3WGWA

Structure of pcna bound to a small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
255
structure length
248
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Proliferating cell nuclear antigen
publication title A small molecule inhibitor of monoubiquitinated proliferating cell nuclear antigen (PCNA) inhibits repair of interstrand DNA crosslink, enhances DNA double-strand break, and sensitizes cancer cells to cisplatin
doi rcsb
source organism Homo sapiens
total genus 56
structure length 248
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3wgwA00
5E0VA 3U5ZF 3TBLA 2IZOC 1RWZA 1VYMA 2ZVWA 5CFKA 2HIIB 1CZDA 3U61F 3GGRB 2IJXA 2ZVMA 1IZ4A 2NTIC 3P91A 2ZVKA 5A6DA 3HI8A 1U76A 3G65B 5HACA 2HIKA 2IX2C 4D2GA 3FDSD 3A1JC 2OD8A 1B8HA 1RXZA 5B7OA 2IO4A 1UD9A 4RJFA 3VKXA 5E0TA 3LX2A 1T6LA 4HK1A 3AIZA 3P87A 4TR6A 4L6PA 2Z0LA 2HIIA 1PLQA 1PLRA 4CS5A 3GGRA 4YHRA 3A1JB 1SXJF 1IZ5A 4ZTDA 3I2MX 1UL1A 3WGWA 2IZOB 3G65A 1U7BA 2ZVVA 3AIXB 3AIZC 5AUJA 1W60A 1AXCA 2NTIB 1ISQA 3HSLX 3GGRC 3GPNA 3V60B 2IX2A 2IX2B 2AVTA 3K4XA 3IFVA 5JNED 2HIKC 5IY4A 3G65C 3A1JA 2AWAA 1DMLA 3V62B 2ZVLA 5IWDA 1B77A 5H0TA 5DA7A 3V61B 3U60F 5DAIA 3AIXA 3GPMA 3P83A 2HIIC 1RXMA 1YYPA 1VYJA 5IXAA 5E0UA 2NTIA 2HIKB 3FDSC 1GE8A 2IO4B 3F1WA 4L60A 3A2FB 3LX1A
chains in the Genus database with same CATH superfamily
5E0VA 3U5ZF 3TBLA 2IZOC 1RWZA 1VYMA 2ZVWA 5CFKA 2HIIB 1CZDA 3U61F 3GGRB 2IJXA 2ZVMA 1IZ4A 2NTIC 3P91A 2ZVKA 5A6DA 3HI8A 1U76A 3G65B 5HACA 2HIKA 2IX2C 4D2GA 3FDSD 3A1JC 2OD8A 1B8HA 1RXZA 5B7OA 2IO4A 1UD9A 4RJFA 3VKXA 5E0TA 3LX2A 1T6LA 4HK1A 3AIZA 3P87A 4TR6A 4L6PA 2Z0LA 2HIIA 1PLQA 1PLRA 4CS5A 3GGRA 4YHRA 3A1JB 1SXJF 1IZ5A 4ZTDA 3I2MX 1UL1A 3WGWA 2IZOB 3G65A 1U7BA 2ZVVA 3AIXB 3AIZC 5AUJA 1W60A 1AXCA 2NTIB 1ISQA 3HSLX 3GGRC 3GPNA 3V60B 2IX2A 2IX2B 2AVTA 3K4XA 3IFVA 5JNED 2HIKC 5IY4A 3G65C 3A1JA 2AWAA 1DMLA 3V62B 2ZVLA 5IWDA 1B77A 5H0TA 5DA7A 3V61B 3U60F 5DAIA 3AIXA 3GPMA 3P83A 2HIIC 1RXMA 1YYPA 1VYJA 5IXAA 5E0UA 2NTIA 2HIKB 3FDSC 1GE8A 2IO4B 3F1WA 4L60A 3A2FB 3LX1A
chains in the Genus database with same CATH topology
5E0VA 3U5ZF 3TBLA 2IZOC 1RWZA 1VYMA 2ZVWA 5CFKA 2HIIB 1CZDA 3U61F 3GGRB 2IJXA 2ZVMA 1IZ4A 2NTIC 3P91A 2ZVKA 5A6DA 3HI8A 1U76A 3G65B 5HACA 2HIKA 2IX2C 4D2GA 3FDSD 3A1JC 2OD8A 1B8HA 1RXZA 5B7OA 2IO4A 1UD9A 4RJFA 3VKXA 5E0TA 3LX2A 1T6LA 4HK1A 3AIZA 3P87A 4TR6A 4L6PA 2Z0LA 2HIIA 1PLQA 1PLRA 4CS5A 3GGRA 4YHRA 3A1JB 1SXJF 1IZ5A 4ZTDA 3I2MX 1UL1A 3WGWA 2IZOB 3G65A 1U7BA 2ZVVA 3AIXB 3AIZC 5AUJA 1W60A 1AXCA 2NTIB 1ISQA 3HSLX 3GGRC 3GPNA 3V60B 2IX2A 2IX2B 2AVTA 3K4XA 3IFVA 5JNED 2HIKC 5IY4A 3G65C 3A1JA 2AWAA 1DMLA 3V62B 2ZVLA 5IWDA 1B77A 5H0TA 5DA7A 3V61B 3U60F 5DAIA 3AIXA 3GPMA 3P83A 2HIIC 1RXMA 1YYPA 1VYJA 5IXAA 5E0UA 2NTIA 2HIKB 3FDSC 1GE8A 2IO4B 3F1WA 4L60A 3A2FB 3LX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E0V A;  3U5Z F;  3TBL A;  2IZO C;  1RWZ A;  1VYM A;  2ZVW A;  5CFK A;  2HII B;  1CZD A;  3U61 F;  3GGR B;  2IJX A;  2ZVM A;  1IZ4 A;  2NTI C;  3P91 A;  2ZVK A;  5A6D A;  3HI8 A;  1U76 A;  3G65 B;  5HAC A;  2HIK A;  2IX2 C;  4D2G A;  3FDS D;  3A1J C;  2OD8 A;  1B8H A;  1RXZ A;  5B7O A;  2IO4 A;  1UD9 A;  4RJF A;  3VKX A;  5E0T A;  3LX2 A;  1T6L A;  4HK1 A;  3AIZ A;  3P87 A;  4TR6 A;  4L6P A;  2Z0L A;  2HII A;  1PLQ A;  1PLR A;  4CS5 A;  3GGR A;  4YHR A;  3A1J B;  1SXJ F;  1IZ5 A;  4ZTD A;  3I2M X;  1UL1 A;  3WGW A;  2IZO B;  3G65 A;  1U7B A;  2ZVV A;  3AIX B;  3AIZ C;  5AUJ A;  1W60 A;  1AXC A;  2NTI B;  1ISQ A;  3HSL X;  3GGR C;  3GPN A;  3V60 B;  2IX2 A;  2IX2 B;  2AVT A;  3K4X A;  3IFV A;  5JNE D;  2HIK C;  5IY4 A;  3G65 C;  3A1J A;  2AWA A;  1DML A;  3V62 B;  2ZVL A;  5IWD A;  1B77 A;  5H0T A;  5DA7 A;  3V61 B;  3U60 F;  5DAI A;  3AIX A;  3GPM A;  3P83 A;  2HII C;  1RXM A;  1YYP A;  1VYJ A;  5IXA A;  5E0U A;  2NTI A;  2HIK B;  3FDS C;  1GE8 A;  2IO4 B;  3F1W A;  4L60 A;  3A2F B;  3LX1 A; 
#chains in the Genus database with same CATH topology
 5E0V A;  3U5Z F;  3TBL A;  2IZO C;  1RWZ A;  1VYM A;  2ZVW A;  5CFK A;  2HII B;  1CZD A;  3U61 F;  3GGR B;  2IJX A;  2ZVM A;  1IZ4 A;  2NTI C;  3P91 A;  2ZVK A;  5A6D A;  3HI8 A;  1U76 A;  3G65 B;  5HAC A;  2HIK A;  2IX2 C;  4D2G A;  3FDS D;  3A1J C;  2OD8 A;  1B8H A;  1RXZ A;  5B7O A;  2IO4 A;  1UD9 A;  4RJF A;  3VKX A;  5E0T A;  3LX2 A;  1T6L A;  4HK1 A;  3AIZ A;  3P87 A;  4TR6 A;  4L6P A;  2Z0L A;  2HII A;  1PLQ A;  1PLR A;  4CS5 A;  3GGR A;  4YHR A;  3A1J B;  1SXJ F;  1IZ5 A;  4ZTD A;  3I2M X;  1UL1 A;  3WGW A;  2IZO B;  3G65 A;  1U7B A;  2ZVV A;  3AIX B;  3AIZ C;  5AUJ A;  1W60 A;  1AXC A;  2NTI B;  1ISQ A;  3HSL X;  3GGR C;  3GPN A;  3V60 B;  2IX2 A;  2IX2 B;  2AVT A;  3K4X A;  3IFV A;  5JNE D;  2HIK C;  5IY4 A;  3G65 C;  3A1J A;  2AWA A;  1DML A;  3V62 B;  2ZVL A;  5IWD A;  1B77 A;  5H0T A;  5DA7 A;  3V61 B;  3U60 F;  5DAI A;  3AIX A;  3GPM A;  3P83 A;  2HII C;  1RXM A;  1YYP A;  1VYJ A;  5IXA A;  5E0U A;  2NTI A;  2HIK B;  3FDS C;  1GE8 A;  2IO4 B;  3F1W A;  4L60 A;  3A2F B;  3LX1 A; 
#chains in the Genus database with same CATH homology
 5E0V A;  3U5Z F;  3TBL A;  2IZO C;  1RWZ A;  1VYM A;  2ZVW A;  5CFK A;  2HII B;  1CZD A;  3U61 F;  3GGR B;  2IJX A;  2ZVM A;  1IZ4 A;  2NTI C;  3P91 A;  2ZVK A;  5A6D A;  3HI8 A;  1U76 A;  3G65 B;  5HAC A;  2HIK A;  2IX2 C;  4D2G A;  3FDS D;  3A1J C;  2OD8 A;  1B8H A;  1RXZ A;  5B7O A;  2IO4 A;  1UD9 A;  4RJF A;  3VKX A;  5E0T A;  3LX2 A;  1T6L A;  4HK1 A;  3AIZ A;  3P87 A;  4TR6 A;  4L6P A;  2Z0L A;  2HII A;  1PLQ A;  1PLR A;  4CS5 A;  3GGR A;  4YHR A;  3A1J B;  1SXJ F;  1IZ5 A;  4ZTD A;  3I2M X;  1UL1 A;  3WGW A;  2IZO B;  3G65 A;  1U7B A;  2ZVV A;  3AIX B;  3AIZ C;  5AUJ A;  1W60 A;  1AXC A;  2NTI B;  1ISQ A;  3HSL X;  3GGR C;  3GPN A;  3V60 B;  2IX2 A;  2IX2 B;  2AVT A;  3K4X A;  3IFV A;  5JNE D;  2HIK C;  5IY4 A;  3G65 C;  3A1J A;  2AWA A;  1DML A;  3V62 B;  2ZVL A;  5IWD A;  1B77 A;  5H0T A;  5DA7 A;  3V61 B;  3U60 F;  5DAI A;  3AIX A;  3GPM A;  3P83 A;  2HII C;  1RXM A;  1YYP A;  1VYJ A;  5IXA A;  5E0U A;  2NTI A;  2HIK B;  3FDS C;  1GE8 A;  2IO4 B;  3F1W A;  4L60 A;  3A2F B;  3LX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...