3V61B

Structure of s. cerevisiae pcna conjugated to sumo on lysine 164
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
254
structure length
254
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLGIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
B PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3v61B00
3V61B 4ZTDA 1UD9A 2HIKC 1U76A 2HIKA 5CFKA 2HIKB 3V60B 1ISQA 5E0TA 2HIIA 1PLQA 3HSLX 5E0VA 2HIIB 3IFVA 3F1WA 5E0UA 2ZVWA 2IJXA 4CS5A 3P83A 4D2GA 4L60A 3P87A 3AIXA 3A2FB 1UL1A 3AIXB 3LX1A 5DA7A 2OD8A 4HK1A 1T6LA 2IX2C 1RXZA 2ZVMA 3A1JC 3A1JA 1AXCA 3A1JB 5DAIA 3AIZC 5AUJA 1B77A 3TBLA 1W60A 3I2MX 3GPMA 1RXMA 4RJFA 1DMLA 4TR6A 2IO4A 3V62B 2IO4B 3GGRC 3HI8A 2IZOC 4YHRA 5IY4A 3VKXA 5JNED 2IX2A 1CZDA 2IX2B 2ZVLA 3G65C 1VYMA 5A6DA 3FDSC 1U7BA 2Z0LA 3AIZA 1IZ5A 5HACA 2AVTA 3U61F 1SXJF 2AWAA 1IZ4A 1VYJA 1PLRA 3P91A 2HIIC 3FDSD 3GPNA 5B7OA 3GGRA 1RWZA 3GGRB 3U5ZF 3LX2A 1B8HA 1YYPA 2IZOB 3WGWA 5IXAA 2ZVKA 3G65A 5IWDA 4L6PA 3K4XA 3G65B 2NTIC 3U60F 2NTIA 2ZVVA 5H0TA 2NTIB 1GE8A
chains in the Genus database with same CATH superfamily
3V61B 4ZTDA 1UD9A 2HIKC 1U76A 2HIKA 5CFKA 2HIKB 3V60B 1ISQA 5E0TA 2HIIA 1PLQA 3HSLX 5E0VA 2HIIB 3IFVA 3F1WA 5E0UA 2ZVWA 2IJXA 4CS5A 3P83A 4D2GA 4L60A 3P87A 3AIXA 3A2FB 1UL1A 3AIXB 3LX1A 5DA7A 2OD8A 4HK1A 1T6LA 2IX2C 1RXZA 2ZVMA 3A1JC 3A1JA 1AXCA 3A1JB 5DAIA 3AIZC 5AUJA 1B77A 3TBLA 1W60A 3I2MX 3GPMA 1RXMA 4RJFA 1DMLA 4TR6A 2IO4A 3V62B 2IO4B 3GGRC 3HI8A 2IZOC 4YHRA 5IY4A 3VKXA 5JNED 2IX2A 1CZDA 2IX2B 2ZVLA 3G65C 1VYMA 5A6DA 3FDSC 1U7BA 2Z0LA 3AIZA 1IZ5A 5HACA 2AVTA 3U61F 1SXJF 2AWAA 1IZ4A 1VYJA 1PLRA 3P91A 2HIIC 3FDSD 3GPNA 5B7OA 3GGRA 1RWZA 3GGRB 3U5ZF 3LX2A 1B8HA 1YYPA 2IZOB 3WGWA 5IXAA 2ZVKA 3G65A 5IWDA 4L6PA 3K4XA 3G65B 2NTIC 3U60F 2NTIA 2ZVVA 5H0TA 2NTIB 1GE8A
chains in the Genus database with same CATH topology
3V61B 4ZTDA 1UD9A 2HIKC 1U76A 2HIKA 5CFKA 2HIKB 3V60B 1ISQA 5E0TA 2HIIA 1PLQA 3HSLX 5E0VA 2HIIB 3IFVA 3F1WA 5E0UA 2ZVWA 2IJXA 4CS5A 3P83A 4D2GA 4L60A 3P87A 3AIXA 3A2FB 1UL1A 3AIXB 3LX1A 5DA7A 2OD8A 4HK1A 1T6LA 2IX2C 1RXZA 2ZVMA 3A1JC 3A1JA 1AXCA 3A1JB 5DAIA 3AIZC 5AUJA 1B77A 3TBLA 1W60A 3I2MX 3GPMA 1RXMA 4RJFA 1DMLA 4TR6A 2IO4A 3V62B 2IO4B 3GGRC 3HI8A 2IZOC 4YHRA 5IY4A 3VKXA 5JNED 2IX2A 1CZDA 2IX2B 2ZVLA 3G65C 1VYMA 5A6DA 3FDSC 1U7BA 2Z0LA 3AIZA 1IZ5A 5HACA 2AVTA 3U61F 1SXJF 2AWAA 1IZ4A 1VYJA 1PLRA 3P91A 2HIIC 3FDSD 3GPNA 5B7OA 3GGRA 1RWZA 3GGRB 3U5ZF 3LX2A 1B8HA 1YYPA 2IZOB 3WGWA 5IXAA 2ZVKA 3G65A 5IWDA 4L6PA 3K4XA 3G65B 2NTIC 3U60F 2NTIA 2ZVVA 5H0TA 2NTIB 1GE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V61 B;  4ZTD A;  1UD9 A;  2HIK C;  1U76 A;  2HIK A;  5CFK A;  2HIK B;  3V60 B;  1ISQ A;  5E0T A;  2HII A;  1PLQ A;  3HSL X;  5E0V A;  2HII B;  3IFV A;  3F1W A;  5E0U A;  2ZVW A;  2IJX A;  4CS5 A;  3P83 A;  4D2G A;  4L60 A;  3P87 A;  3AIX A;  3A2F B;  1UL1 A;  3AIX B;  3LX1 A;  5DA7 A;  2OD8 A;  4HK1 A;  1T6L A;  2IX2 C;  1RXZ A;  2ZVM A;  3A1J C;  3A1J A;  1AXC A;  3A1J B;  5DAI A;  3AIZ C;  5AUJ A;  1B77 A;  3TBL A;  1W60 A;  3I2M X;  3GPM A;  1RXM A;  4RJF A;  1DML A;  4TR6 A;  2IO4 A;  3V62 B;  2IO4 B;  3GGR C;  3HI8 A;  2IZO C;  4YHR A;  5IY4 A;  3VKX A;  5JNE D;  2IX2 A;  1CZD A;  2IX2 B;  2ZVL A;  3G65 C;  1VYM A;  5A6D A;  3FDS C;  1U7B A;  2Z0L A;  3AIZ A;  1IZ5 A;  5HAC A;  2AVT A;  3U61 F;  1SXJ F;  2AWA A;  1IZ4 A;  1VYJ A;  1PLR A;  3P91 A;  2HII C;  3FDS D;  3GPN A;  5B7O A;  3GGR A;  1RWZ A;  3GGR B;  3U5Z F;  3LX2 A;  1B8H A;  1YYP A;  2IZO B;  3WGW A;  5IXA A;  2ZVK A;  3G65 A;  5IWD A;  4L6P A;  3K4X A;  3G65 B;  2NTI C;  3U60 F;  2NTI A;  2ZVV A;  5H0T A;  2NTI B;  1GE8 A; 
#chains in the Genus database with same CATH topology
 3V61 B;  4ZTD A;  1UD9 A;  2HIK C;  1U76 A;  2HIK A;  5CFK A;  2HIK B;  3V60 B;  1ISQ A;  5E0T A;  2HII A;  1PLQ A;  3HSL X;  5E0V A;  2HII B;  3IFV A;  3F1W A;  5E0U A;  2ZVW A;  2IJX A;  4CS5 A;  3P83 A;  4D2G A;  4L60 A;  3P87 A;  3AIX A;  3A2F B;  1UL1 A;  3AIX B;  3LX1 A;  5DA7 A;  2OD8 A;  4HK1 A;  1T6L A;  2IX2 C;  1RXZ A;  2ZVM A;  3A1J C;  3A1J A;  1AXC A;  3A1J B;  5DAI A;  3AIZ C;  5AUJ A;  1B77 A;  3TBL A;  1W60 A;  3I2M X;  3GPM A;  1RXM A;  4RJF A;  1DML A;  4TR6 A;  2IO4 A;  3V62 B;  2IO4 B;  3GGR C;  3HI8 A;  2IZO C;  4YHR A;  5IY4 A;  3VKX A;  5JNE D;  2IX2 A;  1CZD A;  2IX2 B;  2ZVL A;  3G65 C;  1VYM A;  5A6D A;  3FDS C;  1U7B A;  2Z0L A;  3AIZ A;  1IZ5 A;  5HAC A;  2AVT A;  3U61 F;  1SXJ F;  2AWA A;  1IZ4 A;  1VYJ A;  1PLR A;  3P91 A;  2HII C;  3FDS D;  3GPN A;  5B7O A;  3GGR A;  1RWZ A;  3GGR B;  3U5Z F;  3LX2 A;  1B8H A;  1YYP A;  2IZO B;  3WGW A;  5IXA A;  2ZVK A;  3G65 A;  5IWD A;  4L6P A;  3K4X A;  3G65 B;  2NTI C;  3U60 F;  2NTI A;  2ZVV A;  5H0T A;  2NTI B;  1GE8 A; 
#chains in the Genus database with same CATH homology
 3V61 B;  4ZTD A;  1UD9 A;  2HIK C;  1U76 A;  2HIK A;  5CFK A;  2HIK B;  3V60 B;  1ISQ A;  5E0T A;  2HII A;  1PLQ A;  3HSL X;  5E0V A;  2HII B;  3IFV A;  3F1W A;  5E0U A;  2ZVW A;  2IJX A;  4CS5 A;  3P83 A;  4D2G A;  4L60 A;  3P87 A;  3AIX A;  3A2F B;  1UL1 A;  3AIX B;  3LX1 A;  5DA7 A;  2OD8 A;  4HK1 A;  1T6L A;  2IX2 C;  1RXZ A;  2ZVM A;  3A1J C;  3A1J A;  1AXC A;  3A1J B;  5DAI A;  3AIZ C;  5AUJ A;  1B77 A;  3TBL A;  1W60 A;  3I2M X;  3GPM A;  1RXM A;  4RJF A;  1DML A;  4TR6 A;  2IO4 A;  3V62 B;  2IO4 B;  3GGR C;  3HI8 A;  2IZO C;  4YHR A;  5IY4 A;  3VKX A;  5JNE D;  2IX2 A;  1CZD A;  2IX2 B;  2ZVL A;  3G65 C;  1VYM A;  5A6D A;  3FDS C;  1U7B A;  2Z0L A;  3AIZ A;  1IZ5 A;  5HAC A;  2AVT A;  3U61 F;  1SXJ F;  2AWA A;  1IZ4 A;  1VYJ A;  1PLR A;  3P91 A;  2HII C;  3FDS D;  3GPN A;  5B7O A;  3GGR A;  1RWZ A;  3GGR B;  3U5Z F;  3LX2 A;  1B8H A;  1YYP A;  2IZO B;  3WGW A;  5IXA A;  2ZVK A;  3G65 A;  5IWD A;  4L6P A;  3K4X A;  3G65 B;  2NTI C;  3U60 F;  2NTI A;  2ZVV A;  5H0T A;  2NTI B;  1GE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...