3VKXA

Structure of pcna
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
255
structure length
248
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Identification of small molecule proliferating cell nuclear antigen (PCNA) inhibitor that disrupts interactions with PIP-box proteins and inhibits DNA replication
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 248
sequence length 255
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3vkxA00
4L60A 3AIZA 2IZOC 1B8HA 3TBLA 1RXZA 1VYMA 1IZ4A 2IJXA 3LX1A 1UD9A 2AWAA 2ZVWA 1RXMA 2OD8A 3V61B 1YYPA 5E0VA 2ZVKA 3V62B 4CS5A 3U60F 1U7BA 2HIIB 2ZVLA 2HIIA 3GPMA 4L6PA 2IZOB 1IZ5A 3VKXA 3IFVA 2IO4B 1UL1A 1CZDA 5DAIA 3AIXB 3WGWA 5IWDA 2AVTA 2IO4A 3AIXA 1ISQA 2Z0LA 5A6DA 5E0TA 3A2FB 3I2MX 3HI8A 3GPNA 2IX2C 5DA7A 1B77A 3A1JC 5E0UA 3G65C 4RJFA 3V60B 1U76A 1DMLA 1AXCA 5B7OA 1W60A 1PLQA 2ZVMA 3P91A 2IX2B 3HSLX 1T6LA 2IX2A 3A1JB 3U61F 3P87A 3A1JA 2NTIC 3G65B 3LX2A 3FDSD 2HIKC 3G65A 5AUJA 2HIIC 5JNED 3GGRC 5HACA 5H0TA 3FDSC 5IY4A 4D2GA 3AIZC 5IXAA 1RWZA 3U5ZF 3F1WA 4ZTDA 4YHRA 2NTIB 1GE8A 1SXJF 2HIKB 2NTIA 2HIKA 2ZVVA 1VYJA 1PLRA 3K4XA 4HK1A 4TR6A 3GGRB 5CFKA 3GGRA 3P83A
chains in the Genus database with same CATH superfamily
4L60A 3AIZA 2IZOC 1B8HA 3TBLA 1RXZA 1VYMA 1IZ4A 2IJXA 3LX1A 1UD9A 2AWAA 2ZVWA 1RXMA 2OD8A 3V61B 1YYPA 5E0VA 2ZVKA 3V62B 4CS5A 3U60F 1U7BA 2HIIB 2ZVLA 2HIIA 3GPMA 4L6PA 2IZOB 1IZ5A 3VKXA 3IFVA 2IO4B 1UL1A 1CZDA 5DAIA 3AIXB 3WGWA 5IWDA 2AVTA 2IO4A 3AIXA 1ISQA 2Z0LA 5A6DA 5E0TA 3A2FB 3I2MX 3HI8A 3GPNA 2IX2C 5DA7A 1B77A 3A1JC 5E0UA 3G65C 4RJFA 3V60B 1U76A 1DMLA 1AXCA 5B7OA 1W60A 1PLQA 2ZVMA 3P91A 2IX2B 3HSLX 1T6LA 2IX2A 3A1JB 3U61F 3P87A 3A1JA 2NTIC 3G65B 3LX2A 3FDSD 2HIKC 3G65A 5AUJA 2HIIC 5JNED 3GGRC 5HACA 5H0TA 3FDSC 5IY4A 4D2GA 3AIZC 5IXAA 1RWZA 3U5ZF 3F1WA 4ZTDA 4YHRA 2NTIB 1GE8A 1SXJF 2HIKB 2NTIA 2HIKA 2ZVVA 1VYJA 1PLRA 3K4XA 4HK1A 4TR6A 3GGRB 5CFKA 3GGRA 3P83A
chains in the Genus database with same CATH topology
4L60A 3AIZA 2IZOC 1B8HA 3TBLA 1RXZA 1VYMA 1IZ4A 2IJXA 3LX1A 1UD9A 2AWAA 2ZVWA 1RXMA 2OD8A 3V61B 1YYPA 5E0VA 2ZVKA 3V62B 4CS5A 3U60F 1U7BA 2HIIB 2ZVLA 2HIIA 3GPMA 4L6PA 2IZOB 1IZ5A 3VKXA 3IFVA 2IO4B 1UL1A 1CZDA 5DAIA 3AIXB 3WGWA 5IWDA 2AVTA 2IO4A 3AIXA 1ISQA 2Z0LA 5A6DA 5E0TA 3A2FB 3I2MX 3HI8A 3GPNA 2IX2C 5DA7A 1B77A 3A1JC 5E0UA 3G65C 4RJFA 3V60B 1U76A 1DMLA 1AXCA 5B7OA 1W60A 1PLQA 2ZVMA 3P91A 2IX2B 3HSLX 1T6LA 2IX2A 3A1JB 3U61F 3P87A 3A1JA 2NTIC 3G65B 3LX2A 3FDSD 2HIKC 3G65A 5AUJA 2HIIC 5JNED 3GGRC 5HACA 5H0TA 3FDSC 5IY4A 4D2GA 3AIZC 5IXAA 1RWZA 3U5ZF 3F1WA 4ZTDA 4YHRA 2NTIB 1GE8A 1SXJF 2HIKB 2NTIA 2HIKA 2ZVVA 1VYJA 1PLRA 3K4XA 4HK1A 4TR6A 3GGRB 5CFKA 3GGRA 3P83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L60 A;  3AIZ A;  2IZO C;  1B8H A;  3TBL A;  1RXZ A;  1VYM A;  1IZ4 A;  2IJX A;  3LX1 A;  1UD9 A;  2AWA A;  2ZVW A;  1RXM A;  2OD8 A;  3V61 B;  1YYP A;  5E0V A;  2ZVK A;  3V62 B;  4CS5 A;  3U60 F;  1U7B A;  2HII B;  2ZVL A;  2HII A;  3GPM A;  4L6P A;  2IZO B;  1IZ5 A;  3VKX A;  3IFV A;  2IO4 B;  1UL1 A;  1CZD A;  5DAI A;  3AIX B;  3WGW A;  5IWD A;  2AVT A;  2IO4 A;  3AIX A;  1ISQ A;  2Z0L A;  5A6D A;  5E0T A;  3A2F B;  3I2M X;  3HI8 A;  3GPN A;  2IX2 C;  5DA7 A;  1B77 A;  3A1J C;  5E0U A;  3G65 C;  4RJF A;  3V60 B;  1U76 A;  1DML A;  1AXC A;  5B7O A;  1W60 A;  1PLQ A;  2ZVM A;  3P91 A;  2IX2 B;  3HSL X;  1T6L A;  2IX2 A;  3A1J B;  3U61 F;  3P87 A;  3A1J A;  2NTI C;  3G65 B;  3LX2 A;  3FDS D;  2HIK C;  3G65 A;  5AUJ A;  2HII C;  5JNE D;  3GGR C;  5HAC A;  5H0T A;  3FDS C;  5IY4 A;  4D2G A;  3AIZ C;  5IXA A;  1RWZ A;  3U5Z F;  3F1W A;  4ZTD A;  4YHR A;  2NTI B;  1GE8 A;  1SXJ F;  2HIK B;  2NTI A;  2HIK A;  2ZVV A;  1VYJ A;  1PLR A;  3K4X A;  4HK1 A;  4TR6 A;  3GGR B;  5CFK A;  3GGR A;  3P83 A; 
#chains in the Genus database with same CATH topology
 4L60 A;  3AIZ A;  2IZO C;  1B8H A;  3TBL A;  1RXZ A;  1VYM A;  1IZ4 A;  2IJX A;  3LX1 A;  1UD9 A;  2AWA A;  2ZVW A;  1RXM A;  2OD8 A;  3V61 B;  1YYP A;  5E0V A;  2ZVK A;  3V62 B;  4CS5 A;  3U60 F;  1U7B A;  2HII B;  2ZVL A;  2HII A;  3GPM A;  4L6P A;  2IZO B;  1IZ5 A;  3VKX A;  3IFV A;  2IO4 B;  1UL1 A;  1CZD A;  5DAI A;  3AIX B;  3WGW A;  5IWD A;  2AVT A;  2IO4 A;  3AIX A;  1ISQ A;  2Z0L A;  5A6D A;  5E0T A;  3A2F B;  3I2M X;  3HI8 A;  3GPN A;  2IX2 C;  5DA7 A;  1B77 A;  3A1J C;  5E0U A;  3G65 C;  4RJF A;  3V60 B;  1U76 A;  1DML A;  1AXC A;  5B7O A;  1W60 A;  1PLQ A;  2ZVM A;  3P91 A;  2IX2 B;  3HSL X;  1T6L A;  2IX2 A;  3A1J B;  3U61 F;  3P87 A;  3A1J A;  2NTI C;  3G65 B;  3LX2 A;  3FDS D;  2HIK C;  3G65 A;  5AUJ A;  2HII C;  5JNE D;  3GGR C;  5HAC A;  5H0T A;  3FDS C;  5IY4 A;  4D2G A;  3AIZ C;  5IXA A;  1RWZ A;  3U5Z F;  3F1W A;  4ZTD A;  4YHR A;  2NTI B;  1GE8 A;  1SXJ F;  2HIK B;  2NTI A;  2HIK A;  2ZVV A;  1VYJ A;  1PLR A;  3K4X A;  4HK1 A;  4TR6 A;  3GGR B;  5CFK A;  3GGR A;  3P83 A; 
#chains in the Genus database with same CATH homology
 4L60 A;  3AIZ A;  2IZO C;  1B8H A;  3TBL A;  1RXZ A;  1VYM A;  1IZ4 A;  2IJX A;  3LX1 A;  1UD9 A;  2AWA A;  2ZVW A;  1RXM A;  2OD8 A;  3V61 B;  1YYP A;  5E0V A;  2ZVK A;  3V62 B;  4CS5 A;  3U60 F;  1U7B A;  2HII B;  2ZVL A;  2HII A;  3GPM A;  4L6P A;  2IZO B;  1IZ5 A;  3VKX A;  3IFV A;  2IO4 B;  1UL1 A;  1CZD A;  5DAI A;  3AIX B;  3WGW A;  5IWD A;  2AVT A;  2IO4 A;  3AIX A;  1ISQ A;  2Z0L A;  5A6D A;  5E0T A;  3A2F B;  3I2M X;  3HI8 A;  3GPN A;  2IX2 C;  5DA7 A;  1B77 A;  3A1J C;  5E0U A;  3G65 C;  4RJF A;  3V60 B;  1U76 A;  1DML A;  1AXC A;  5B7O A;  1W60 A;  1PLQ A;  2ZVM A;  3P91 A;  2IX2 B;  3HSL X;  1T6L A;  2IX2 A;  3A1J B;  3U61 F;  3P87 A;  3A1J A;  2NTI C;  3G65 B;  3LX2 A;  3FDS D;  2HIK C;  3G65 A;  5AUJ A;  2HII C;  5JNE D;  3GGR C;  5HAC A;  5H0T A;  3FDS C;  5IY4 A;  4D2G A;  3AIZ C;  5IXA A;  1RWZ A;  3U5Z F;  3F1W A;  4ZTD A;  4YHR A;  2NTI B;  1GE8 A;  1SXJ F;  2HIK B;  2NTI A;  2HIK A;  2ZVV A;  1VYJ A;  1PLR A;  3K4X A;  4HK1 A;  4TR6 A;  3GGR B;  5CFK A;  3GGR A;  3P83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...