1W60A 5IWDA 3FDSC 5E0TA 3GPNA 3K4XA 2IZOC 3GGRC 3GGRA 3P91A 3TBLA 3A2FB 4YHRA 5DA7A 2IZOB 3V60B 3P83A 3GGRB 4L60A 1T6LA 2Z0LA 3GPMA 5JNED 1GE8A 2ZVVA 1VYJA 4RJFA 4CS5A 2ZVKA 3LX2A 3F1WA 2HIIC 2HIIA 5AUJA 3LX1A 3V61B 3A1JC 3AIZC 3A1JA 3AIZA 1ISQA 3V62B 2ZVLA 2HIIB 1YYPA 3IFVA 1AXCA 1IZ4A 3U5ZF 5IXAA 2NTIC 3A1JB 2NTIA 5E0UA 2OD8A 1UD9A 1CZDA 1U7BA 4TR6A 2NTIB 3AIXA 1PLRA 1RWZA 1PLQA 2IO4A 3AIXB 1DMLA 5CFKA 5DAIA 2AVTA 1IZ5A 5E0VA 3VKXA 2IO4B 5IY4A 1VYMA 2HIKB 4L6PA 2IX2C 2IX2A 4D2GA 3U61F 3U60F 3G65B 1RXZA 2IX2B 3I2MX 1UL1A 2IJXA 1B77A 2AWAA 3P87A 4HK1A 5B7OA
chains in the Genus database with same CATH topology
3FDSD 2HIKC 5A6DA 2HIKA 3WGWA 1B8HA 5H0TA 5HACA 3HI8A 1RXMA 3G65C 2ZVMA 3G65A 3HSLX 1U76A 2ZVWA 4ZTDA 1SXJF 1W60A 5IWDA 3FDSC 5E0TA 3GPNA 3K4XA 2IZOC 3GGRC 3GGRA 3P91A 3TBLA 3A2FB 4YHRA 5DA7A 2IZOB 3V60B 3P83A 3GGRB 4L60A 1T6LA 2Z0LA 3GPMA 5JNED 1GE8A 2ZVVA 1VYJA 4RJFA 4CS5A 2ZVKA 3LX2A 3F1WA 2HIIC 2HIIA 5AUJA 3LX1A 3V61B 3A1JC 3AIZC 3A1JA 3AIZA 1ISQA 3V62B 2ZVLA 2HIIB 1YYPA 3IFVA 1AXCA 1IZ4A 3U5ZF 5IXAA 2NTIC 3A1JB 2NTIA 5E0UA 2OD8A 1UD9A 1CZDA 1U7BA 4TR6A 2NTIB 3AIXA 1PLRA 1RWZA 1PLQA 2IO4A 3AIXB 1DMLA 5CFKA 5DAIA 2AVTA 1IZ5A 5E0VA 3VKXA 2IO4B 5IY4A 1VYMA 2HIKB 4L6PA 2IX2C 2IX2A 4D2GA 3U61F 3U60F 3G65B 1RXZA 2IX2B 3I2MX 1UL1A 2IJXA 1B77A 2AWAA 3P87A 4HK1A 5B7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDS D;  2HIK C;  5A6D A;  2HIK A;  3WGW A;  1B8H A;  5H0T A;  5HAC A;  3HI8 A;  1RXM A;  3G65 C;  2ZVM A;  3G65 A;  3HSL X;  1U76 A;  2ZVW A;  4ZTD A;  1SXJ F;  1W60 A;  5IWD A;  3FDS C;  5E0T A;  3GPN A;  3K4X A;  2IZO C;  3GGR C;  3GGR A;  3P91 A;  3TBL A;  3A2F B;  4YHR A;  5DA7 A;  2IZO B;  3V60 B;  3P83 A;  3GGR B;  4L60 A;  1T6L A;  2Z0L A;  3GPM A;  5JNE D;  1GE8 A;  2ZVV A;  1VYJ A;  4RJF A;  4CS5 A;  2ZVK A;  3LX2 A;  3F1W A;  2HII C;  2HII A;  5AUJ A;  3LX1 A;  3V61 B;  3A1J C;  3AIZ C;  3A1J A;  3AIZ A;  1ISQ A;  3V62 B;  2ZVL A;  2HII B;  1YYP A;  3IFV A;  1AXC A;  1IZ4 A;  3U5Z F;  5IXA A;  2NTI C;  3A1J B;  2NTI A;  5E0U A;  2OD8 A;  1UD9 A;  1CZD A;  1U7B A;  4TR6 A;  2NTI B;  3AIX A;  1PLR A;  1RWZ A;  1PLQ A;  2IO4 A;  3AIX B;  1DML A;  5CFK A;  5DAI A;  2AVT A;  1IZ5 A;  5E0V A;  3VKX A;  2IO4 B;  5IY4 A;  1VYM A;  2HIK B;  4L6P A;  2IX2 C;  2IX2 A;  4D2G A;  3U61 F;  3U60 F;  3G65 B;  1RXZ A;  2IX2 B;  3I2M X;  1UL1 A;  2IJX A;  1B77 A;  2AWA A;  3P87 A;  4HK1 A;  5B7O A; 
#chains in the Genus database with same CATH topology
 3FDS D;  2HIK C;  5A6D A;  2HIK A;  3WGW A;  1B8H A;  5H0T A;  5HAC A;  3HI8 A;  1RXM A;  3G65 C;  2ZVM A;  3G65 A;  3HSL X;  1U76 A;  2ZVW A;  4ZTD A;  1SXJ F;  1W60 A;  5IWD A;  3FDS C;  5E0T A;  3GPN A;  3K4X A;  2IZO C;  3GGR C;  3GGR A;  3P91 A;  3TBL A;  3A2F B;  4YHR A;  5DA7 A;  2IZO B;  3V60 B;  3P83 A;  3GGR B;  4L60 A;  1T6L A;  2Z0L A;  3GPM A;  5JNE D;  1GE8 A;  2ZVV A;  1VYJ A;  4RJF A;  4CS5 A;  2ZVK A;  3LX2 A;  3F1W A;  2HII C;  2HII A;  5AUJ A;  3LX1 A;  3V61 B;  3A1J C;  3AIZ C;  3A1J A;  3AIZ A;  1ISQ A;  3V62 B;  2ZVL A;  2HII B;  1YYP A;  3IFV A;  1AXC A;  1IZ4 A;  3U5Z F;  5IXA A;  2NTI C;  3A1J B;  2NTI A;  5E0U A;  2OD8 A;  1UD9 A;  1CZD A;  1U7B A;  4TR6 A;  2NTI B;  3AIX A;  1PLR A;  1RWZ A;  1PLQ A;  2IO4 A;  3AIX B;  1DML A;  5CFK A;  5DAI A;  2AVT A;  1IZ5 A;  5E0V A;  3VKX A;  2IO4 B;  5IY4 A;  1VYM A;  2HIK B;  4L6P A;  2IX2 C;  2IX2 A;  4D2G A;  3U61 F;  3U60 F;  3G65 B;  1RXZ A;  2IX2 B;  3I2M X;  1UL1 A;  2IJX A;  1B77 A;  2AWA A;  3P87 A;  4HK1 A;  5B7O A; 
#chains in the Genus database with same CATH homology
 3FDS D;  2HIK C;  5A6D A;  2HIK A;  3WGW A;  1B8H A;  5H0T A;  5HAC A;  3HI8 A;  1RXM A;  3G65 C;  2ZVM A;  3G65 A;  3HSL X;  1U76 A;  2ZVW A;  4ZTD A;  1SXJ F;  1W60 A;  5IWD A;  3FDS C;  5E0T A;  3GPN A;  3K4X A;  2IZO C;  3GGR C;  3GGR A;  3P91 A;  3TBL A;  3A2F B;  4YHR A;  5DA7 A;  2IZO B;  3V60 B;  3P83 A;  3GGR B;  4L60 A;  1T6L A;  2Z0L A;  3GPM A;  5JNE D;  1GE8 A;  2ZVV A;  1VYJ A;  4RJF A;  4CS5 A;  2ZVK A;  3LX2 A;  3F1W A;  2HII C;  2HII A;  5AUJ A;  3LX1 A;  3V61 B;  3A1J C;  3AIZ C;  3A1J A;  3AIZ A;  1ISQ A;  3V62 B;  2ZVL A;  2HII B;  1YYP A;  3IFV A;  1AXC A;  1IZ4 A;  3U5Z F;  5IXA A;  2NTI C;  3A1J B;  2NTI A;  5E0U A;  2OD8 A;  1UD9 A;  1CZD A;  1U7B A;  4TR6 A;  2NTI B;  3AIX A;  1PLR A;  1RWZ A;  1PLQ A;  2IO4 A;  3AIX B;  1DML A;  5CFK A;  5DAI A;  2AVT A;  1IZ5 A;  5E0V A;  3VKX A;  2IO4 B;  5IY4 A;  1VYM A;  2HIK B;  4L6P A;  2IX2 C;  2IX2 A;  4D2G A;  3U61 F;  3U60 F;  3G65 B;  1RXZ A;  2IX2 B;  3I2M X;  1UL1 A;  2IJX A;  1B77 A;  2AWA A;  3P87 A;  4HK1 A;  5B7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...