The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
135
|
structure length |
130
|
Chain Sequence |
ITHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEAL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription/peptide
|
source organism |
Homo sapiens
|
publication title |
Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
pubmed doi rcsb |
molecule keywords |
RNA polymerase-associated protein RTF1 homolog
|
total genus |
38
|
structure length |
130
|
sequence length |
135
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2013-06-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03126 | Plus-3 | Plus-3 domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | paz domain | paz domain |
#chains in the Genus database with same CATH superfamily 3U1U A; 2DB9 A; 4L1U A; 2BZE A; 4L1P A; #chains in the Genus database with same CATH topology 2FFL A; 3O6E X; 3HVR A; 3QIR A; 4NGG A; 3MJ0 A; 1R4K A; 4W5T A; 2XFM A; 4W5N A; 1Z25 A; 4NGD A; 3O7V X; 4NH6 A; 3U1U A; 5T7B A; 4KRE A; 1T2S A; 3HK2 A; 4W5Q A; 1R6Z A; 3O3I X; 3DLH A; 4NH5 A; 4W5O A; 4NGF A; 5JS1 A; 3F73 A; 2QVW A; 4L1P A; 3DA5 A; 4Z4F A; 4OLB A; 4Z4E A; 4NGC A; 4KRF A; 2L5C A; 4OLA A; 3DLB A; 4W5R A; 4NGB A; 4Z4I A; 2BZE A; 1SI3 A; 1VYN A; 3HJF A; 1SI2 A; 4NH3 A; 4F3T A; 1U04 A; 4Z4G A; 4NHA A; 2DB9 A; 5JS2 A; 2L5D A; 3O7X A; 1T2R A; 3HO1 A; 3HM9 A; 5KI6 A; 4L1U A; 1Z26 A; 4Z4H A; 4Z4C A; #chains in the Genus database with same CATH homology 2FFL A; 3O6E X; 3HVR A; 3QIR A; 4NGG A; 3MJ0 A; 1R4K A; 4W5T A; 2XFM A; 4W5N A; 1Z25 A; 4NGD A; 3O7V X; 4NH6 A; 3U1U A; 5T7B A; 4KRE A; 1T2S A; 3HK2 A; 4W5Q A; 1R6Z A; 3O3I X; 3DLH A; 4NH5 A; 4W5O A; 4NGF A; 5JS1 A; 3F73 A; 2QVW A; 4L1P A; 3DA5 A; 4Z4F A; 4OLB A; 4Z4E A; 4NGC A; 4KRF A; 2L5C A; 4OLA A; 3DLB A; 4W5R A; 4NGB A; 4Z4I A; 2BZE A; 1SI3 A; 1VYN A; 3HJF A; 1SI2 A; 4NH3 A; 4F3T A; 1U04 A; 4Z4G A; 4NHA A; 2DB9 A; 5JS2 A; 2L5D A; 3O7X A; 1T2R A; 3HO1 A; 3HM9 A; 5KI6 A; 4L1U A; 1Z26 A; 4Z4H A; 4Z4C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...