3EZ7A

Partition protein apo form in space group i4122
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
SSQLHKVAQRANRMLNVLTEQVQLQKDELHANEFYQVYAKAALAKLPLLTRADVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGTPKYRDRYSEAYVIFISNLKGGVSQTTSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Plasmid partition protein A
publication title Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
pubmed doi rcsb
source organism Escherichia coli
total genus 106
structure length 382
sequence length 395
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
A PF18607 HTH_54 ParA helix turn helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.30 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3ez7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ez7A02
3GLIA 1KZ7B 3K9GA 4Q7MB 5FBRB 3I4LA 1LF0A 3N70A 2PJZA 3GFTA 5L3QB 5EE3A 1HUQA 2XGJA 2D7DA 1NJGA 1II8B 2N1BA 3NDPA 2IA5A 3CO5A 1E69A 2X2EA 4FWIB 1WF3A 2FEMA 1E32A 1II0A 1OIXA 5GVRA 3LXXA 4JVLA 1YU9A 5AUPB 1IY1A 1P5ZB 2OZEA 1LS1A 2K5UA 2MMCA 2Q3MA 3ND8A 5AR1A 4F4IA 1Q12A 4C0LA 5CITA 5B57C 5D3MB 5IDVA 1LF5A 2IF0A 2WICA 4BUJA 2W58A 4DLUA 4QGGA 4HAZA 2QROA 2VLIA 5JHGB 2E9SA 3J81k 4J0QA 3L82B 1C4OA 1US8B 1ESNA 3B13B 3LWNA 3NXSA 4JVNA 3PUZA 3TIFA 3U3OA 1T4GA 2R62A 2BC9A 5BWMA 1KMHB 2W2VA 4QBHA 5FUWA 4DT1A 4IDHA 2JAQA 1FX0A 4KYIB 2QORA 3K0FB 4NP6A 2ODBA 3CONA 4ABYA 1N5KA 1XTKA 1GRNA 4B3GA 1XCMA 5DLQC 3EIQA 4I1SA 1W1WA 4B3DA 821PA 3PJRA 1HT1E 4DUGA 2JDIA 4I4LA 4RFSB 3BH0A 4PO9A 2OBNA 1AZSC 5BN3A 1N5LA 4MH0R 3UMFA 3ZD6A 4TTPA 3QXJA 1OIWA 4M1KA 1GDDA 1S1CA 1U9IC 5IF9A 1G1MA 1MT0A 3CPEA 3T34A 4B44A 3OESA 3QG1A 3BK7A 1NN1A 3HYRA 2HCBA 4BRWA 4RCYA 2P6RA 2V3CC 4XWOA 1E2HA 1OT3A 2QY9A 4KO8A 1BMFA 2ZRKA 5FOVA 3CM0A 2NTYC 3DDCA 3HU1A 5DN6D 1OXSC 3CB4A 4U00A 1DAEA 3CWZA 5AUQA 4V0NA 3CH5A 4KHZA 4OHVA 2ORIA 4TL7A 4FWTA 1XEWY 4GFDA 4OI4A 2Q6TA 2AXPA 2J7KA 1G7CA 1N5IA 2A78A 2QMHA 1XD8A 3CR7A 1XTJA 4Q01A 4OI1A 1QHSA 3AF2A 3C8UA 1Z47A 3L0IB 4PTLA 2ZSBA 1LFDB 1T6NA 4BFWA 2CLDX 3RNLA 1ZVQA 4S2EA 4PPFA 1OXXK 2ONKA 1G17A 1OH7A 2JJ2D 3PENA 4OYHA 1AQUA 1AQYA 2ZYTX 3KZ1E 4QL3A 3UK6A 2OO7A 5BYJA 3TQCA 3QENA 2I3BA 2ATXA 4NZYA 3SEAA 5SZKB 1NVXQ 1Q44A 4QBGB 3AVPA 4YONB 2XB4A 3MGCA 2F55A 4JBYA 1UM8A 3FHOA 4BFYA 4RZUA 1XF9A 3Q5EA 1N0VC 2F43B 5AK0A 3JVUA 4MRNA 3OIVA 1NLZA 1RYFA 5AUNB 2CNWD 3AKDA 2PEZA 6Q21A 1CULC 2Q9AA 3CH4B 2W6JD 4D4MA 4CW7A 4Q4LA 3SN6A 5HCIA 1GITA 3CNLA 1OHHD 1JR6A 1FP7A 4P4SA 3U2QA 3WMEA 2V6JA 2XTZA 2RAPA 4IOJA 1EK0A 5LPNA 2O8BB 5KYKA 1LY1A 1T3HA 4HAYA 4YXWA 1OFIA 1FTNA 4DZZA 5EE0A 1AM4D 1G6HA 2I1VB 4XVRA 1VYUA 3UPUA 1ESMA 1E79D 1TADA 3X2SA 1KOFA 5HE8A 1JAIA 2J0VA 3FFAA 3SHFA 3LBNA 3PV0A 3ASYA 5FI1B 2QP3A 1ZCBA 4XWKA 8OHMA 4GDFA 1IONA 3KFXA 4TYPA 1U8ZA 4Y0AA 3T1TA 2EFGA 1NBMA 2GVDC 4RY2A 4KSBA 3L2OB 4TYQA 5K8IA 3K70B 1PLKA 2Z5FA 3QF4B 4NONA 1JR3D 1RFLA 3QVUA 3W8RA 3ADCA 2XZPA 2HYDA 4BECA 1EFRD 4M9QA 4ZIRB 1RYHA 4QBIA 3BH7A 3W5IA 3VR2A 1D9XA 5CLQA 1ZINA 2GNOA 1ZUNB 5FPTA 4LGMA 2ERXA 2NMVA 2ZRFA 1M6NA 1W2GA 4ZPXA 5TDHA 2V4ZA 1P2VA 4DLXA 4M9ZA 3TAHA 2O8DB 1YE8A 1E0KA 1KO7A 3ADDA 3GJ6A 1W4RA 2YJTD 4MYCA 3U44B 4BZPA 3GLGB 2QMEA 2IHBA 3GEEA 3QKRA 4JBXA 4BLPA 1PUIA 1EFHA 3DKVA 3IBGA 5A5GA 2CLSA 2QPAA 1YHNA 2A5GA 2XEXA 2R65A 4KI0A 2FDCA 4ZDKA 3RRYA 2EYQA 2IBMA 4CVNA 3K9HA 1GILA 3LW8A 1D8TA 1OIVA 2EWVA 2YVUA 3Q8XB 2GEDA 4DLTA 2CL7X 5KDDA 4OHWA 1JJVA 2LKCA 2CHVA 3FKSA 4B3BA 3T15A 4ACBA 4PSKA 2VPPA 3A1TA 1E9AA 3TUJC 4RD2A 4P33A 1GIAA 4US0R 1OB2A 4BFUA 5DI9A 2AD5A 3E2IA 3UWKA 1CLUA 2PLRA 2JA1A 1QVRA 3Q5DA 1CJVC 3CRQA 4O0MA 2IYVA 3U7FB 4JL5A 1XX6A 5LB2A 2WIBA 3VKHA 1RC8A 4DLSA 3BGWA 4YMUA 3WP0A 4O2RA 3L43A 2TMKA 3OEED 2XTNA 3F8TA 1JXOA 3O8BA 1X8LA 3QXHA 1N6HA 2HV8A 4B2LA 1Q20A 1ZD1A 1ZC3A 4CEIB 2XZLA 3KUDA 3TBKA 1A2KC 4G5RA 1CR0A 2F3TA 4ZCLA 4BLQA 1SGWA 4DJTA 2OV2A 1XPRA 2WKRA 4ILEA 4XTRA 2VP9A 1E2DA 5HE9A 1E2GA 3QBVA 1GKYA 3RLFA 2O0KA 1UFQA 1HYQA 4HLUA 3X1ZA 2PJRA 3BRWD 2QE7A 2ZRDA 5FBLB 4NKRA 4DHEA 1CKEA 5F98A 4AKIA 4QHSA 2R6AA 4GMDA 1BIFA 2BBTA 5HKKA 3NG1A 3SQXA 2FF7A 2J0UB 3QEJA 1F2TB 5L8VA 2DHRA 1E94E 1GSIA 4D0NA 4F38A 1KY2A 4UNRA 2GK7A 4KITB 2C78A 2GVZC 3FHTA 5F3WB 3THYB 4QFMA 3EG5A 3VFDA 3BOSA 2NZ8A 4B35A 1NJFA 4AKHA 3QKUA 2VSFA 4GOKA 5K8TA 1DARA 4W7SA 5EXXA 5BYKA 1KK0A 2OFXA 1GP2A 621PA 1Z63A 3AM1A 2ZYUX 1G9XA 1Z6TA 5JJLA 3H1TA 3DOFA 4DCTA 5C18A 2W0SA 3QF7A 3P1JA 5FL7D 1KJWA 2ZRCA 4OHXA 1DELA 2WSSA 2GZHA 4QJ4A 3UXMA 4MRPA 5IT5A 4WW0A 1CRPA 3EWAA 1R5NA 3RC3A 1ANKA 2DFLA 1E9BA 2NQ2C 4PQYA 5JWHA 3IHWA 3VX3A 1P2SA 4KU4A 1ZM4A 2QENA 3RANA 1IXZA 4X8MA 2P6NA 3SQWA 1K5DA 3MCAA 1ZU5A 2OAQ1 2G88A 4TMKA 1GG2A 2C96A 1YRBA 1N6IA 2YWGA 1NN5A 3C41J 3A37A 1II8A 2QMUA 5JCPA 2FSIA 2ZI5A 4OQFA 4TMWA 3R7WB 1FNMA 1HQCA 1E2MA 2JLUA 3FGNA 2Q3HA 1DAMA 1M7HA 2AHOA 5TMPA 4B75A 5DI3B 5JS8A 5J4HA 2O8CA 3LLMA 3UMSA 1OPXA 4MRVA 2WMNB 3ZQ6A 1TMKA 1KO8A 1WXQA 1WBBA 1E0JA 2XSZA 3FMPB 3GMTA 5JEEA 2NO0A 4NYMR 1OH8A 1E9FA 4AKGA 5EE5B 1ZIOA 3A4NA 2R8RA 3M0EA 3Q7QA 4GZLA 4RZ2A 4Q1CA 1P72A 4ITRC 3BJIC 5IHPA 1T0JB 2IWRA 3VKGA 2QAGA 1AGPA 2VHTA 1GKUB 2G83A 2RKOA 5B58C 3RS2A 2Q0HA 5FUXA 4A8JA 2VL7A 2MSEB 4EDHA 3IGFA 3O8RA 3WY9A 4L8GA 5CIWA 4AYXA 2H7VA 2JDID 3TE6A 4F93B 2XITA 3OHMA 2MSDB 1VG0B 1TF5A 5FL3A 4TL8A 4TZ0A 1HURA 2VRWA 1NG9A 2DFTA 2IYZA 3AF0A 1F3OA 3AV0B 4RFSA 4HDCA 3UMRA 4PXAA 4MGIR 4DCNA 4F4JA 1GL9B 4LC0A 3MG9A 4UNSA 1KK3A 4A2WA 2YHSA 2SHKA 2QT0A 1OJLA 2UZIR 1AS0A 4TT3D 1BMFD 2VYFA 4OQLA 3UG7A 3GFOA 3VTKA 4D4LA 2JJ1A 4YMSA 4LHYA 3B78A 3UIEA 1ODFA 3S1AA 3W6PA 2REOA 3LBIA 1KSFX 1W47A 4C9BA 1T8TA 4M21A 2GEVA 3LVRE 2ZYVX 4QHTA 4M1OA 2RGNA 3RABA 1P6XA 4WXRA 5G40A 3VKWA 4EIWA 1AKEA 3NHAA 2BM1A 3TKLA 4D82A 1OH6A 3KKMA 2FSGA 3OAAD 3LLUA 1D5CA 3MRSA 2GJAA 5JEDA 1TQ4A 3P20A 4B74A 2HLDA 2REBA 2QSZA 2CNWA 1DAFA 2ZI4A 3SS8A 2B6HA 1WDTA 2XTMA 4EPWA 1S4QA 5JFGA 3FFBA 3A1UA 1KI9A 1G16A 4DIEA 1IHUA 3OF5A 1G8PA 1H8EA 3U3JA 3WNCA 1W36D 2NO9A 2G9NA 4DCSA 1N0WA 1SZPA 4XVUA 2OXCA 4DEXA 3U5ZB 4A0HA 4DLWA 1EWQA 4O25A 2QRZA 1NMXA 4UQOA 5EZ6B 4I1UA 4CF7A 2W2TA 4N1AA 4XSGA 3I1FA 2ZITA 1RW4A 3ECCA 3B9PA 4JBWA 4DBLC 5HZHA 2P3SA 2C2HA 1P2TA 5G3ZA 1AS3A 3LAWA 1CJKC 5AJYA 5C2JB 1W48A 1UBFA 4JLDA 5TARA 2FA9A 2CE7A 1N2CE 2LCFA 3T1VA 2ZRHA 4LHVA 1TX4B 1VIAA 2OFOA 4MYUA 1J8YF 1JECA 3HPQA 1DADA 4DRZA 1UKEA 1O3YA 3GJ8A 4LJ8A 1XD2B 4BQSA 1WMSA 1JR3A 2VP0A 2IXEA 1Z08A 3K8YA 1AJEA 2WWGA 4MA4A 5FTJA 1U8AA 2OSBA 3LA6A 5E4FA 4XD7A 2QMOA 4G3XA 4NYMQ 2O8BA 1AIPA 1E2QA 1KDRA 1ZMXA 2D3WA 2O8EB 1LS6A 1E2NA 3ZVLA 2W83A 1J70A 1FP6A 1WRBA 1XCPA 4ASUD 5ELXA 1AN0A 1U8YA 1P62B 4A6XA 3WBJA 2FFBA 1U99A 2JGNA 2ODEA 4GBMA 5LD2C 1NBMD 4V0MA 3LH5A 4TYYA 1KKLA 4HSEA 3GJ7A 2V8OA 3SC3A 4U5XA 2HF8A 3EZ9A 4Q7KA 3FE2A 2OEPA 1X6VA 1RVDA 2PZFA 4RKFA 1SVKA 4DKXA 4CT5A 3MLEA 1R4AA 3AEZA 3B5JA 3TSWA 2QM7A 4KFTA 5KNBA 2ZS7A 1NLFA 2XXAA 1KK2A 4LI0A 2QU8A 3K0SA 5KSOA 3CUEF 2AK3A 1SXJA 1TF2A 1XMIA 2WJVA 3K1JA 1P9RA 4Z54A 2QGNA 1Z0FA 1A7JA 1IY0A 1NF3A 1E9EA 4KBFA 5FOTA 2VA8A 4IVQA 3EA0A 5AJXA 3V4RA 2QBYA 4QGHA 1N6PA 4B48A 3IO5A 1RJ9B 2NPIA 4FCTA 1KI3A 2XOKA 3QY0A 4LOAA 3ZZ0A 5KTYA 1UKZA 1S9DA 4JJZA 3RS0A 1CIPA 5SZJA 2P65A 3SOPA 3TR5A 1MRSA 1W5SA 2GAAA 4P4UA 4Q00A 2GF9A 3VMFA 4JLMA 1DPFA 3THXA 1P3JA 2D2FA 2O0JA 2ZU0C 4K81B 4L15A 4QGAA 4LYHA 4G5GA 1QRAA 5EP1A 2RB4A 4TYNA 3FKSD 1BO6A 1X1SA 3U61B 2R9VA 1UDWA 2EU8A 3EX7C 4FMCB 5F2EA 5GJBA 3F5FA 2OCYC 3TRFA 3K09C 5J47A 2QT1A 1K8RA 4HAVA 2F6RA 5KDLA 4C7OA 2J46A 2VF8A 1OFHA 4NCKA 4TL9A 3DPUA 5EE9A 3SYLA 1SKQA 2B21A 1G291 4MGYR 4ZO4A 4B73A 2FU5C 1RE0A 2OHFA 3E70C 4LX0A 2ANBA 4IJMA 3RHFA 3NH6A 1Z29A 2AWOA 1XTQA 4TSFA 2WWXA 3K0AB 3CLVA 5J4VA 2BIFA 1L8QA 1T0HB 3PEYA 1KAGA 2AKYA 2HCJB 4BFXA 2ZSAA 3L0OA 5BN4A 3CF2A 3I72A 1RPZA 1UBGA 4RCZA 2ZR9A 2W2XA 2YYZA 4IXNA 3KX2A 4US2R 3X1WA 3CX7A 2QN6A 5JRZA 3OFNA 4Q4JA 2XJ9A 3RSLA 3GFPA 3SR0A 4I1OA 4M4SA 3O8DA 1IJEA 1COWD 1DG3A 3CBQA 1JJ7A 2KWIA 5LDDC 1ZP6A 4ERNA 4MUAA 5FL7A 1Z6XA 3TUIC 5J5CA 3WYFA 5HKKD 4Q9KA 1EESA 4D2IA 3EW9A 2BBSA 3THWA 1JALA 3EASA 4DB2A 1TQ2A 1YKSA 3DEFA 3GQBA 1DEKA 2GJ9A 2FV8A 1NY6A 2J0UA 4IOMA 1B0UA 2KBFA 3VR4A 1AA9A 2IC5A 2MMGA 1F2UA 2V6IA 3GEHA 4Q1AA 4TWZA 3U3KA 4ARZA 2C03A 5JWRA 3NHBA 3PUVA 5CK5A 4BGDA 1ONBA 1NY5A 1S2MA 2BHRA 4Q03A 4XOIA 1TTTA 4R7ZA 3NC1C 2GCPA 3Q85A 2BKUA 2QA5A 1ETUA 2WSSD 1Z6GA 4TLBA 2OM2A 2YV5A 1QHYA 2ZAMA 3AP2A 3EZ7A 5DIFA 4OJKA 5G3YA 1D9ZA 1R2QA 1QHIA 1G8HA 2N46A 1MABB 4POAA 2HT1A 2NG1A 1ZW6A 4CEHB 3OIYA 2OXRA 3AVWA 3IEUA 4X8LA 2AFHE 2W6IA 2DBYA 2BCGY 3QVVA 2R6GA 2BOVA 2ZS9A 3NBXX 2BKEA 5JECA 4Q9JA 2C9YA 3HU2A 1U0LA 4B32A 4Q4HB 5CDFE 1TPZA 4QKQA 3SFZA 5KOYA 2OE2A 3H84A 3QEOA 4IHQA 4M2LA 4NCIA 1GUAA 1CEEA 4NCHA 4W5HA 3ZIAA 1XZPA 4FI3C 1KTVA 5DH9A 3O8CA 1LV7A 2OLJA 3LV8A 3VR3A 3AKCA 1CJUC 2ZI3A 3SJZA 2VH5R 3SE0A 2ZPTX 2HJGA 4X8OA 3QKSB 1ZYUA 4BLTA 3IQXA 1TQ6A 1DAKA 2BJVA 3W3ZB 2XSZD 3SU8A 4EPVA 2IUSA 5AJZA 5CJPA 3AGPA 2XAUA 3B8HA 2A7QA 4LDJA 3ZYCA 1KY3A 1X86B 3NIBA 4NYIR 1AZTA 1EG7A 1ZM7A 4OBEA 4K8OA 4TT3A 121PA 1XJCA 4JLPA 1SVIA 3QNUA 1LNZA 2XNSA 5GADl 3DOEA 3AF1A 3RVBA 4HUQA 2F1IA 1GNQA 5KSPA 4Z1MA 2C77A 2AX4A 2ATVA 1IJFA 1MH1A 3BXZA 3FMOB 1N25A 4FIDA 3NEJA 2B7CA 5A0FA 1KKMA 2IXFA 5LD2B 1NVVR 2AD1A 4M0LA 4AK9A 3DL0A 3R8FA 1XXHE 4QHYA 1KI1A 4AG5A 2NZJA 4NHOA 3OAAA 4PZYA 2FJUA 3JVVA 4DDTA 3IIMA 4QNRA 4LZZA 2JLVA 2P5TB 2AWNA 2KBEA 4AWXA 4A2QA 4LC1A 2JLXA 2X19A 3RRZA 3BB3A 2PH1A 4EAQA 3FOZA 4QXAA 2JJ1D 3EPJA 2YC2C 2REXB 1GAJA 4EUNA 3R20A 1JR3E 4EQ6B 5KSZA 4BLSA 3DVLA 4HDOB 2O5VA 2B7BA 1WQ1R 1L2TA 3AGQA 3EPLA 3T1OA 2BV3A 3CW2A 1G4AE 3BB1A 4K46A 4Q9HA 4BFVA 2RGXA 4PFSA 5FOWA 1N6NA 1UPTA 3TVDA 4V0KA 2HLDD 4MRSA 3CRW1 4V0OA 3T12A 1JBKA 2GBLC 1KAOA 4HLDA 1R10A 2ZSEA 1XPOA 4D4KA 2IYWA 5FPYA 2WJGA 3HYTA 1DBSA 3HWSA 1H8ED 1OXUA 2Z4SA 3CZPA 2F7SA 3KXKA 3D31A 1XXHB 4WAUA 3G0HA 2KJQA 1J90A 4IEIA 2Z43A 1CR4A 2C8VA 3AVUA 1XJ0A 1SKYE 1S1MA 1JI0A 4W9MC 1YZGA 2VSXA 4N0DA 4L9SA 4WZBE 1XTRA 4QM7A 2X2FA 4PHGA 4Q66C 3GEIA 2E87A 3LD9A 1GOTA 4C0JA 1QZXA 3BFVA 2G1JA 1Z0IA 2JATA 4ASUA 2WTUA 3TAUA 4FMDF 4ZKDA 1MV5A 2O52A 2WZQA 2WSMA 2FG5A 3FWYA 5DE3A 4R9UC 3TH5A 4BFZA 1DE0A 2PL3A 3B2EA 2VTKA 4V0LA 2QG6A 3U7HB 4HZUB 1Z83A 4RD0A 1E99A 3QE0A 4UNPA 5JSZB 3IBYA 5G53C 3NKVA 2FZLA 1N6OA 4IDQA 1NVUQ 4M8NE 1QF9A 3BS4A 2GXUA 1SVMA 1XD2A 2JLRA 4XD7D 5EXPA 4A15A 3AVVA 3SZRA 2DCUA 2ZIAA 4P31A 4G5QA 2JLSA 3OEHA 4EJSA 2JEOA 2RGGA 4NYIQ 1BOFA 2VHQA 1OFTA 3KTAA 5E95A 1FQKA 3SBDA 3K0CA 4D6PA 2NO6A 4EFMA 4EPRA 3X1YA 1NNEA 1M2OB 2B8TA 3BFKA 3QPUA 3PUWA 2C5LA 4HB0A 3EZ2A 1OW3B 3E1SA 3CRVA 3WYAA 4TQ9A 3B1WA 1XEXB 3GLFA 4CRWB 5DGXA 2OCBA 2WWHA 5FPHA 3REGA 3IHLA 3B7GA 3SYKA 1BYUA 1NVVQ 4JVMA 1W5TA 2WJYA 1W36C 2J7PD 1GVNB 3TW4A 2ZE5A 1RRCA 4LV6A 1M7GA 3FB4A 3LW7A 2NGRA 5AWFC 2W00A 4NBSA 1Q0UA 1SXJD 4M53A 4JLBA 3PIRA 1Q22A 4KYUA 4URUR 4CT4B 4C30A 4QJ3A 3TJZA 2XNDD 2BMJA 5L3SA 1QHXA 1VECA 3SBEA 1Q1ZA 2GCOB 1EX6A 3GJ0A 3NBFA 1R0YA 4Y0VA 5FR1A 5FBWB 2DY1A 1Z0DA 2XOKD 1OLOA 1R0XA 2QSYA 3VHLB 2CJWA 1KI6A 1KZGB 1MRNA 1T9HA 3EWSA 4MUBA 4AKEA 1S9HA 2LWIA 3U4QB 3KKQA 4CEJA 1Q21A 4HAXA 2FEOA 1G3UA 3EZFA 2BVNA 3K9NA 4QG7A 4YDHB 1DTSA 4A0GA 2ONJA 4U02A 1IY2A 1Y3AA 2ZAOA 4NE2A 4Q4AB 4TMZA 4WOPA 2A30A 3MJHA 1T5IA 2EFEB 4S35A 4WXPA 5EP4A 5FOUA 3SJCA 2O0HA 2Q9CA 4M22A 1F5NA 2ZTSA 4MRRA 5BQ5A 4B3CA 1T3LA 5BXQC 5AJVB 4F4CA 3GLIE 3FMFA 4YC7A 1L7VC 3MMPA 2WIAA 2F3RA 2QQ0A 2H57A 1G8YA 4LY6A 1Q3TA 4HAWA 3SYNA 1NN3A 1YR7A 5HCNA 2ECKA 4A82A 3WYGA 3ND9A 3CX6A 3Q72A 1SVSA 3TR0A 1G8FA 1NL3A 2FPLA 4PC3A 1COWA 3N2EA 4Q5IA 4DLYA 4TSFD 4HAUA 1TUIA 2ASEA 4AG6A 4HUTA 4WIAA 1TF7A 4PSAA 1E9RA 1E0SA 5K8LA 4LHZA 2FPMA 4LV5B 3U7GA 3B9QA 3EARA 3K0AA 4QRHA 1TEVA 1KDOA 5C1BA 1MKYA 1E4YA 1QHHB 2H8KA 2A5DA 1ZD8A 3A4MA 1KSGA 1NMZA 1R8QA 3OFND 1UEJA 4W5JA 4X8HA 1JEDA 1JEEA 1W4CA 3VU9A 2FSFA 2JLQA 2ZEJA 2Q3FA 2E1RA 1NIPA 5TY0A 2BMDA 3I73A 1W0KA 3IILA 1OFUX 3CNOA 4FCVA 3VAAA 3PEWA 3GLHA 5FFMA 4FN5A 1EXMA 2GESA 3ZJYA 3QI2A 3GLIB 4BFTA 4WZAE 1OSNA 1SVLA 2C99A 5H1YA 1G6OA 1NKSA 4B47A 4DCUA 2WJHA 4Z8YA 5FTNA 3PQCA 3UWOA 2JJ8A 2WKPA 1EFUA 3LXRA 4MKHA 5EXSA 1FW6A 2VSOA 1KIMA 1J8MF 1KI2A 4GOJA 2J87A 2XJ4A 3RYTC 4UXJA 2ZETA 1GFIA 2PBRA 3BERA 4TL6A 4LJ9A 1P75A 2ZJ8A 3M1IA 2J5XA 2RGBA 1M34E 4PPGA 5L3QA 2ZJAA 4LBZA 4BLRA 2ZS8A 4IKEA 4RFVA 1XPUA 3AP3A 3VQTA 1KYIA 1L4UA 2IX3A 1ZJ6A 4JKYA 2FSHA 3CRMA 4PAMA 1RIFA 3LQRA 4YMTA 5HTKA 1NLYA 1P60A 2GDJA 1FFHA 1HH4A 3OIUA 3FYHA 3P27A 2OBLA 4NH0A 4PC1A 1E3MA 1VHLA 2A5YB 3MWJA 3ZVNA 4CGZA 3CR8A 3BORA 2W6ID 4DT1B 4D0LB 1FX0B 2ZI9A 5D3MA 1WP9A 3CKLA 4CEHA 2DWPA 1GNPA 1R5OA 3VHXA 1T5LA 1N5JA 1P7CA 4PAQA 4PZLA 4PX9A 4EPXA 1HE8B 1E9DA 1E2IA 1VMAA 1US8A 3IIKA 4R71A 3U3RA 2H92A 4P0TA 4B76A 2DB3A 3LNCA 3ZIAD 2Z0MA 4D26A 3QPVA 4HLUC 1E2PA 1KMHA 4XVQA 4RJLA 2W0MA 2H5EA 3K0FA 2FH5B 5TVKA 4JLOA 4TQAA 4ZDIA 1G8GA 4MKIA 2PT5A 1DVRA 1FUUA 2QUZA 5KUTA 2EW1A 1W2HA 5EP3A 4F92B 4LUCA 3IPYA 1VPLA 5A4JA 3Q3JB 1CJTC 2ZUDA 4YMWA 2EQBA 4DIDA 4NMMA 3ETLA 1MO4A 1XFAA 4FW9A 1XMJA 3WHLA 5JS7A 4KVAA 4OHZA 2OCAA 1EGAA 4JL8A 1XB2A 2CCKA 4ZKEA 1ZNWA 3C16C 2NO7A 4HEJA 3N2IA 3B6EA 3EC1A 4Z1MD 3VR1A 2UKDA 2AR7A 1E2FA 4TMVA 5FOXA 4DEYA 4LJ5A 1U94A 1ZNZA 1VG8A 3NEYA 3UG6A 2P5SA 1G5TA 3I3SR 4GT1A 4V02A 2QGZA 3EIHA 2HXSA 4EPYA 3KJHA 1DO2A 1CR2A 1QG2A 1H8HA 4B71A 2AK2A 2EFCB 1G19A 2QAJA 3DZ8A 3TK1A 3EAQA 1UKVY 2CCGA 2ZI6A 2X1VA 1W36B 2GHIA 1U0JA 1WA5A 4G5OA 2ERYA 2GJKA 4LYJA 3C15C 1Z0JA 4MKGA 2GK6A 5JI2E 5DNYB 1NBME 1G7RA 3CWQA 4Q02A 4BFSA 4JJKA 4KODA 2IWHA 2FNAA 2QI9C 4C2TA 1NG1A 2VHUA 1IN5A 5KNCA 5CM8B 2IS1A 4IFEA 1VCMA 1Z5ZA 2VIIA 3PUYA 2JIZD 5J4KA 1E1QA 4IEEA 2G3YA 1G64A 1VDZA 4PHFA 3ZGXA 3A1WA 2RHMA 5CB6A 2DWOA 2H17A 4I99A 3SI7A 4HLCA 5DYIA 2ZQ5A 4JT2A 1BH2A 4PQFA 4ZDWA 1KMQA 2IYTA 1WBDA 2F43A 1UEIA 2Q21A 2PT7A 1GTVA 2QAGC 3IQWA 4QJ5A 4IFBA 2GKSA 4JYBA 4R2IA 3GLFE 1R7RA 1F60A 2QL6A 5JJIA 2C95A 4A8JC 2GZAA 5JJKA 1GRRA 1K6MA 2HDNB 3A1SA 3R9XA 2ZUCA 4HYYA 2B92A 3K09A 5B64A 2GJSA 4JLKA 1TU3A 3D3QA 4US1R 3AVTA 2WOJA 2D4HA 4N3NA 2BJWA 2ODWA 2PZEA 3B85A 2B8WA 3TQFA 1G41A 2OG2A 2PCJA 4C0KA 5DHAA 1KO1A 2KSQA 3LQQA 2ZJYA 2FPKA 2QPOA 3X1DA 2ZU6A 4PAOA 2CVFA 1KNQA 2QZ4A 1SVWA 1PLLA 3GJ5A 2Z6VA 3NTUA 4URXR 4BZQA 4JKIA 2ZJ2A 4DDVA 2F1JA 3QF4A 2FZ4A 4JL6A 1HV8A 2J7PA 3IDQA 2RGNC 2CK3A 3OEHD 4A1FA 3PCRB 2UZ3A 1OYYA 2IK8A 1JXMA 4ZIRA 1CBUA 4D0GA 3KB1A 2QRNA 3QKRB 3DHWC 4MYHA 1ZNYA 1S96A 1R0ZA 2BEKA 3B1YA 1X1RA 4L16A 4H1VA 4Z51A 5KSYA 4ZI2A 2XNDA 3UANA 3QSYA 4I81A 2VHJA 2ZJZA 1YZKA 4TLCA 2O8DA 3QQ5A 721PA 2AN9A 1IOZA 2ZRPA 3PR1A 1KGDA 1LW7A 4P3YA 4EFNA 3U44A 3KDSE 3GLGA 1FMJA 4NDZA 3OIWA 2IW3A 2FFHA 4OK3A 3KKOA 4IDPA 1XTSA 4DDUA 521PA 421PA 5JMTA 1XEWX 2F9MA 2L0XA 2QP9X 1ZM2A 4TYWA 4MKFA 4QM6A 5L3VA 3LBHA 1FTSA 5F9HA 1W0JA 3RRNA 4LHXA 2J59A 3LO5A 3PEUA 4IW3B 3HR7A 5JI3E 4JVSB 4XTCS 1G18A 3ZDQA 1NRJB 2WOOA 3MJRA 3IEVA 1TL7C 2EWWA 2PX3A 3CX8A 1YZTA 3P26A 4PC6A 3MWLA 5FTMA 4HB3A 4Q48A 1N6LA 1S3SA 3AQ4A 1V43A 3TMKA 3F0TA 5UKDA 3KKPA 4A4DA 5CK4A 4P4TA 3MWKA 3NBZC 1MO6A 3EZ6A 3W34A 2WPDA 4NYJR 5L3RA 4NCJA 3EIEA 5J4LA 5FTKA 1VYTA 2HJVA 5FR2A 3WNBA 4ZCMA 1OYWA 5GJWC 3NVAA 4LK2A 1YR6A 4MYTA 1AKYA 4IVPA 4DWJA 2IF2A 1MR3F 4TTQA 1T91A 3C4JA 4OI0A 1BKDR 4KFRA 4ON9A 4U7DA 4CEIA 1FPMA 3MUFA 5SZHB 3NC0C 3HU3A 4NCNA 4B2IA 3TUZC 1ZM9A 5B30A 4JS0A 5JBQA 1G21E 3HDTA 4ZV4A 2ZREA 3F3YA 2CMKA 3Q7PA 4LJAA 3U6BA 5EQTA 1U0HC 4PO8A 4TN1A 5GVSA 1B23P 1PZNA 4BE7B 4JZKA 3FDIA 1U9IA 2P0EA 2A3RA 2HEIA 2Z83A 1XZQA 4HB2A 4UXIA 3GCGA 3PXGA 2BCJQ 2X77A 1CJMA 1CU1A 1P4SA 2FE4A 3T61A 1RRFA 1SXJC 2GETA 5HZKA 1TU4A 2OESA 3KXIA 4GOXA 1F2TA 3V00A 1LB1B 3KJGA 4AY2A 3DMNA 1E1RA 4KFSA 1XWIA 2ZR0A 4Q1FA 2RGAA 1P73A 1DAGA 4LHWA 3AF3A 3U6KA 2WMOB 4FINA 3BD9A 1W0KD 4LPSA 3THYA 1XBTA 5GJCA 4GMXA 4KLNA 4R98A 2QP4A 4G5SA 3FMIA 4PHTA 1N0UA 3QPWA 1Z8FA 4TLAA 4A2PA 1IM2A 2H1LA 4LJYA 1E2KA 1X8JA 1IAQA 3H4MA 3DMDA 3QJYA 1Q1EA 5FBVB 3ONWA 5E7JA 2IXGA 4QBFA 3SDZA 2O8FB 3KUCA 3AVYA 4AIIA 1E9CA 5TB5A 1EWRA 4HATA 2GF0A 1E2JA 3WMFA 4DSNA 3U7EB 3U3MA 1VKJA 3ADKA 3IKJA 4PANA 2IS4A 3C14C 4GP7A 1QHGA 4UXHA 2CEAA 4WA7A 3BH6A 2ZVQX 1TEXA 1E6CA 3DO6A 3HP1A 2IUTA 4GI7A 2O8CB 4WVFA 1I2MA 4JLJA 1UJ2A 2BEJA 4KJZA 4Q9IA 4RD1A 1VIYA 3AB3A 3O47A 3KJIA 1IN6A 3WXMA 1YZUA 2F9LA 2GWHA 1F48A 1EFCA 2VHCA 1JPJA 1W44A 2R6CA 3GPLA 2R6FA 3VNVA 4E07A 2ZRGA 1Z28A 2RMKA 3R7WA 1Q57A 3AVQA 1ZNXA 2ZRMA 2GBLA 3I62A 1XTIA 2QAGB 3U60B 3RDPA 5DI3A 2NPFA 1U2RA 4FMBB 1JNYA 1G3MA 2F1HA 4ESHA 4DLZA 4A8JB 3FVQA 1S0UA 3EC2A 1YZLA 2YOGA 4B34A 3QG5A 3TW8B 4KCGA 4Q1DA 3TLXA 2RGDA 2ZRLA 4PC7A 4L4UA 3QKTA 5JCZA 3D8BA 2AKAB 4NTZA 2PZGA 4RKEA 4NYJQ 3AVXA 2V1XA 1UF9A 1G5RA 2P6UA 5D3QA 2V1UA 2GXSA 1A2BA 2ZE6A 4DLVA 1L4YA 1ZU4A 2P2LA 1DAHA 1HTWA 1UKYA 4XSHA 1XD9A 4IDOA 3DM5A 2DFKB 2CBZA 3LX5A 4Q19A 3BIFA 3TSZA 3A6PC 3H86A 1OV4A 4G1UC 4GPTA 3ASZA 1ZAKA 3VNUA 2WKQA 5JWOA 2HF9A 3PFIA 3S1AB 4BEJA 2AXNA 1ELOA 2CHQA 2G0NA 3OE7D 5KU1A 3W6OA 1KDPA 4JMPA 3SNHA 3THOA 3ICQB 1E9SA 4URYR 2C98A 5JRJA 1ZRHA 1A4RA 1PVOA 4C0BA 3NWJA 3T5GA 1D2MA 1S8FA 5CB8A 4OQMA 4LV8B 2ZRAA 5TV2A 1W46A 2JLZA 2JIZA 1K5GA 3N5CA 5EZ5A 1G7SA 5IRCD 1H8HD 5HR5A 4E22A 1G3QA 2X8AA 2JLWA 1E4VA 4YQFA 1KNXA 2I1QA 3W5JA 2VBCA 3OZXA 2FWRA 2NIPA 4B43A 3AKYA 1CF4A 4AYTA 4FMDB 4V0ME 1XEFA 4NL4H 1MO5A 2WWIA 2V7QA 4CIDA 4A0FA 1NKTA 1P9NA 4PC2A 2ZRNA 3E5HA 4BWYA 1TUEA 3ZVRA 2IYXA 1E1QD 4LJ6A 3UKDA 3W90A 4C3ZA 1XNJA 3I5YA 1W4BA 2R6DA 2YNMA 1SQ5A 3QBTA 4C0QC 4KXFB 2EFHB 2FGJA 5E7MA 1SXJE 3JZAA 1ZC4A 3T06B 4B33A 2PMKA 3FTQA 4M1SA 1KK1A 5DYGA 1IXRC 3PEVA 1SHZA 1GM5A 3PG5A 2EVWX 4A6PA 2RHDA 1Z2CA 3FKQA 3HPRA 4LWZA 4LYAA 1ZIPA 4TTRA 1Z6AA 4D4JA 2VEDA 5GJVC 1KO4A 3GJ3A 3A36A 4JLAA 4NU0A 2IYUA 2H18A 3G5UA 4M1YA 2R44A 3GLGE 1XJQA 2VO1A 3FHCB 4DLRA 1GKIA 2IT1A 1UDXA 4Q21A 1RRPA 3VR5A 1A5TA 5FI0B 5H8WA 1NVWQ 4JSTA 3ZZTA 1VCIA 3TGPA 2PMDA 4C0HA 3DKPA 3L0PA 3X1XA 4GZMA 1N6KA 2Y8EA 3P32A 3TSOA 5B2ZA 3W8NA 4LSGA 1TQDA 3W6NA 4Q1BA 2J0SA 1UBEA 4A92A 1SULA 2O8EA 1VTKA 1HE1C 2V55B 2XZOA 4M1MA 3GJ4A 2WWYA 2R2AA 1SKYB 1Z2AA 1R8SA 1G5PA 1RKBA 3GJXC 1Z0KA 3KL4A 5KHOC 2ZJ5A 1IXSB 2XXAB 5C4MA 2ZR7A 2J1LA 2QNRA 3KB2A 3ZD7A 3K70D 1SXJB 1RZ3A 3IUYA 2KE5A 4QOSA 4A36A 2DPXA 3ZS8A 1KJZA 1VCNA 2CK3D 3EPHA 4HB4A 3KKNA 4ZDJA 2NOAA 1W49A 2QBYB 1YQTA 1KJYA 4GL2A 3BFXA 5BN5A 2CVHA 3T35A 4DB4A 4URWR 4QGFA 2GEUA 1V5WA 1OKKA 221PA 2CLCX 2YWHA 4Q47A 1I4DD 2FFAA 4RD3A 4F7WA 1I4LD 1OXVA 2AFIE 2D74A 3THXB 4RSGA 4KSCA 3KXLA 4JLNA 3C5HA 4WZ6A 3CPJB 3AH8A 3I32A 1RJ9A 1G4UR 1NSFA 2WAYA 4URVR 4OK5A 2GILA 1Q1BA 2IYLD 3I8XA 4MGKR 3ZH9B 4JYCA 2BM0A 1FQJA 4DVGA 2HT6A 2IHYA 4IOKA 2FX3A 4C7OB 2HUPA 2OCPA 1W0JD 2YOHA 2IYQA 2YKGA 2WHXA 5H68A 2ZRJA 1NSTA 3WMGA 2JCSA 4XH9B 4DCVA 2YC4C 2XX3A 1TNDA 4YMVA 4H9GA 4MQBA 2G77B 2J9RA 3MWYW 1XU4A 1U98A 3EXAA 1C1YA 3CF6R 3WRXC 2V54A 4N0EA 1ZCAA 4AI6A 3ZVMA 2KI5A 1NN0A 4AURA 4Q1EA 1E0AA 1D6JA 1T3SA 2DYKA 3BBPA 3BE4A 1X3SA 2FFQA 5ANRB 2OUKA 4M9XA 2ORVA 4KLZA 4W5WA 1J7KA 1XCGB 2WPDD 5J40A 2KB0A 2VP6A 4DSOA 2DR3A 1BS1A 2GXQA 3T5DA 1IBRA 4Q4JB 4EJSC 1SVOA 1GWNA 1DG1G 2ODNA 2OFWA 3M6AA 3QIAA 4C4PA 3K0CC 4UJ3A 1O87A 3ICEA 4RD4A 2VP4A 1J2JA 1D2NA 4JLVA 1W7AA 1IN4A 2D2EA 1Y63A 2BMEA 2ZJBA 3D6TB 1LVGA 3THWB 2PCLA 1FUKA 4D25A 3PVSA 1KSJA 2RGCA 4PZZA 2ZANA 4HLQB 3CNNA 4UJ5A 4EKDA 1U81A 1GNRA 5EUMA 1WCV1 3ZLJA 1IQPA 3SJAA 5DHFA 4ARZB 1F2UB 3MFYA 3A4LA 4LJ4A 2OAP1 2HXYA 5IK2D 1EFTA 1P2UA 2J41A 3R8CA 4B3XA 2P67A 1R0WA 3KQNA 1Z06A 2ZM5A 4LJ7A 1H65A 2AL7A 3V9PA 4LBVA 3H2YA 1JPNA 1XMVA 1Q3HA 1E1RD 4C0SA 3CF0A 3WHKA 1Z07A 4TQUS 2J3EA 1DS6A 3P4XA 1I2DA 1HA3A 4ZCIA 5KDOA 4B3FX 2D7CA 4MDFA 1A1VA 4BZXA 1JB1A 3LDAA 4PO1A 1UBCA 1M74A 3Q9LA 5LBIA 3AF4A 2VP5A 5CLLA 2CHGA 3B60A 1II9A 2QTHA 3A8TA 2IYYA 5FPSA 4B6EA 2IUUA 2WJJA 3M4YA 5SZIA 1PJRA 2G0TA 2J0QA 3I92A 1ZUHA 3RSOA 1LTQA 1MABA 1I4TD 2QQEA 2ZE7A 2VP2A 4LPKA 1HT2E 4M1WA 5CYPA 2IYRA 2O8FA 1ZD9A 3NBYC 3W3AA 2G6BA 3P4YA 1J99A 3DZDA 2BWJA 2BDTA 1M1YE 4NPHA 2C9OA 1E96A 4MGZR 4Q4HA 5CM9C 2QM8A 1HY3A 2ZRBA 4AD8A 1P61B 4LCBA 1TAGA 3TVTA 1YR8A 5LB4A 1ZM3A 5TXGA 4AYWA 2YOFA 1BYIA 4PQRA 4R2HA 2OT3B 3SHWA 4FXPA 2GXAA 4IVRA 4V03A 1QBKC 2PEYA 5BW8A 2JLYA 4GRAA 2GTPA 4UNNA 3IPXA 2ZJOA 1YRAA 2I4IA 3QKSA 4MITA 3RRMA 3BB4A 2Z4RA 2D06A 3RWOA 3HR8A 2IS2A 3LX8A 4HUQB 4C0AC 1JQJC 4D80A 4RZ3A 3R9IA 2GAOA 2WVJA 4JIMA 3OE7A 3AUYA 3H0KA 4I1VA 1YJ5A 3AUXA 5DN6A 3AP1A 5CJ2A 2CCJA 3RS3A 1VCOA 5JHHB 3EPKA 1FMLA 2QTVB 3MD0A 4DDWA 4DUGD 5AUOB 4UKDA 1PLJA 4A0RA 5K8UA 4DSUA 1DO0A 1R6BX 5AJWA 2H16A 2A5JA 3B1ZA 2ZUBA 4G01B 1RRGA 4PHHA 4LBWA 3KFVA 4HI0E 4OK6A 4GP6A 4CDGA 4OJQA 1YR9A 5JLJA 1AK2A 4URZR 4IDNA 3ZZUA 3IIJA 5CDFA 2QPTA 5E7IA 4M9SA 5CIQA 4F91B 2IL1A 3KQLA 3K0EA 5FUYA 1KI7A 4L9WA 1FZQA 4EFLA 3DM9B 4BPBA 4KFUA 2JJ2A 2WM9B 2OLKA 1OF1A 2VF7A 2WAXA 2ANCA 2ZSDA 2N42A 1Z22A 1N6RA 3I5XA 3GP8A 1Z3IX 3TNFA 3NDBB 4Z8XA 2ZSFA 3EA5A 1KDTA 2BBOA 2CDNA 3RS4A 1NP6A 1P9WA 1SHKA 2FOLA 4YDSA 5P21A 3ADBA 4OI2A 4EQ6A 2XB2A 2LKDA 4TLDA 2F1RA 4OQNA 1S3GA 3G82C 3HJNA 2WWFA 5FUVA 2NO1A 1D2EA 1CS4C 1OB5A 2CL0X 3BC1A 3RWMB 3I61A 4P4SB 2W6JA 4RVCA 5FTLA 3JZMA 2FN4A 2CE2X 1PUJA 3LY5A 2GJ8A 1HQYE 5E3HA 4O2LA 4LBYA 1OE0A 1KI8A 1OHHA 2V7QD 4CYMA 2BBWA 4H1UA 1VG1A 2RCNA 5DO9A 2ZXUA 5FPKA 2JASA 3MAAC 1QDEA 3T1QA 3CIOA 2WBLC 3FPAA 3L8YA 3V4FA 4MDEA 1Z6YA 2Q9BA 2WV9A 2ZROA 3BWDD 1E79A 1XXHA 1CXZA 3B1XA 4O3MA 4BEBA 1QG4A 1ZUIA 1R5BA 4KAXA 3AKEA 3C7KA 5FBQB 4TMXA 4Q7LA 5DISB 5KNDA 4PR0A 1DOAA 4QC2A 2MSCB 1AS2A 3WRYC 5C46F 2RGEA 2A2ZA 4M1TA 4OHYA 2ZVPX 4PPQA 4Q18A 2ZE8A 4FD2A 4E03A 3A1VA 5H70A 4D81A 1YZQA 2FMXA 3B82A 4OL0A 4YXWD 3VR6A 3LFUA 2A5FA 4JSYA 1XP8A 3W9YA 4ACAA 1EFRA 2GCNA 2ZYWX 3REFA 4EJSB 3R9WA 2IEYA 3CRRA 3K9LA 2YWFA 3KJEA 3QXSA 5G41A 3UATA 3MSXA 3KTAB 4EPTA 4HZUA 3D7MA 1G3IA 4DSTA 1WE2A 5JSZA 5EXTA 1XDBA 5FOSA 1CR1A 1OXTA 3NH9A 1E98A 4XIGS 1U90A 4E5UA 5C4GB 1IN7A 4HZIA 3QUSA 3GLFB 5JZVA 4HDQB 1A82A 4PPNA 4GNKA 1VYVA 4BASA 1N3BA 4P32A 5EP2A 4WBSA 5F9FA 3B1VA 1YVDA 4XWAA 2CXXA 1KHTA 2CL6X 4DXAA 4ESVA 3ZQJA 4B6FA 1CP2A 3CZQA 3LVQE 4II7A 2PX0A 4LRWA 1GZSA 4DC9A 2ZI7A 1XEXA 5L3SB 3IO3A 1NMYA 2UVQA 4OQXA 3SFVA 4YLGA 1AGRA 4L5BA 4RD6A 2QEQA 1XRJA 5EUQB 5EJEA 3CPHA 3PUXA 2CJWB 1KI6B 3KQHA 1NI3A 4KVGA 4TZ6A 1NIJA 4GSYA 1OKKD 2BMFA 3SJBA 4CEJB 1FOEB 3RS7A 4XJXA 4UNQA 1WB9A 4RZXA 1FNNA 1M8PA 2J45A 4TLEA 1MOZA 3RAPR 2VQSA 4IRUB 2G1KA 1GRQA 4BLOA 2YWEA 1M7BA 2DFNA 2GCOA 2GZDA 3KQUA 3LRPA 3AVOA 1G20E 3GLHE 1KSHA 1VHTA 1QHNA 2ORWA 1EX7A 3QOFA 3U4QA 4AC9A 5KO2A 1CTQA 1GL6A 4Q9LA 1JAHA 1QVAA 4TMTA 5CYOA 1W4AA 2RH5A 5M04A 2IEZA 4LYFA 3OEEA 3K53A 3PITA 5KPJA 1VG9B 2D62A 2FGKA 4IXMA 4Q4AA 4C2UA 1F6BA 5J4YA 1G3RA 4CZ2A 1JQLB 2WJIA 3A58B 2YZ2A 4G0NA 4E09A 2V9PA 3VX4A 3WP1B 1DAIA 2EFDB 2C9CA 1ZBDA 2EYUA 3I8SA 4FCWA 3WNDA 5KPDA 2IS6A 1C9KA 4KBGA 4A9AA 5HPYB 3KQKA 3RC8A 3GD7A 2HYIC 1XMSA 2C04A 3C5CA 1PV4A 3QXXA 4FMCF 3K70C 1CRQA 1E2EA 2DWQA 2IYSA 1OH5A 1GL7A 4OKSA 1IN8A 3QXCA 1HEIA 3L8ZA 2A9KA 2OBMA 3VU9B 1YZNA 3ZS9A 1UAAA 2ZRIA 4Q7JB 5IK2A 4ZI3A 3RS5A 1KO5A 5DSZA 4QNMA 2WWWA 3GLHB 1Z0AA 3L0SA 2QTFA 1Q1QA 1E2LA 4KV9A 1T8UA 2GA8A 1X8KA 2QE7D 4PSVA 2OILA 1FL9A 1KI4A 1QHHA 3WBKA 1UADA 4B2PA 1MO3A 3BAFA 2YINC 2PLFA 4BRUA 1G7TA 2GRJA 4JT4A 5EE1A 4IOLA 5FH9A
chains in the Genus database with same CATH superfamily
4CDMA 4WK4B 1P2GA 1EFVA 2HSWA 3LSTA 4FNGA 4H60A 2E21A 3N70A 3N0RA 2JZNA 1JLMA 4I8DA 2VDVE 3BGOS 1RBZA 4QFCA 1XCLA 3GLSA 4WLOA 5EE3A 3UUGA 3T5CA 5C7IO 1TEHA 2C5FA 2Q6OA 4XLTA 3NDPA 3S0JA 4DQXA 3D71A 1E69A 2A9QA 3DHVA 3PUKA 4IILA 5BSVA 3UZUA 1QX4A 4U3JB 1I7NA 2XDAA 1TQHA 1SG6A 1OIXA 1SOAA 3I83A 4KJXA 3C1UA 1YU9A 3DZBA 4TXNA 1P5ZB 3UHAA 3AHGA 5D3ZA 5BUSA 1N2SA 3E9NA 5C1DA 3DEJA 5T3UA 2ZWMA 2BE7A 2MMCA 1EFDN 2Q3MA 3TLAA 1SY7A 1MX9A 2IOQA 4X1YA 4CR8A 5B57C 1RQXA 2EBWA 4PYLA 1Z6ZA 5D3MB 5IDVA 3R75A 4E5NA 3MUEA 4DLUA 5B7NA 2I03A 3JQCA 4HAZA 5D01A 3AX6A 3ZTYA 2HBYA 2ZJ4A 3P97A 3KAJA 4KAJA 1R8EA 3R7LA 3WDSA 3PLAE 3KKKA 3P94A 3BGIA 1J25A 1JQ3A 3LWNA 4Y67A 3IUEA 2HK9A 4Q3BA 1EJBA 3ZNNA 2R62A 5BWMA 2W2VA 4QBHA 3M9XA 1UUFA 3RUPA 4KN8A 1VKHA 1FX0A 1FBTA 2WQ7A 1GRNA 1J9GA 1F8XA 1IHXA 3E9YA 1HQKA 2WUFA 2BFWA 3GJSA 1W581 2MINB 1QGYA 2YXLA 3ZZMA 3UB3A 3HCDA 5CNMA 5DT2A 1X7ZA 4WZAA 821PA 4YAKA 5JO9A 5TPZD 1WUHS 1OUMA 3IP6A 4I4LA 2ARKA 3GCDA 3GVXA 1JEJA 1UOPA 5EJAA 3ZD6A 1UZNA 5JSHA 1EZ4A 5EEGA 2ZAGA 1XJ5A 4JITA 2OCGA 2QNIA 4JBNA 2JBAA 4L95C 5KINB 1S1CA 2P0AA 2HQSA 4WT7A 4C7MA 2JHAA 3U1BA 3CPEA 1FDRA 1MT0A 3T34A 4B44A 3BK7A 3CX3A 4Q3EA 3S68A 2PUAA 4WBNF 1X14A 2H4JA 5EZSA 1EFPB 4XWOA 1K3TA 1EUQA 2QY9A 2V6BA 1BMFA 1O95D 1FS4A 4UBLA 5CDTA 5DHQA 3AZOA 2YMLA 3RC7A 4AZ0B 1J21A 4GI3A 4JUDX 2NTYC 4EK9A 2O54A 1EDOA 1SBZA 4L0MA 4U00A 1DAEA 4V0NA 1IG0A 4OHVA 5F1YA 2PUVA 4Z86A 1T0BA 3GFFA 2FUEA 3IQIX 1XEWY 4FWTA 4GFDA 4BJ1A 3GRYA 3ZIUA 1D6MA 1IZYA 1DRWA 2Q6TA 3L05A 1ZJJA 4HH0A 2AXPA 4ZPJA 2IHNA 2J7KA 3ML1A 5BSHA 1LWNA 1XZMA 5D84A 5TJ9A 2RGRA 2GR9A 1XTJA 4Q01A 2IP1A 3I5AA 2CDRA 2DERA 1ZG3A 1QHSA 2XYVA 3LOPA 1TRKA 5C3MA 1Z47A 3VDRA 2CHEA 2EP7A 1NDQA 5CA0B 5DBIA 1ULBA 2HA6A 1P0MA 1Z7GA 3I2IA 2PSJA 4MWZA 1ECFA 1FTGA 2H54A 1JSLA 3I1YA 1OXXK 2ONKA 3QOWA 3FZEA 2JJ2D 2ZWAA 4WERA 5JSUA 3RYIA 2YTZA 1Y1LA 4CM4B 2A59A 2PXCA 3OQBA 4XIJA 3KZ1E 4QL3A 4UU8A 2OO7A 2VYNA 5BYJA 5KYUA 3TQCA 3IFSA 4NZYA 3NRBA 3SEAA 3UICA 4EMSA 1OTYA 2Y2VA 3L6CA 2WIJA 2QX6A 2YWXA 4OBXA 1DAPA 2IPLA 3AVPA 1NP3A 3C7CB 5E6UA 1N7IA 3MGCA 3NTXA 1K4MA 4R1NA 5BYBA 5BWLA 2F55A 2NX2A 2WYHA 2M98A 4IPTA 1WPQA 1SIBE 2WQZA 3LVFO 4KTVE 4YR9A 1UM8A 2B4KA 1FRVA 1JEQB 4BFYA 1XF9A 3D9QX 2QNBA 3HLYA 4QQNA 4CWAA 4MVCA 1WNFA 2OV4A 2J4CA 4QDXA 2NNWB 2PA0A 3GA5A 1ACMA 1KAQA 3OIVA 2C5HA 4M54A 4WFIA 4F85A 4PNEA 1QGUB 1UR5A 2PEZA 3AKDA 2M6KA 4YMLA 4K05A 4OF4A 1CS0A 3QUCA 3I6ZA 3W3AH 4GXRA 3DV0B 3WKCA 1R6XA 1J07A 3NBQA 2L42A 4CW7A 5IXYA 3BWMA 1BSVA 4Q4LA 1W8DA 4QLBA 2YZGA 2FQYA 2A4KA 4JEHA 2G80A 3IT0A 4JUIA 1OHHD 4N03A 3ZWVA 4CKCB 2AB0A 2WNSA 3D7SA 3U2QA 3WMEA 1RC0A 1AGXA 2V6JA 2XTZA 1HDCA 4UEOA 2RAPA 4IOJA 4WV3A 5I7FA 5CGQB 5LPNA 4PM4A 1T3HA 4YXWA 2CJXA 2JIPA 1L7MA 3EF1A 3MM4A 2VXBA 1FTNA 2PM8A 3QA9A 4FYWA 3E48A 1RYYA 5DULA 3DZFA 4U2EA 1Y33E 5LMUB 3X2SA 4X94A 1Y4DE 2ZHGA 1LJLA 1AE1A 1XRNA 4M89A 4P93A 2J0VA 4CLEA 2X6TA 4G0VA 3LBNA 3PV0A 3ASYA 5JSKA 5BSTA 1O94A 4MA5A 4CJXA 1P1RA 4GS5A 4S05A 4DFDA 4DQVA 4GDFA 1IONA 3HN2A 5CBPA 4OHKA 4Y0AA 3EJ6A 3KK0A 4C04A 2C9ZA 2JEYA 1WO8A 4B31A 5C8XA 2ZBFA 4WD3A 3E4DA 3L1HA 3K70B 2NSLA 2OGZA 3QF4B 4PYJA 5H16A 1NBEA 1L5QA 1MNQA 2XZPA 5B2EA 1Q7GA 2GPBA 1GPMA 3B6JA 3DB2A 1XAHA 2RHLA 3P0JA 2PWZA 2ABWA 4MUJA 5JH7F 4B7XA 3W5IA 3AUAA 1AK9A 2Q5FA 4KIJA 4TV9B 3H97A 3QE3A 2IU3A 4MWBA 2CLMB 1OGJA 3VR2A 5DYTA 1NA5A 4R3NA 2ERXA 2OYRA 1W2GA 3H5OA 2E4VA 2HR1A 2ZK7A 4E31A 2ZTUA 1Q0RA 2AOWA 3V8QA 3K1AA 1ULSA 3KZOA 1UWCA 1EK1A 2HMWA 4N6OA 1GGKA 1N0HA 3EXIB 3EXG1 4C3OB 2O8DB 2PQ2A 3ADDA 1SG0A 3GJ6A 3Q6IA 4BZPA 1NPTO 3NIDB 1N2CA 4XUEA 2IHBA 3GEEA 2JMLA 3AK4A 2VJMA 5GIOE 1YRYE 2Y68A 1LJUA 3GCWA 4NBRA 5GP1A 3WS7A 2YWRA 2CLSA 2QPAA 1YHNA 4KQEA 5A71A 3VV2A 4RZHA 2ISCA 3I4CA 1V6CA 1F4LA 4RH0A 2CFCA 4JI8B 4JBHA 2EYQA 4EI2A 1PT9A 2IBMA 3SJUA 4CVNA 5C9ZA 2K6GA 3LW8A 1CEXA 4G0YA 4KXYA 3TEFA 2GEDA 1SK8A 1PR5A 3S4YA 3A9SA 3LX6A 2ZULA 3V4OA 3FKSA 4IDCA 2CHVA 5HHTA 3ETNA 4YK7A 4HWKA 3ZQKA 1ZMOA 3IE2A 3IOCA 1E60A 3FJOA 3A1TA 1TDJA 3GAZA 1DJOA 4GZ6A 4OA8A 5I9LA 3CBGA 1RACA 4PYOA 4P33A 4US0R 3K9FC 1J22A 2GS9A 2JHFA 4WE3A 1TK3A 4JOSA 2WHRA 1RLTA 1YBMA 3Q9NA 2JS7A 4AJOA 5JLAA 5IC6A 3SNKA 5HIKA 1SC4A 2X76A 3WIDA 1WS6A 4JI1B 1JH8A 5L6LB 1NVFA 2IYVA 4W9NA 1UC4B 1XX6A 2NU9A 2WU8A 4TV8F 2WIBA 1A69A 3DDOA 3IEXA 1RC8A 3C2QA 3PPIA 2ZXFA 4YMUA 3WP0A 3L43A 3OEED 2XTNA 3ABQB 3F8TA 1JXOA 1ODSA 3HJHA 3KQTA 1Y1KE 1Z56C 1N6HA 2HV8A 1Q20A 1QYCA 3ZU6A 1CUVA 2IUFA 3C3EA 2R00C 2NT3A 3VU3A 1I0LA 3NATA 5ILQA 2E4AA 3GGSA 1TM7E 3RJTA 1MB9A 2QMQA 1BQ3A 1OAOA 3IH5A 1XDSA 5DMHA 3I04M 2DT5A 2ZBEA 2CFSA 4P7BA 2YR0A 2C94A 2C58A 3PR2B 4ZMRA 1GPKA 3BRWD 1A72A 1SHUX 2QD4A 3FDXA 3DO5A 3GDHA 3HCOA 3TRJA 4EMTA 3RVPA 5C1OA 3K6RA 3ITNA 3KQQA 4IMJB 5IBCA 5JS2A 1T25A 5ELMA 2FWNA 3SQXA 2O5EA 5CVEA 4JU8A 5JALA 4W1SA 3QEJA 1DPGA 2IHVA 3P19A 4CBVA 5L8VA 1E94E 4F38A 1E59A 4WXEA 3G5MA 2H7XA 3QVOA 2NVOA 1OAAA 4LOIA 3PE4A 4KITB 2GVZC 5IU6A 5KQSA 2FZEA 3JQAB 3S2YA 4PBSA 4PLTA 3P5BA 4IMRA 1Z33A 2WMDA 3R7DA 5AVXA 2NZ8A 3VI3B 4B35A 1CV2A 2JFBA 4B5KA 1U0EA 4AKHA 3G13A 4C6RA 4GOKA 1XVIA 3C3WA 1TU0A 1DARA 1GN9A 3L7DA 2WV7A 4W7SA 1JR2A 3G89A 3Q40A 1A8SA 5ENZA 4YAIA 1Z63A 5AVRA 3CUYA 4MDHA 1T1JA 2O3TA 2Q2NA 2A1TS 1Z6TA 2C3OA 4AZWA 3H1TA 5C18A 4DCTA 4QYTA 5IC4A 4UOEA 2W2OA 4KDCA 4B7AA 3RGGA 4CR7A 2ES4A 2GZHA 3HDJA 4NHEA 4HWPA 4OLBA 2WUGA 3ZGNA 4WW0A 1TW3A 1CRPA 1IRXA 3L46A 1R5NA 4OSPA 2AE2A 1JKJA 2NYAA 2ZCVA 3Q6NA 4S1WA 3TJMA 3ZDXB 3K72B 3G79A 2ZJ0A 1JNXX 1RMQA 3IQZA 3GN1A 2FHSA 1YIDA 4KQ2A 1IXZA 3H87A 3IP5A 2P6NA 1K5DA 2M9MA 1Q0HA 1WHTA 1PL8A 4KVFA 2FW0A 1BXKA 2OAQ1 4ML3A 4OG2A 4QZVA 1LFAA 1R8XA 2SECE 4BO7A 4PRZA 4DG5A 4F4UA 3G2HA 2CVZA 4AMYA 2ZDQA 2YWGA 2QTBA 4IV8A 1THGA 4GWLA 1G0OA 1JA0A 2P9FA 2PVSA 3PLNA 4LJKA 2FSIA 3VPSA 4CKWB 5JCPA 2FDRA 3U7RA 4EW3A 4TMWA 3R7WB 1FNMA 3LIIA 1IG3A 1E2MA 1X9GA 1Z7EA 3T3IA 3VC2A 4ENTA 2JLUA 1C80A 2Q3HA 3EQ6A 2LDXA 2XDWA 5C8ZA 3LCJA 3PJDA 5A4IS 3KWMA 3EH1A 1TMKA 4TKLA 1GGVA 4JIGA 3NYWA 4IJUA 4PQGA 4Y2XA 1UJNA 1GQOA 2NO0A 2EGUA 4LTNA 3U16A 2DCMA 1MZVA 3KSRA 3PRYA 3TIGA 2VYVA 3GOHA 3K32A 5EE5B 2BDEA 3EG9A 2NTEA 4RYDA 1YZHA 2VHWA 3CXRA 3Q7QA 4UTZA 3OX2A 4OH1A 1P72A 3DS8A 3BJIC 1XRPA 3BGVA 4Q1CA 2DG6A 3R41A 5IHPA 2HGSA 3D4PA 2DETA 1QQ6A 3OF3A 3FY4A 2QM0A 2IOYA 4PX3A 4WL0A 5B58C 1YKGA 1LBQA 2VJYA 1PI3A 1T34A 2FUCA 5FQOA 4A8JA 1QU2A 4QULA 4BNHA 1CQZA 1SJ9A 4WUTA 1Q14A 3WIUA 2HCTA 5CIWA 4AYXA 2X40A 1EH5A 3OHMA 2MSDB 5TQ2A 3W79A 4UDOA 2JPDA 1JBGA 1V41E 2JFOA 2VZEA 3RC2A 2BUAA 4UASA 1I6KA 1F3OA 3WRYA 2ETVA 2YCLA 4IWNA 1CDOA 4B83A 4D79A 4YVFA 4A2WA 2YHSA 4NV3A 2SHKA 1RHRA 2QT0A 1OJLA 4BBJA 2H06A 4MI1A 3UG7A 2W8BA 2BW0A 4M1QA 3RHSA 3W9YA 4D4LA 2OP1A 2JJ1A 4XI9A 2IRWA 2Y1EA 4JBIA 5LQJA 4RVFA 2V7PA 1T8RA 3LYLA 3PYMA 3RTGA 1KSFX 1W47A 4YT2A 1Q08A 1PSWA 1PX2A 1MX1A 1GQYA 3TZHA 2BMWA 3O3CA 3GBPA 2JEZA 5DNDA 5LZ5A 4WXRA 5EINA 2VC2B 1VDMA 4RVDA 1AK1A 3GH3A 3TKLA 1G66A 1EQUA 1LZLA 3JS5A 1RWQA 5E6RA 3UAWA 5LOVA 4LF4B 4BCBA 4BYMA 3RADC 1PR9A 3Q7IA 4UM7A 3NHZA 3MRSA 3MF4A 4YAJA 1TQ4A 2B5OA 1VKOA 2UZ1B 4JJEA 2REBA 5MHTA 1DAFA 1RADA 2ZI4A 4TKVA 4ZA2A 4CF4A 4RABA 3WB0A 5JFGA 4TWBA 4DLNA 2OHXA 2ZBGA 3O3MB 5C8VA 1LI5A 3DAHA 1AD2A 1S2OA 2FR8C 4ARSA 3OF5A 2HFJA 1P4JA 4LSMA 1O5OA 3U3JA 3WNCA 4J6FA 3IALA 1ZR2A 2NO9A 1N1EA 5FWDA 1T5HX 2L82A 3SX0A 2PFGA 4EMBA 2RHOA 2QRZA 3GGDA 3VTAA 4AULA 4ENPA 2D0OB 4DJJA 3RSHA 2ZITA 3GIWA 2WSYB 3B9PA 3ECCA 3PPVA 4HLNA 4L9RA 4XWYA 4C89A 4RULA 1O1YA 4PZ0A 3A9TA 4L1KA 5G3ZA 1AS3A 1J4AA 2Y9MB 3NT4A 4TUYB 1KYVA 2CXOA 3H5TA 4B3HA 2ZKIA 2Q8NA 5FPQA 3K6JA 4WX2B 4O63O 4FKZA 4DABA 1WB6A 2FQXA 4H7IA 3MZ0A 2Q7DA 5C7OO 1M6HA 2PYZA 2Y27A 1QWOA 3PCTA 5KYXB 4WI1A 4X3PA 3PX3A 3T1VA 3FWNA 1RWOA 1JECA 4DR7B 2G7MC 2JJYA 3LF1A 3PNPA 3S40A 3UJCA 4YREA 3HFGA 3PFBA 4LJ8A 3WDKA 1XZKA 1E8MA 1Z5VA 2VP0A 4XJVA 2IXEA 1AJEA 2GERA 10MHA 1B74A 4TSKA 2WWGA 4BNZA 5BRJA 4EUEA 2G06A 3KTDA 3EEQA 4M8SA 5E4FA 4YRNA 2Y9PB 1SBHA 2PS9A 1LPBB 3HUFA 3CO0S 4I50A 1AIPA 1DC3A 1TZCA 2GHQA 5AVYA 1E3JA 1KDYA 2D3WA 4Y1RA 5C53B 1HEUA 3NOXA 3N8HA 1U2PA 4ASUD 1FP6A 1XCPA 3BF8A 5ELXA 1AN0A 3L92A 1XHFA 4YIKA 1U8YA 5JAMA 5E0KB 1HNXB 4A6XA 4DLLA 1U99A 2V4MA 4E2YA 5LD2C 3E84A 3HJUA 4V0MA 5JJCA 2CFTA 3CTMA 3C7DB 3GJ7A 4MQLA 5JADA 4DC0A 3VHQA 2VQEB 3EZ9A 3D02A 1QCZA 3E9MA 3M1AA 2GNAA 3CCFA 1X6VA 3CYFA 4RK5A 4Y1EA 2IEFA 1BWSA 3WK4A 4CNQA 4BQEA 1QC5A 3KQOA 3ZCQA 1GV1A 1SCNE 4HWSA 2P9EA 3UJ8A 1FB5A 4C08A 5HZGA 4K5QA 1E1CA 1KL7A 1KK2A 5T4HA 3DEZA 2QU8A 5FNVF 1I4OA 3LC2O 3CUEF 3PDWA 5M2QA 3K0SA 1SXJA 2J6BA 1RR6A 4Z54A 1SC1A 3K1JA 2GD1O 1ZUNA 1A7JA 1YACA 4PLFA 1E9EA 2R86A 3LQ4A 3P7MA 4XLLA 4W7HA 1N6PA 1NW9B 2VS1A 3NT5A 3H3JA 4L7QA 5TNXA 3IO5A 4B48A 2AEMA 4R6WA 2GZSA 6PFKA 2CLKB 5CVDA 3QY0A 3ZWCA 4K3VA 3MT8A 2B1QA 3ORYA 4XFDA 3CUUA 1J2YA 3QA3E 3RJMA 3RS0A 8MHTA 4AX8A 3HCBA 4NJMA 4INJA 3HR4A 3K4PA 5DV9A 3RJZA 1B8OA 2D2FA 4K81B 2ZU0C 3EODA 2O7VA 4QGAA 1IEWA 1KJJA 1Y3FE 2AC2A 3PWZA 5KTSA 1MQ9A 3GELA 1X1SA 5CPBA 4I19A 3U61B 5ALTA 1X42A 1G2PA 1S8AA 1TTPB 4EUFA 4GR4A 2A6PA 2ADFA 2EU8A 4FMCB 2OG0A 2CMHA 4E4RA 2GCIA 3F5FA 3OZ7A 3FF4A 2Q49A 3TRFA 5HK9A 2X3FA 1J97A 3TCNA 5T3YA 4HAVA 1OLXB 1EE9A 3AOEA 2J46A 3DL7A 1JIUA 2LCQA 5KYTA 1KEVA 3E22B 4NCKA 2X0NA 2X1HA 2Y77A 1QR2A 3B51X 3NBMA 2HWKA 4GAEA 4MRMB 1H9AA 4MGYR 2W4MA 2WK1A 4B73A 5A9SA 1NI4A 2FU5C 5TT1A 3E9EA 3E70C 1UP6A 2ANBA 3GVPA 3ZI4A 3PT9A 4UU7A 4EGQA 5K4GA 2FEXA 1J0AA 1JIXA 2AWOA 1XTQA 3STWA 1YULA 4G1VA 5ALUA 2HRQA 4QT4A 1L8QA 1GNTA 4F56A 5D00A 4RHYA 3M6IA 3VO8A 3ZGYA 3V1TC 2HCJB 4D9JA 2ZSAA 3L0OA 3MUNA 1T2UA 2O57A 4ER0A 1POWA 2PX8A 2ZJ6A 3ODPA 4RQUA 4J4TA 1SKBA 3TDMA 4NXMB 1DQZA 1Y1SA 3KX2A 5JQGB 4D3DA 1XXLA 2QLFA 3CX7A 4I55F 5HBRA 2F3QA 1A0OA 4X54A 1U4OA 3L0ZA 4Z7NB 5IPFA 1V25A 3AHCA 3K6KA 2AJDA 4V3CA 4NZNA 2LP4Y 4B4UA 1PZFA 4E2WA 5LZ9A 1FXWA 5SY9A 2I6SA 4M4SA 3O8DA 3I0ZA 4P7KA 5K0FA 2CWDA 1COWD 2IDMA 4OUDA 2HPHA 3GFBA 3WYCA 4Z9AA 4MUAA 3AWIA 4Y6RA 3V34A 4BJ3A 1KS9A 5JNTA 5FL7A 1Z6XA 4PBTA 1F7VA 3BMOB 5FADA 4J7XA 5HKKD 1EESA 1I2ZA 4NU5A 4D2IA 5T4EA 2QGFA 3N8NA 5IX8A 4N0PA 4Z4HA 3RFVA 1C7EA 2FV8A 3EMKA 3K30A 5KQPA 3T3GA 5JAPA 2Q6KA 3G8CA 2J0UA 4RQAA 5IVIA 3DFZA 2VPIA 2VOEA 1B0UA 5LQDA 5JW6A 4XE5A 5F1KA 3WO0A 2MMGA 4NEQA 2COKA 3S6JA 3WV5A 2D0DA 4EEXA 1QB7A 2JKVA 4X97A 1KZ1A 1VL8A 5CK5A 4ZO7A 2BHRA 3F2VA 1SA0A 4XOIA 4CUKA 4QWWA 1K7XB 1MIOA 3BXPA 4JP5A 3IKTA 1FU7A 3IXQA 3Q85A 3TRIA 4MPRA 3IMEA 4XM1A 3OQMA 2A84A 2LIPA 3FPBA 3NDJA 3TE7A 2EIXA 2OM2A 3D2BA 5DIFA 1GEGA 1TB4A 4JGBA 3W8DA 4BRZA 3STUA 4POAA 4EP1A 3RR2A 1KVTA 3PBKA 3WO1A 5EKUA 3A6LA 1H93A 4CEHB 3SFTA 4Q3KA 2OXRA 5GOTA 3IEUA 2DTDA 1XCOA 2JFWA 2ZQZA 3TEJA 1XZGA 5JOQA 4KPGA 3AI2A 3BDVA 1G1AA 4HPWA 1IVNA 1O6ZA 1TYBE 2WB2A 1JG6A 1TPZA 4M0PA 3WWOA 3AUKA 1R4ZA 4R1MA 4AB1A 2JD2A 1KORA 1IEVA 2WU0A 3IDZA 4EFKA 1KEUA 3PGKA 2ZSHA 3Q41A 4M2LA 1AHPA 2YJNA 3FM9A 1Q74A 3EDYA 4JR1A 2WIGA 4W5HA 1FDTA 5F33A 3EQ7A 3ZIAA 1RQ2A 1RVV1 4HUJA 1U4SA 1T8YA 2B8EA 2V97A 1UJCA 4GPD1 3O8CA 3K2EA 3K4HA 2OLJA 1VE9A 4KC0A 5AM0A 3KAKA 3R5TA 5FHQA 2C1EA 2ZI3A 2RG1A 3PFHA 3Q1MA 2VH5R 4LNHA 4I9GA 4N01A 4Y1FA 2ZPTX 4M1EA 4YJGA 5CVVA 1F8UA 3V8PA 1OBVA 1G2IA 3BWCA 3Q4GA 4BLTA 1LPNA 1FP4B 4KV7A 3GG2A 1U8UA 3IAHA 3RAGA 4Z4IA 2CVQA 3NYQA 1LU9A 5EJ4A 1UKBA 1XYGA 4P7JA 4B84A 1DBPA 2IUSA 1S8NA 5FF9A 5IJ9B 3QVMA 4GKKB 9LDTA 4BVFA 5K03A 3ZYCA 4LDJA 3BJZA 3QPCA 2F4VB 3QVGB 2AOUA 4IH4A 1DCMA 1Z4QA 3R3ZA 4NYIR 1ORWA 3NV9A 2LRHA 2CSXA 3SKXA 4HDKA 4JR2A 4KE9A 1CUEA 1SVIA 3QNUA 4B3MB 1ZLXA 2HA2A 4FJ0A 4ND8A 2XRZA 1FTQA 2XNSA 3DVQX 4OGGA 3RUAA 4DHWA 3DOEA 3RVBA 3U4GA 4X5OA 4R8RA 3U0BA 5DM0A 1F3LA 2PMEA 4ISCA 1USVA 4YJ2B 1IJFA 1X74A 4OA5A 4OHBA 1DL5A 3NEJA 4ONEA 2HI0A 4WN9B 4C6SA 1KKMA 1Z26A 1VPTA 4WMLA 1NVVR 1O6FA 2XCRB 4AK9A 3EK2A 2MSNA 2PU5A 4QHYA 2A33A 5ITZB 2OV1A 3O4GA 4AG5A 4B4KA 1XZ8A 3JVVA 4HDRB 4LZZA 4PRKA 1GLGA 1YO6A 5AVQA 1LQTA 1J5PA 1M1YA 1RJDA 1GAWA 1EP1B 1GPYA 1TVKA 2AWNA 1PP4A 2HJSA 2KBEA 2WHYA 2JCXA 4LC1A 3JQEA 3K31A 3FOZA 2Q6VA 1I94B 4QXAA 4XWWA 1UWKA 3ZOKA 2BR5A 1KJIA 1HOTA 1NMEA 2REXB 3B53X 4GKBA 4PPYA 4X61A 1E3EA 4IM7A 4Y2PA 3KDAA 1A9SA 3ISTA 3IV6A 1YZVA 3QLUA 3BMQA 2PWAA 4P5PA 3K5PA 1W85A 4EQ6B 3N2GA 4H3SA 4RNDB 1QF6A 2B7BA 4MAMA 3MS2A 2OMKA 2ZB4A 3EPLA 1XN1A 5I9IA 1U6JA 4QTUB 3ZU2A 1HYHA 2RKBA 2HHCA 3EDQA 3LXMA 3L40A 5EXDA 3NHLA 1UPTA 3TVDA 1TYEB 1R1DA 3UT5A 3GZNB 1Y5MA 1XPOA 4AZVA 3DE6X 1PGPA 3JAMA 2BHTA 3HYTA 3T54A 4QUIA 4PLZA 1LK5A 3R6GA 3WB2A 3R3XA 1H8ED 4IF6A 4KRYA 4DA9A 2Z4SA 3CZPA 2F7SA 2X5XA 4EO7A 1U8EA 2A9RA 3K7EA 2QVZX 4WGGA 1CEQA 4D1YA 4IEIA 4E94A 4H6WA 3G0HA 4U39A 3ICOA 2RI0A 2BPOA 1SKYE 1JI0A 3ORSA 1V48A 2GPAA 4N0DA 4BNMA 5DM2A 4HH1A 5LA6F 4AY5A 3HFJA 4H7DA 3BQ9A 2XUZA 3GEIA 3LD9A 4QECA 5KOJA 3D0RA 3LRTA 1U2TA 2XT9A 3W2HA 4C0JA 2VCHA 3NOOA 1EE2A 1FFWA 3LLVA 1PHRA 3R2JA 5DHRA 4H31A 1SRRA 4OHUA 3AIOA 4FFMA 4WK6A 4XDGA 4ZOLB 2GHTA 3FWYA 1AUPA 1DE0A 2PL3A 3EFBA 3IRVA 2VTKA 4V0LA 4QVIA 1FE8A 2QG6A 4QOEA 3PWKA 4HZUB 4RD0A 1VJ1A 1DZ3A 4MWCA 1E99A 5G0WA 3ZHTA 3H1PA 1HG0A 4PNPA 5KSWB 3ZTWA 4OP1A 3IBYA 1ZWLA 4DCGA 4M8NE 4EG1A 1FMCA 3BS4A 3ES9A 3HWX1 2C9MA 3L0YA 1PDOA 2FQQA 1Z75A 5HKOA 4ED9A 2P5UA 3L7NA 3SZRA 3GU3A 4G5QA 2DQYA 4EEZA 1K0FA 1VXRA 3HJGA 2RGGA 4NYIQ 3FYUB 3R7AA 2BZ0A 4HNAB 4KPEC 2VHQA 4RVGA 4RIIA 3UOWA 4N3GA 4BL5A 1BVHA 2O9JA 5DYWA 2VG8A 1DG9A 3DW3X 3OUUA 3MTEA 4YP1A 4EFMA 3X1YA 2B61A 1P4HA 3I23A 4FR0A 1SUIA 1OZAA 2Y1GA 3BDIA 3BFKA 4FK8A 2C5LA 4IIJA 2O8NA 4TQ9A 5IKMA 3UHJA 4ZCTA 1PTJC 4CRWB 2LD4A 2OCBA 2WWHA 2DRIA 1PEDA 1VMKA 3FR7A 4GEGA 5LZ8A 3REGA 1NVVQ 3FDZB 2FOXA 2VZLA 4BUCA 1W5TA 3IQHX 3I9JA 2C3UA 4ZREA 1RRCA 1GVNB 3RG2A 4YJFA 1FMFA 2CD9A 4LV6A 1L1EA 5AW7A 1ENZA 1D2AA 2P8JA 2XNCA 5FV7A 4E4TA 3LW7A 2RGWA 5AWFC 3TLBA 1YCDA 2G28A 3I09A 2IE8A 3CZ9A 3TBHA 2H9AA 2AUNA 4PLGA 4X60A 3EXHC 2JFUA 2TMYA 3JQPA 3NNSA 3TJZA 2BMJA 2P9QA 2R2GA 3GEDA 1ITZA 1CK4A 3SBEA 1Q1ZA 3GJ0A 2PGAA 4XQCA 5HBGA 1FFCA 4AQYB 4I6EA 3UEOA 1ISRA 3BCRA 5LNK6 1ZJ5A 1EDDA 2CJWA 3R5JA 1MRNA 4AKEA 1S9HA 1W52X 3QX8A 3KKQA 5E3JA 1Q21A 4CIXA 4CEJA 2H0AA 3KT0A 1PG0A 2R7KA 3EVBA 5ENDA 3TTXA 2V7VA 2JVJA 2JBHA 2XNJA 4YDHB 1JKMA 4IG9A 2BKAA 4YHBA 2HBZA 2ONJA 4U02A 3DBHA 4M8KA 2Q5QA 1Y3AA 2CXRA 2FSVA 2A30A 3BIXA 1T1EA 1ODKA 1T5IA 1UP7A 2EFEB 2R8BA 4JQZA 5EP4A 1AV7A 2O0HA 1K6EA 1ILWA 2WJ4A 4M22A 3IJRA 3JD4A 4MRRA 5DNEA 3R24A 5BQ5A 4KXLA 1T3LA 2UZAA 1H9CA 4F4CA 5GGYA 1CFJA 3GLIE 1NURA 5BUCA 3KQVA 3QAOA 3V9AA 5KNDH 1JDVA 3OZRA 3Q3CA 1MD9A 3QEMB 4UCXA 4DLKA 2QQ0A 3N0WA 4WQMA 3K1TA 4KRXA 2W6CX 3E9QA 3LBFA 4IJKA 1NN3A 1R9GA 2O3QA 5HCNA 2BEUA 2ECKA 1ADFA 2GM4A 3TQQA 4N3BA 4Z6KA 3WYGA 1UFKA 3ND9A 3KJQA 3CX6A 1AKWA 2W48A 4RPKA 3C5VA 4KW7A 1G8FA 1GQSA 1NL3A 1ZHHA 2QTMA 2RFLA 4OHOA 2AV6A 4PC3A 5EFZA 4BNNA 4FFNA 1PE0A 4NENB 4TKUA 2ASEA 5D7BA 4ZVUA 1XHLA 3KHSA 4I3HA 4YP6A 4AG6A 1TF7A 2B34A 4PSAA 1E9RA 2RGUA 5FQNA 4WDQA 3EISA 1GU1A 4LHZA 1VBKA 3L4BC 3HZHA 3TLGB 4UHBA 3VYVA 3ZI7A 1J8FA 5JRDS 5FFNA 3PGXA 2CMDA 1TO1E 4UVHA 1GQFA 4L8FA 1MKYA 1I36A 3ZE6A 1QHHB 4MW1A 5BXYA 1ZD8A 3A4MA 1R8QA 2H1FA 3OFND 1C3VA 2FY8A 4O1HA 1JEDA 2EQAA 3V8RA 1W4CA 4IIUA 3OPNA 4F3KA 3M3DA 2FSFA 2JLQA 1RCTE 2AR9A 1NIPA 2Q3FA 2X9NA 1C8BA 3A9UA 4LRXA 1OFUA 3DFMA 3NQ41 1U1IA 3CNOA 3T5BA 4AMZA 1G20A 4D3SA 5HSGA 2J3JA 1DMSA 1HE4A 3GLHA 2J3IA 3T6KA 4FN5A 5IF3A 5DW0A 4G67A 5I48A 3IXLA 4ZOCA 3GLIB 2W2KA 4PSDA 1A50B 3D6YA 1SVLA 2Z1MA 3LPMA 1RCFA 2FEAA 1LDNA 3C98A 4DCUA 2O7SA 1Z9BA 3OE1A 3G8AA 3GLRA 3I5UA 1SD2A 3PQCA 3UWOA 2JJ8A 1EFUA 4JFAA 3WAKA 2F48A 5EWMB 3TNDA 1Y9AA 1JH9A 3LXRA 4MKHA 5T57A 3D2CA 4M88A 2O8CA 2C57A 5LP6F 1PGJA 3CUTA 1WW3A 3RYTC 5IARA 5IJ0B 1UMKA 3BXEA 1N2EA 1BE1A 5EKDA 1P75A 3B8EA 2J5XA 1M34E 2LW7A 4LXHA 5IZCC 2ZJAA 1OFVA 3H8WA 2RCYA 3P8ZA 1XGKA 1WZCA 1K8XB 3KUUA 3AP3A 2YUTA 3UMBA 3VQTA 1P4GA 4EJMA 2IX3A 1ZJ6A 3HI6A 4KZKA 3VNAA 2BKXA 2RG7A 1QFJA 3PHBE 1HFWA 1RIFA 3NLLA 2GDJA 4RHTA 3AU8A 1FFHA 2FKAA 4U3JA 3QVWA 5KEIA 3N53A 4PC1A 2XMPA 4QFBA 4CI0B 5BSEA 3C4VA 3CR8A 4X7PA 5G02A 5K4HA 2W6ID 3IE1A 4D0LB 1VPWA 1BHSA 1GT91 1TI7A 2P30A 3QFSA 5D3MA 1M2EA 3DBIA 1GNPA 1TO6A 2HTEA 2PVCA 3BSSA 2P41A 3UF0A 5B6IA 3SWWA 4MVJD 4PRLA 1YA6A 5AKZA 1KFBB 1VSUA 3FAKA 1WD5A 1BMDA 5FPPA 3BXHA 2ST1A 1E2IA 2XYGA 3U3RA 1FU4A 5BSWA 2PGXA 4R6XA 3LNCA 1V0JA 4ARVA 4RTSA 3SQOA 5BQXA 1P7VA 2ECQA 3O83A 3QPVA 4CGYA 1ZN7A 5HRCA 3K4QA 3F73A 4ECEA 1DDIA 3OCJA 2SKDA 2OHOA 5FLYA 2FE1A 3KYDB 1DKPA 4TQAA 2G1PA 3LCCA 2V3WA 2MINA 4W5OA 4TMYA 2PT5A 1XALA 1FUUA 1IATA 1M1XB 1T2FA 1W2HA 2GPTA 2QUZA 1BWRA 1ULHA 2H07A 4HY3A 4LUCA 1M34B 3DTTA 3GF4A 3NMUF 4XGQA 1PJ8A 4R1OA 1OWPA 5K6AA 1MTZA 3EUFA 1CYDA 4LYYA 4WFQA 4YMWA 3SC4A 5IN4A 1FU8A 4WINA 4JROA 3FR8A 4NMMA 2VLBA 1XFAA 5FO0A 1SZDA 1JFRA 2PWBA 3FKJA 1M2WA 2X4GA 4LMBA 3T3NA 2JGJA 1OREA 4ZKEA 1CUFA 4BMVA 2QN1A 3FRIA 1EFPA 5DKFA 4RVUA 4BZWA 3TG8A 4TLLB 2Z56A 3ER9A 4HEJA 1ENOA 4Z1MD 4AZ0A 4GD3Q 1MMFB 4J0HA 2UKDA 2AR7A 3Q0TA 4Q3NA 4BGVA 3L8EA 4L76A 1T8SA 2C4UA 1T5OA 4E5YA 2XA9A 1U94A 2B9VA 2FX2A 2XOXA 1FFXB 3GROA 4IIDA 4IDAA 5CVUA 5IJZA 4V02A 3U62A 3L7CA 4MO2A 1GYRA 4ZODA 3W78A 1DCKA 4N82A 3ESBA 2HXSA 1DO2A 1CR2A 4N9WA 4ID3A 1WXEA 5AKLA 5JASA 4AWAA 4G4SO 5CURA 4R2LA 2J8ZA 3DZ8A 3OO1A 4PG7A 3WYNA 1UKVY 2AG6A 3E5MA 5DN9A 2V7TA 1U0JA 2DSTA 3AFMA 2GJKA 3R0ZA 3QPAA 4G4SP 1EFAA 2CDAA 1CNEA 1YCFA 1XAGA 5JI2E 4Q02A 1G7RA 2ZRQA 3INYA 4JJKA 1A3CA 3E7FA 2BM8A 5K8VA 1L7DA 5AW3A 1ZVMA 4FCCA 5TGZA 3IL2A 4CM4A 1NJ1A 1ZN8A 5CM8B 4IFEA 1VCMA 2VIIA 5KJFA 1JHMA 2WT8A 2JIZD 2OHVA 4DWVA 1E1QA 2YL2A 1CY2A 3WBFA 3IHTA 3ZGXA 1FJGB 1M2NA 4KMSA 1W6RA 2H11A 3SSMA 4WOJA 4D8WA 5BV7A 5CB6A 4WBXC 3GMDA 2DWOA 3CRNA 4I99A 1H6DA 1XQYA 3FNHA 3T1YB 2P2NA 3IEPA 3VZBA 4JT2A 2PMCA 4PQFA 3PHHA 1JEQA 1KMQA 4LMRA 3WQSB 1QO0D 5JTTA 4ER3A 5AKJA 4C5BA 4COKA 3ABOB 3MELA 1OVGA 1QGUA 3DPSA 1YDEA 2QAGC 3QELB 4R2IA 4YROA 3GLFE