3V62B

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
255
structure length
255
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLGIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 58
structure length 255
sequence length 255
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
B PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3v62B00
2ZVMA 5CFKA 1U76A 4L60A 1SXJF 4RJFA 1W60A 2ZVWA 2AWAA 5E0TA 3A2FB 5E0VA 2Z0LA 3V60B 5B7OA 3U61F 3AIXA 3U60F 2IJXA 2ZVKA 3P83A 3GPMA 3U5ZF 1B8HA 1CZDA 3I2MX 3AIXB 3WGWA 5H0TA 1AXCA 4ZTDA 3AIZA 1T6LA 3LX1A 3GGRA 2OD8A 1RXMA 4HK1A 3AIZC 1UL1A 1YYPA 3GGRC 2IO4A 3GPNA 1U7BA 3GGRB 1B77A 1PLRA 1RWZA 3LX2A 3IFVA 2IO4B 4CS5A 5IXAA 3VKXA 1IZ4A 5AUJA 1UD9A 2AVTA 2ZVLA 3A1JA 3FDSC 1PLQA 1DMLA 3A1JC 3G65A 3K4XA 5DAIA 3A1JB 3HI8A 3G65C 2IZOC 2HIKA 1VYMA 3V61B 3G65B 2IZOB 2HIIA 3F1WA 3FDSD 4YHRA 4TR6A 3P91A 5HACA 3TBLA 3V62B 1VYJA 5JNED 5DA7A 3P87A 5E0UA 1IZ5A 5IY4A 2IX2A 2HIKC 5A6DA 4D2GA 2HIIC 2IX2C 2HIKB 5IWDA 2NTIA 1GE8A 2HIIB 3HSLX 2IX2B 4L6PA 2NTIC 2ZVVA 2NTIB 1RXZA 1ISQA
chains in the Genus database with same CATH superfamily
2ZVMA 5CFKA 1U76A 4L60A 1SXJF 4RJFA 1W60A 2ZVWA 2AWAA 5E0TA 3A2FB 5E0VA 2Z0LA 3V60B 5B7OA 3U61F 3AIXA 3U60F 2IJXA 2ZVKA 3P83A 3GPMA 3U5ZF 1B8HA 1CZDA 3I2MX 3AIXB 3WGWA 5H0TA 1AXCA 4ZTDA 3AIZA 1T6LA 3LX1A 3GGRA 2OD8A 1RXMA 4HK1A 3AIZC 1UL1A 1YYPA 3GGRC 2IO4A 3GPNA 1U7BA 3GGRB 1B77A 1PLRA 1RWZA 3LX2A 3IFVA 2IO4B 4CS5A 5IXAA 3VKXA 1IZ4A 5AUJA 1UD9A 2AVTA 2ZVLA 3A1JA 3FDSC 1PLQA 1DMLA 3A1JC 3G65A 3K4XA 5DAIA 3A1JB 3HI8A 3G65C 2IZOC 2HIKA 1VYMA 3V61B 3G65B 2IZOB 2HIIA 3F1WA 3FDSD 4YHRA 4TR6A 3P91A 5HACA 3TBLA 3V62B 1VYJA 5JNED 5DA7A 3P87A 5E0UA 1IZ5A 5IY4A 2IX2A 2HIKC 5A6DA 4D2GA 2HIIC 2IX2C 2HIKB 5IWDA 2NTIA 1GE8A 2HIIB 3HSLX 2IX2B 4L6PA 2NTIC 2ZVVA 2NTIB 1RXZA 1ISQA
chains in the Genus database with same CATH topology
2ZVMA 5CFKA 1U76A 4L60A 1SXJF 4RJFA 1W60A 2ZVWA 2AWAA 5E0TA 3A2FB 5E0VA 2Z0LA 3V60B 5B7OA 3U61F 3AIXA 3U60F 2IJXA 2ZVKA 3P83A 3GPMA 3U5ZF 1B8HA 1CZDA 3I2MX 3AIXB 3WGWA 5H0TA 1AXCA 4ZTDA 3AIZA 1T6LA 3LX1A 3GGRA 2OD8A 1RXMA 4HK1A 3AIZC 1UL1A 1YYPA 3GGRC 2IO4A 3GPNA 1U7BA 3GGRB 1B77A 1PLRA 1RWZA 3LX2A 3IFVA 2IO4B 4CS5A 5IXAA 3VKXA 1IZ4A 5AUJA 1UD9A 2AVTA 2ZVLA 3A1JA 3FDSC 1PLQA 1DMLA 3A1JC 3G65A 3K4XA 5DAIA 3A1JB 3HI8A 3G65C 2IZOC 2HIKA 1VYMA 3V61B 3G65B 2IZOB 2HIIA 3F1WA 3FDSD 4YHRA 4TR6A 3P91A 5HACA 3TBLA 3V62B 1VYJA 5JNED 5DA7A 3P87A 5E0UA 1IZ5A 5IY4A 2IX2A 2HIKC 5A6DA 4D2GA 2HIIC 2IX2C 2HIKB 5IWDA 2NTIA 1GE8A 2HIIB 3HSLX 2IX2B 4L6PA 2NTIC 2ZVVA 2NTIB 1RXZA 1ISQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVM A;  5CFK A;  1U76 A;  4L60 A;  1SXJ F;  4RJF A;  1W60 A;  2ZVW A;  2AWA A;  5E0T A;  3A2F B;  5E0V A;  2Z0L A;  3V60 B;  5B7O A;  3U61 F;  3AIX A;  3U60 F;  2IJX A;  2ZVK A;  3P83 A;  3GPM A;  3U5Z F;  1B8H A;  1CZD A;  3I2M X;  3AIX B;  3WGW A;  5H0T A;  1AXC A;  4ZTD A;  3AIZ A;  1T6L A;  3LX1 A;  3GGR A;  2OD8 A;  1RXM A;  4HK1 A;  3AIZ C;  1UL1 A;  1YYP A;  3GGR C;  2IO4 A;  3GPN A;  1U7B A;  3GGR B;  1B77 A;  1PLR A;  1RWZ A;  3LX2 A;  3IFV A;  2IO4 B;  4CS5 A;  5IXA A;  3VKX A;  1IZ4 A;  5AUJ A;  1UD9 A;  2AVT A;  2ZVL A;  3A1J A;  3FDS C;  1PLQ A;  1DML A;  3A1J C;  3G65 A;  3K4X A;  5DAI A;  3A1J B;  3HI8 A;  3G65 C;  2IZO C;  2HIK A;  1VYM A;  3V61 B;  3G65 B;  2IZO B;  2HII A;  3F1W A;  3FDS D;  4YHR A;  4TR6 A;  3P91 A;  5HAC A;  3TBL A;  3V62 B;  1VYJ A;  5JNE D;  5DA7 A;  3P87 A;  5E0U A;  1IZ5 A;  5IY4 A;  2IX2 A;  2HIK C;  5A6D A;  4D2G A;  2HII C;  2IX2 C;  2HIK B;  5IWD A;  2NTI A;  1GE8 A;  2HII B;  3HSL X;  2IX2 B;  4L6P A;  2NTI C;  2ZVV A;  2NTI B;  1RXZ A;  1ISQ A; 
#chains in the Genus database with same CATH topology
 2ZVM A;  5CFK A;  1U76 A;  4L60 A;  1SXJ F;  4RJF A;  1W60 A;  2ZVW A;  2AWA A;  5E0T A;  3A2F B;  5E0V A;  2Z0L A;  3V60 B;  5B7O A;  3U61 F;  3AIX A;  3U60 F;  2IJX A;  2ZVK A;  3P83 A;  3GPM A;  3U5Z F;  1B8H A;  1CZD A;  3I2M X;  3AIX B;  3WGW A;  5H0T A;  1AXC A;  4ZTD A;  3AIZ A;  1T6L A;  3LX1 A;  3GGR A;  2OD8 A;  1RXM A;  4HK1 A;  3AIZ C;  1UL1 A;  1YYP A;  3GGR C;  2IO4 A;  3GPN A;  1U7B A;  3GGR B;  1B77 A;  1PLR A;  1RWZ A;  3LX2 A;  3IFV A;  2IO4 B;  4CS5 A;  5IXA A;  3VKX A;  1IZ4 A;  5AUJ A;  1UD9 A;  2AVT A;  2ZVL A;  3A1J A;  3FDS C;  1PLQ A;  1DML A;  3A1J C;  3G65 A;  3K4X A;  5DAI A;  3A1J B;  3HI8 A;  3G65 C;  2IZO C;  2HIK A;  1VYM A;  3V61 B;  3G65 B;  2IZO B;  2HII A;  3F1W A;  3FDS D;  4YHR A;  4TR6 A;  3P91 A;  5HAC A;  3TBL A;  3V62 B;  1VYJ A;  5JNE D;  5DA7 A;  3P87 A;  5E0U A;  1IZ5 A;  5IY4 A;  2IX2 A;  2HIK C;  5A6D A;  4D2G A;  2HII C;  2IX2 C;  2HIK B;  5IWD A;  2NTI A;  1GE8 A;  2HII B;  3HSL X;  2IX2 B;  4L6P A;  2NTI C;  2ZVV A;  2NTI B;  1RXZ A;  1ISQ A; 
#chains in the Genus database with same CATH homology
 2ZVM A;  5CFK A;  1U76 A;  4L60 A;  1SXJ F;  4RJF A;  1W60 A;  2ZVW A;  2AWA A;  5E0T A;  3A2F B;  5E0V A;  2Z0L A;  3V60 B;  5B7O A;  3U61 F;  3AIX A;  3U60 F;  2IJX A;  2ZVK A;  3P83 A;  3GPM A;  3U5Z F;  1B8H A;  1CZD A;  3I2M X;  3AIX B;  3WGW A;  5H0T A;  1AXC A;  4ZTD A;  3AIZ A;  1T6L A;  3LX1 A;  3GGR A;  2OD8 A;  1RXM A;  4HK1 A;  3AIZ C;  1UL1 A;  1YYP A;  3GGR C;  2IO4 A;  3GPN A;  1U7B A;  3GGR B;  1B77 A;  1PLR A;  1RWZ A;  3LX2 A;  3IFV A;  2IO4 B;  4CS5 A;  5IXA A;  3VKX A;  1IZ4 A;  5AUJ A;  1UD9 A;  2AVT A;  2ZVL A;  3A1J A;  3FDS C;  1PLQ A;  1DML A;  3A1J C;  3G65 A;  3K4X A;  5DAI A;  3A1J B;  3HI8 A;  3G65 C;  2IZO C;  2HIK A;  1VYM A;  3V61 B;  3G65 B;  2IZO B;  2HII A;  3F1W A;  3FDS D;  4YHR A;  4TR6 A;  3P91 A;  5HAC A;  3TBL A;  3V62 B;  1VYJ A;  5JNE D;  5DA7 A;  3P87 A;  5E0U A;  1IZ5 A;  5IY4 A;  2IX2 A;  2HIK C;  5A6D A;  4D2G A;  2HII C;  2IX2 C;  2HIK B;  5IWD A;  2NTI A;  1GE8 A;  2HII B;  3HSL X;  2IX2 B;  4L6P A;  2NTI C;  2ZVV A;  2NTI B;  1RXZ A;  1ISQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...