The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
81
|
structure length |
79
|
Chain Sequence |
LMTDAIPYQEFAKLIGKSTGAVRRMIDKGKLPVIDMTDPQSASAGEYWVYLPAWNNGLKLAYESRPKEIRDGWLMWLGL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural insight into DNA binding and oligomerization of the multifunctional Cox protein of bacteriophage P2.
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| source organism |
Enterobacteria phage p2
|
| molecule keywords |
Regulatory protein cox
|
| total genus |
22
|
| structure length |
79
|
| sequence length |
81
|
| ec nomenclature | |
| pdb deposition date | 2013-07-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF10743 | Phage_Cox | Regulatory phage protein cox |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 | Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 |
#chains in the Genus database with same CATH superfamily 4LHF A; #chains in the Genus database with same CATH topology 3Q2Y A; 3HH0 A; 3GP4 A; 4R4E A; 4LHF A; 1Q0A A; 1Q07 A; 3Q1M A; 3Q5S A; 1EXI A; 1Y6U A; 5I41 B; 1Q05 A; 1JBG A; 3Q5P A; 2OG0 A; 3D70 A; 1EXJ A; 4J2N A; 5D90 A; 2ZHG A; 2KVV A; 2ZHH A; 3EZF A; 3UCS A; 2DG6 A; 4R22 B; 3D6Z A; 3QAO A; 2IEF A; 3IAO A; 1Q06 A; 3EZ6 A; 4R24 B; 5I44 A; 1R8D A; 3GPV A; 3Q5R A; 5D8C A; 3EZ2 A; 1PM6 A; 4WLS A; 3D6Y A; 4DCZ A; 3EZ9 A; 3EZ7 A; 3D71 A; 1RH6 A; 5E01 A; 1R8E A; 4WLW A; 2VZ4 A; 1Q08 A; 1LX8 A; 2JML A; 1Q09 A; 3Q3D A; #chains in the Genus database with same CATH homology 3Q2Y A; 3HH0 A; 3GP4 A; 4R4E A; 4LHF A; 1Q0A A; 1Q07 A; 3Q1M A; 3Q5S A; 1EXI A; 1Y6U A; 5I41 B; 1Q05 A; 1JBG A; 3Q5P A; 2OG0 A; 3D70 A; 1EXJ A; 4J2N A; 5D90 A; 2ZHG A; 2KVV A; 2ZHH A; 3EZF A; 3UCS A; 2DG6 A; 4R22 B; 3D6Z A; 3QAO A; 2IEF A; 3IAO A; 1Q06 A; 3EZ6 A; 4R24 B; 5I44 A; 1R8D A; 3GPV A; 3Q5R A; 5D8C A; 3EZ2 A; 1PM6 A; 4WLS A; 3D6Y A; 4DCZ A; 3EZ9 A; 3EZ7 A; 3D71 A; 1RH6 A; 5E01 A; 1R8E A; 4WLW A; 2VZ4 A; 1Q08 A; 1LX8 A; 2JML A; 1Q09 A; 3Q3D A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
