3EZ7A

Partition protein apo form in space group i4122
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
SSQLHKVAQRANRMLNVLTEQVQLQKDELHANEFYQVYAKAALAKLPLLTRADVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGTPKYRDRYSEAYVIFISNLKGGVSQTTSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partition protein A
publication title Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 106
structure length 382
sequence length 395
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
A PF18607 HTH_54 ParA helix turn helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.30 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3ez7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ez7A02
1R2QA 4KODA 2AK3A 4A0FA 4HLCA 1BH2A 1VHTA 4GOXA 4Q7MB 3V00A 5KNDA 1C1YA 2YJTD 1KDOA 4JYBA 3K0AA 5FTNA 3TRFA 4IW3B 3UXMA 4GI7A 3DHWC 5KDOA 2HYIC 3BH7A 5J40A 4MGYR 121PA 4PZYA 2GAOA 1EG7A 2WOOA 4JT2A 3B9PA 1OPXA 2EWVA 4MRNA 4AURA 1ZD9A 3Q3JB 1IHUA 3OFND 2ZE7A 1OB2A 1YZUA 4P4TA 4GT1A 2Z43A 2JDIA 4OQFA 4OJQA 1RPZA 1P73A 2GCOA 2W6JA 2CBZA 5AJZA 1I2DA 1ZRHA 3W3ZB 4D0GA 3K09C 4LC1A 3X1YA 4B34A 4B73A 5FPKA 1FW6A 1TX4B 2A30A 4QGAA 4A15A 3IDQA 2ATVA 5J4KA 5JMTA 1N2CE 4NYIQ 2FX3A 4M22A 4JLNA 5TARA 3EZ7A 3BS4A 4NH0A 3EASA 2CCGA 3GJ4A 1KAGA 1XFAA 2GEUA 3B1WA 4MH0R 4QRHA 3KKNA 1M7GA 3A1WA 4V02A 4YDHB 3VKWA 2OLJA 4H9GA 4ZO4A 4NONA 2IC5A 3ADBA 3OFNA 4KVGA 1N25A 3REGA 2F3RA 4TTQA 2ZYUX 5EUQB 3KTAB 3A1SA 2V1XA 1M74A 1T3HA 4DSOA 3KJIA 2EW1A 2ZRKA 2RMKA 3QVUA 4IOLA 5KUTA 4LYJA 1W48A 1S8FA 2PMKA 3EARA 3LBNA 3LW8A 3EWSA 4D4LA 1NN0A 3IILA 1W5TA 4QGGA 4MA4A 2JAQA 3FYHA 3RS0A 1F60A 1UF9A 4D0LB 4XVUA 3VKHA 2IYVA 1P4SA 2YC4C 4DT1B 4OK5A 4BFUA 1HEIA 5EP2A 5HTKA 3CNLA 3FVQA 3L43A 2A5DA 3AVXA 4Q1FA 2QP9X 3NXSA 5E3HA 3QKSA 5J47A 1ZM4A 3KX2A 5KNBA 3VR2A 5DHFA 1T9HA 3BD9A 4RD1A 3NDBB 2W00A 1UDWA 1KI7A 1TUIA 2WJJA 3KTAA 5E7IA 2ZI6A 3VR3A 3LFUA 2JLXA 4WXPA 3U7HB 1UEJA 1VHLA 1VG1A 1ZMXA 2UVQA 3IHLA 3LX5A 4OK6A 1M34E 3X2SA 3G0HA 4H1VA 1AM4D 1Z47A 1Z83A 4LDJA 5JFGA 1P9WA 4P31A 1A4RA 1KK3A 4PQYA 3QI2A 4DT1A 1N0UA 2IL1A 5JEEA 1NNEA 3W8RA 3ZZUA 2P65A 2RGEA 2ZRBA 4DWJA 2A78A 2L0XA 4JSTA 3M1IA 1JXMA 3B78A 4JLBA 2B8TA 4ESHA 5F9HA 4JMPA 1G3UA 2H16A 2MSDB 2IK8A 2GKSA 2GK6A 3CX8A 3SOPA 3GLIB 4A2QA 1ZIPA 4NHOA 1II0A 5KPDA 1S96A 1JALA 4HYYA 1JAIA 2WTUA 1YZKA 1G4AE 4RZXA 4Q48A 4IEIA 4DVGA 4N0DA 2ZITA 3ONWA 2YVUA 1KOFA 1Q1BA 1Q57A 4Q9LA 2VF8A 4GPTA 4M9SA 2ZJAA 3AQ4A 4RKEA 1KDTA 3B7GA 2ZJ5A 1CJTC 1K8RA 4DCVA 1TQ2A 2FPMA 5CLQA 2ZE5A 3BE4A 2QP3A 1ZNWA 4LHVA 3M6AA 1CP2A 2LKDA 3NHAA 3I73A 4B2LA 3NVAA 2ZRMA 3AF0A 2D74A 3KL4A 5DIFA 2KWIA 3TBKA 3GLIA 1G5PA 1KO5A 4GZLA 2RGXA 4KSBA 4Y0VA 1G5RA 3QF4B 1U2RA 2G9NA 1OYWA 1T0HB 4K46A 1QZXA 2EU8A 1UBEA 4V03A 4LZZA 2CE2X 1ZM3A 1VYUA 4EAQA 621PA 1XTIA 3A58B 4TMWA 4D6PA 3EA5A 3ETLA 5ELXA 3EC2A 3TGPA 3RNLA 5TVKA 3Q85A 1J90A 4X8LA 5DISB 2CLCX 2ODWA 2ZE6A 4HLDA 3ZQ6A 1X1SA 2F9MA 3E2IA 4HI0E 3RANA 1FX0A 1LS1A 2ZRDA 1ZU5A 1TF5A 1X8KA 3QF7A 4EFMA 1H65A 4MGZR 3DL0A 2QT0A 2GILA 3QF4A 1OH5A 4JLJA 5CJ2A 4WIAA 1E2NA 1NN1A 1EESA 3PUVA 4QGHA 1ZNYA 5CIQA 1FQKA 4YLGA 3FFAA 5K8UA 1G21E 3NH9A 4E03A 1WP9A 4C0HA 1HT2E 1BYUA 3ZH9B 2X1VA 5H70A 4I1SA 3D3QA 3A6PC 1CTQA 2OLKA 2BDTA 4HSEA 1NMZA 1GWNA 1ZUIA 1SKQA 1XPRA 2WMNB 4WZ6A 5HPYB 2PJZA 3SJZA 5C2JB 2NO7A 3B1YA 4EPTA 1SKYE 3UMSA 1QDEA 3RC8A 2YZ2A 1G17A 4Z1MD 1KK2A 1NVWQ 2ODNA 1KK1A 4CF7A 2IYRA 1Z6YA 2NO1A 4DSUA 1RRFA 1IXSB 3BFXA 2JASA 4Q18A 2ZYWX 1VECA 1OE0A 4MKGA 1MRSA 1J99A 2QU8A 2GZAA 4TYWA 4L9SA 1FUKA 1XTJA 4RCZA 3R8CA 2A5FA 4EKDA 1KZ7B 5C4GB 1U99A 1U94A 2VPPA 2XB4A 1NLZA 4B6EA 4PZLA 1AS2A 4Z1MA 3GLGE 4EIWA 2EVWX 1QG2A 4XWOA 1A2KC 3VQTA 3C41J 4PC1A 1JJVA 3T5DA 2NGRA 1SVWA 5JBQA 4PANA 4UJ5A 4QFMA 2HJVA 1NIJA 1KO8A 4CYMA 3GJXC 4WW0A 1NVVR 2ZSEA 2QAGC 3L82B 1XPUA 3AVWA 4DKXA 2HUPA 1XJCA 3W34A 2PZEA 1LF5A 2ZI3A 3WYFA 3AF1A 3MMPA 4QBFA 2HT6A 2IS2A 5FL3A 3I8SA 2A5GA 2OCAA 3LBIA 1NBME 1XB2A 4D4MA 2PZGA 2CL0X 2F43B 3RSOA 5C46F 3TAUA 6Q21A 3QIAA 1Z22A 1GKIA 2Q9CA 1PLKA 4A8JC 2ZQ5A 1N3BA 2NZJA 3HR7A 1EWRA 1RYHA 4JLVA 3K70C 3I62A 1T8UA 4EFNA 3F8TA 3FGNA 4Q01A 3AKYA 2WOJA 5JJIA 1JR3D 1G5TA 1SVKA 5FFMA 2QTFA 3F3YA 5L3SB 1N5KA 5EE1A 3THOA 4DLYA 1E79D 2DHRA 1CJVC 1KNXA 4QGFA 4NMMA 5J4VA 1XRJA 5B2ZA 4XVRA 2NPFA 1LB1B 1OXXK 1T0JB 4JJZA 2YOGA 3CUEF 4P33A 5DYIA 5LB2A 2ZXUA 3U3JA 3WNBA 3DKVA 2GNOA 1KI2A 2F43A 4QHSA 4RD2A 5DYGA 5DGXA 3GD7A 1OFUX 3HU2A 3RS7A 4BZQA 4DCUA 2YWHA 4IRUB 2Z4RA 2AN9A 2ZRHA 2Q9BA 1MV5A 3TK1A 5L3QB 5CJPA 3KKQA 1JR3A 1TU4A 2WKRA 4EFLA 1W36B 4JVNA 1IN4A 1JPNA 2GXUA 2ZREA 4YMWA 1N6LA 5HE8A 1E0JA 5AUNB 1DAHA 4JSYA 4DEXA 3BGWA 1JEEA 4B6FA 1W36D 1E79A 1RIFA 2AL7A 2IYZA 2ZS9A 3MRSA 5HKKD 3D8BA 2RKOA 2WIBA 3L2OB 1V43A 5L3SA 1TADA 1P2SA 4C30A 4JVMA 5JWOA 1W1WA 4DXAA 3ZGXA 5JSZB 1II9A 2CMKA 2V8OA 4ACBA 3GLHB 1FP7A 3KKOA 2CCKA 4RZUA 5FUWA 4BZXA 3KDSE 4GMXA 1XTSA 2AD5A 3X1ZA 2O8EA 2CJWB 1KMQA 3LX8A 3QXHA 1A5TA 3CKLA 3QBTA 3HP1A 1M7HA 3AF4A 3EAQA 5FBQB 2ERXA 4PPFA 5L3QA 1US8B 2ZI7A 3HWSA 5HKKA 2IW3A 3AVTA 4DB2A 3BOSA 3U61B 2O8DA 2WBLC 3CM0A 3GJ8A 5AJYA 1XZPA 3FE2A 3BFKA 2CL6X 2ZIAA 1NG1A 3PITA 3W3AA 3GLHA 2O8CB 2B7CA 2IHYA 5JI2E 5L3VA 4LJ5A 5IF9A 4C0AC 2CLSA 3Q9LA 2G6BA 2ZJOA 2V9PA 2F9LA 4IDQA 2BEKA 2CJWA 4Z51A 2DWOA 4DCTA 1R5NA 2WWGA 3AH8A 1Q1EA 2WHXA 1U0LA 1KMHB 5B64A 1US8A 2QN6A 3K0CC 2HDNB 4RJLA 4ZIRB 1W47A 3QKUA 2H7VA 3KJEA 4HUQA 4XSHA 3I72A 4A9AA 4AYTA 5B57C 2QBYA 4C2UA 4C2TA 2ORIA 1GRQA 2VO1A 5EE9A 3T1OA 3U44A 4WXRA 4M0LA 3K0FA 2JLSA 2QZ4A 3T15A 1PVOA 2AWNA 4FIDA 2P0EA 1XD2B 1IY0A 4U7DA 2ZS8A 2J7KA 3ZQJA 1E1RD 3QXXA 1OJLA 1S9DA 2GHIA 8OHMA 2O8FB 2OFXA 2ZRAA 3LVQE 1FNMA 1KYIA 1EXMA 1X8JA 1KMHA 1D2MA 1CBUA 1LNZA 5FPTA 4B35A 3R9XA 3K9GA 2PT7A 3CZPA 4GL2A 3B8HA 2P5SA 3B9QA 3FMIA 3ZS9A 3TUIC 4FCVA 1SHZA 4B32A 1E2LA 2I1VB 4JBYA 2ZRIA 4C0QC 4D82A 2UZ3A 2E87A 1FFHA 1XD2A 2BMJA 3CO5A 1TMKA 2FN4A 1OF1A 4URVR 5JJLA 1L2TA 4HZUB 1E1RA 5JRZA 1E2MA 2WJGA 1AQUA 5CDFE 1OH8A 2J46A 1IN5A 3FFBA 1AK2A 2LCFA 3IQWA 2IWHA 4OQMA 1UBGA 4PAMA 1OIVA 4G3XA 4V0LA 5B30A 2O8FA 1SXJC 3BFVA 2FA9A 3SJAA 1LV7A 3B1ZA 4M1TA 4Y0AA 4JLAA 5G41A 5D3MB 1WBBA 4EQ6A 2REOA 4M1WA 3GLFE 5JWRA 3SBEA 2WJYA 1Z0KA 1R7RA 1KI6B 3DVLA 4QBIA 1WA5A 3WMGA 3TSZA 2GXQA 4Q4JB 3SNHA 1E0AA 3QSYA 3UPUA 4HZUA 2PMDA 4RZ3A 2ZI4A 2ERYA 2LWIA 3CF0A 1DAFA 4LPKA 4Q1CA 4ARZB 5LD2C 4AK9A 2V6JA 1C4OA 4GOJA 4LBZA 4IDHA 3LW7A 1VCMA 4WZBE 1HH4A 1KY2A 1JBKA 3KB2A 1KTVA 1ZNZA 4S2EA 1CJUC 3MAAC 5KYKA 2W2XA 5D3MA 1NI3A 1E1QD 2UZIR 5BYJA 2CXXA 4B3DA 4EPXA 4AKIA 4A6XA 2IUSA 1KKMA 3NH6A 1XEXB 2IYWA 2QORA 2JLUA 1E9FA 4F4IA 2PJRA 4DDUA 3GLGB 1KI6A 1UDXA 1XEWX 2C96A 3SYLA 1ZIOA 2OCPA 2V4ZA 4Q5IA 2GJKA 3X1WA 3WRXC 1IN6A 4L16A 3RS4A 3WBKA 3B13B 1OLOA 4ARZA 5BN5A 1E69A 2ZR0A 3U3OA 1QHSA 5CK4A 2R6AA 1XDBA 1F5NA 1HUQA 2GTPA 5FH9A 1E1QA 2X2EA 1KDPA 3HYRA 1K5DA 3C5CA 4LJ7A 2D62A 1LTQA 1XEXA 1Q21A 3W5JA 1RRGA 5TY0A 3OESA 3QG5A 3AVOA 5F3WB 4A4DA 2RB4A 5BW8A 3FHCB 4PPQA 3TSWA 1YQTA 4UXJA 1CRPA 1DO0A 4IKEA 1UPTA 2GJAA 2RGCA 1SXJE 1XWIA 2YNMA 4BFWA 4MITA 1XMVA 4M1MA 3TR0A 1Z2AA 4F4JA 4FXPA 2FDCA 3B5JA 3LNCA 1W7AA 2OHFA 2ZROA 1ZNXA 2GESA 4TMZA 4TMVA 4TYQA 2ZANA 1KO7A 3UMFA 3K0EA 2AXPA 4OI0A 1J2JA 5JI3E 4URYR 3KXLA 1T4GA 1U90A 4XD7D 3L8YA 5F9FA 1G16A 2QQ0A 2QPTA 3ZD6A 2DYKA 2WIAA 4KYUA 3UKDA 2D7CA 3VTKA 3EPLA 3AP2A 1GSIA 1QHXA 2R6DA 1AGRA 1OV4A 4BPBA 1WF3A 1XJQA 3OEED 4M1YA 2RHMA 4Q1DA 1Q3TA 1OXSC 2GJ8A 3MJHA 3CR8A 4PR0A 3KXIA 1CR0A 2OFWA 4C0SA 4DSTA 2F1RA 4CEJB 2PH1A 1SZPA 4FMDB 3TSOA 4Z54A 4V0ME 1XF9A 2FPLA 4V0OA 1QHIA 3T35A 5AWFC 3AKEA 5DSZA 2C8VA 2ZSFA 2JGNA 4XD7A 3WXMA 2C2HA 3C4JA 4JKYA 2FU5C 4KJZA 1FPMA 5LDDC 3P4XA 2D4HA 2XTNA 2QTVB 5DO9A 2NG1A 2G3YA 4UJ3A 3ZZTA 4C0JA 1P2VA 3T1TA 2ATXA 3LBHA 3A4MA 3OEEA 2GEVA 4HB0A 4II7A 4RFSB 2QAGB 1QF9A 1D2NA 2QENA 2HXYA 1BYIA 4AKEA 4LSGA 2CCJA 1E4VA 3O47A 4F92B 3MWLA 3SS8A 1FZQA 1S4QA 5DI9A 3QNUA 4TL9A 3HR8A 1KNQA 3EWAA 1U98A 3CR7A 1XP8A 4C0LA 4DCNA 4G0NA 2GBLC 3BIFA 3PQCA 3ZVLA 3VX4A 5EZ5A 1VG0B 2KSQA 2OCYC 1E9DA 3WP0A 3QKRB 5EQTA 1GILA 5CB8A 4K8OA 4A8JB 2EFDB 4IFEA 2Z83A 1R10A 1Y63A 3GQBA 3IBYA 2R2AA 4DB4A 3K70B 1XMJA 1XZQA 2ODEA 2WWIA 3MWYW 1P6XA 3K70D 3FPAA 1RW4A 3O8RA 2VP0A 4LWZA 2EFCB 2QAGA 1T5LA 1OYYA 4GNKA 2NOAA 2VYFA 1YU9A 2AHOA 2IYSA 2REXB 2WSSD 3V4RA 1E2PA 4JLMA 1NSTA 1ZINA 2IYQA 3RRZA 4HUTA 2JJ8A 3I5XA 4NL4H 1E2EA 4HLQB 3T34A 4URXR 2BC9A 4B44A 3MJRA 2R6GA 4OL0A 4LOAA 2GCPA 1G3QA 3IHWA 1F2UA 3AF2A 2P67A 3I4LA 3NBFA 221PA 2FE4A 3QKRA 4HDQB 4QHTA 1N6NA 2ONJA 3RS2A 3ZJYA 1TQDA 4O25A 4A8JA 3AGPA 3ZVMA 4RSGA 3FOZA 3A1TA 2YWGA 1N6OA 3MLEA 4CRWB 4CIDA 2AD1A 4R9UC 3U5ZB 2NMVA 1M6NA 2VHQA 4KHZA 3Q7PA 3EZFA 1EX7A 2WSSA 2GJ9A 2DFLA 1ZC4A 4I81A 2J1LA 4NCNA 2OBMA 4TYYA 2PLRA 3GPLA 1EFUA 1Z0IA 2OE2A 3CRMA 4Q03A 3IBGA 4TMTA 4RVCA 1HE8B 4TLBA 1RE0A 1FP6A 4KYIB 4TLCA 1D9XA 4DUGD 1KDRA 4AYWA 5FBLB 2WZQA 4AYXA 1SGWA 2DBYA 2GETA 3LRPA 3LDAA 3IIMA 5HE9A 4DIEA 2O8DB 4FN5A 1JXOA 5LPNA 2UKDA 4DCSA 3THXB 1NN5A 2ZR7A 3CLVA 3L0SA 3TE6A 2XZOA 1D8TA 3CNNA 4E07A 4Q00A 1ESMA 2ONKA 3GEEA 3LWNA 3T1VA 1GVNB 2FFQA 5JLJA 4US0R 2E9SA 2QTHA 2ANBA 4AY2A 1G3MA 4DUGA 4MDFA 4HAXA 3LD9A 3RABA 4QXAA 3QEJA 1LVGA 1XEFA 3BK7A 1U9IC 1S0UA 2DCUA 2BV3A 2RHDA 2WM9B 3D6TB 4FMBB 2EQBA 1XCMA 1XXHB 4P4SB 3EC1A 3B1VA 1U0HC 1P3JA 1GTVA 1Z2CA 2VQSA 3B6EA 5DHAA 4TQUS 1E9BA 5AUOB 1Z6XA 2VBCA 3UMRA 3LXRA 4OHVA 2FEMA 4Q66C 4TN1A 4XIGS 5AUPB 3U7GA 2BMFA 1EFCA 2PX3A 4IJMA 5GJWC 2IT1A 2ANCA 4V0NA 4J0QA 4LJ4A 3UG6A 2CNWD 2VP2A 2EFEB 2Z5FA 2D2FA 4CDGA 2Q3HA 1F2TB 5C18A 3UIEA 5JRJA 1Z29A 1A2BA 1ZP6A 1G19A 4Q4AB 2F55A 2PBRA 3OZXA 3MCAA 1LF0A 4BEBA 3Q8XB 2BM1A 2J5XA 4DC9A 3KKPA 1M7BA 1XXHA 2FFHA 4P4SA 1ZCAA 3MFYA 4YXWD 1L4UA 2FSHA 2IEZA 3EA0A 4BQSA 2XNDD 3K8YA 5EP3A 2H18A 1C9KA 1MOZA 4KVAA 4LBWA 4ZPXA 1WRBA 1Z0DA 1ZCBA 1DELA 1D9ZA 2XTZA 1VCOA 1DE0A 2CNWA 2OBNA 2O0HA 3NWJA 5CK5A 4A2PA 5FPSA 2HYDA 2JATA 1F2TA 1G6OA 4HAZA 2ZJ8A 2OXCA 3NKVA 2ZJZA 4Q4AA 2JLRA 1G6HA 1WBDA 2OESA 1NLYA 2BBWA 2J0UB 1G9XA 1G8YA 3D31A 1UJ2A 2VP9A 1HV8A 4YXWA 3M0EA 5JS8A 2XNDA 1SXJB 3IPXA 4EDHA 2OZEA 2QSZA 2ZRGA 2JLVA 2PX0A 4QJ5A 2FGJA 2VLIA 1SXJD 2PT5A 4C9BA 4LHXA 1NL3A 4Q1BA 2WVJA 4YONB 1OFHA 3CBQA 4R2IA 4DLXA 1J8YF 4H1UA 2C77A 3MUFA 4E09A 1E2QA 2WAXA 4LYHA 1L7VC 1TAGA 4TQ9A 4JLKA 3I1FA 2IYUA 1SHKA 2GCNA 3PJRA 2J0VA 1N5JA 1GKUB 3QKTA 4W9MC 4DBLC 4QJ3A 1G18A 1KIMA 3AVYA 5LD2B 1VYVA 4Z8XA 1CF4A 2J0UA 1G3RA 3JZMA 3KFXA 2FSIA 4KV9A 3BH6A 4N1AA 2J9RA 4URWR 1VDZA 4P3YA 1SXJA 1N0WA 2BKEA 1XX6A 4FINA 2WJIA 2RGAA 4QJ4A 4PHFA 3P27A 4YDSA 1UKYA 1FTNA 2C03A 5P21A 1N6KA 2FEOA 5DI3B 2P6UA 4F93B 2VSOA 2ZYVX 4KLZA 3THYB 3PXGA 5KSYA 1IAQA 1H8HD 3H86A 3M4YA 5AJWA 1KKLA 3TAHA 1P9RA 4LYFA 1YZNA 2VSXA 4RCYA 2FPKA 1PUIA 1OT3A 3K9NA 4QNRA 1BS1A 1E3MA 4TZ6A 4TL7A 4PC6A 3KB1A 2GWHA 5FR2A 2OILA 1RVDA 3AVPA 2QRNA 3PIRA 4M9ZA 3OIYA 3W6NA 2FMXA 4OI2A 2ZETA 4XWAA 2IA5A 2ZSAA 2CK3D 5AR1A 5B58C 4CEIB 5AUQA 2EYUA 1X8LA 3BORA 4UNQA 2DY1A 4TMXA 5FTJA 1G7RA 2F7SA 5DI3A 4XWKA 4Q19A 1O87A 1H8HA 2G88A 2ZYTX 4MYUA 3THYA 5DLQC 2PEYA 2WJVA 4KBFA 3SJBA 5FBRB 3TH5A 2IWRA 3SZRA 4IVPA 3T12A 1JJ7A 2IEYA 2F6RA 1G7SA 4WVFA 1WDTA 4HAWA 3QQ5A 2VHTA 3D7MA 3LH5A 1KAOA 2R44A 3AV0B 1VCIA 3CRW1 4YMSA 4F7WA 4I1VA 1J8MF 5HZHA 2HEIA 3ASYA 3RRNA 3TLXA 4V0KA 3GJ0A 1OIWA 2D3WA 2FFAA 3CF2A 2CK3A 1KO1A 1Z28A 2NO9A 1N6PA 3PR1A 4LUCA 4CEIA 2YOFA 3R8FA 1NIPA 1M2OB 5GADl 1KI1A 1LFDB 2W6ID 2ZRJA 4BFZA 2R6CA 3AP1A 3SI7A 3ADKA 1X3SA 3UWOA 1KJWA 1IOZA 4O0MA 4DSNA 4KFSA 3DPUA 2F1HA 2OT3B 3TKLA 3NTUA 1R5OA 4KCGA 4B47A 1N6RA 4EUNA 1NY5A 3SYNA 5HZKA 3P4YA 2IS1A 3DM9B 1ANKA 3QXJA 3NBZC 4FMDF 3KQLA 4ILEA 1T6NA 3PFIA 4JJKA 3JVUA 1JEDA 1YZLA 4NCJA 2QMOA 4ASUD 2BIFA 3JVVA 4QBGB 4GFDA 2O0JA 2PZFA 1DAKA 2W6IA 3I61A 4JLOA 5JCPA 3H1TA 4HAYA 4B3XA 5CIWA 4GDFA 1W4CA 4KLNA 2EYQA 4TL8A 4KITB 1P61B 4AIIA 1A1VA 5TDHA 3WMFA 2IXGA 2DFTA 1E4YA 1DTSA 1L8QA 1TTTA 2CE7A 1ZM9A 3C15C 2B6HA 5IRCD 3ECCA 1UFQA 1XBTA 3PEVA 1KJYA 4DLRA 4NP6A 2IHBA 2RGBA 3P1JA 2ECKA 1AIPA 1XCGB 1CR2A 3CWZA 3K9LA 4ZKEA 2VEDA 4KBGA 1TU3A 4AG5A 4LK2A 4MRVA 1R0WA 3PUZA 3GCGA 3BBPA 4NE2A 3U6KA 3KXKA 1P60A 1E98A 1HA3A 3KQKA 5BQ5A 1G7CA 2OAP1 1JECA 3VNUA 4PSAA 5GJBA 3NEJA 3LLUA 1YR8A 4QL3A 5FOWA 5FUYA 4OHZA 3TQCA 5KSPA 5UKDA 4JVLA 4LV5B 4TLEA 2BCGY 5EP1A 2J0QA 4PC2A 3CW2A 4QNMA 1NP6A 2JA1A 2XTMA 4M8NE 1MKYA 4LHWA 2FZLA 4L8GA 4PTLA 1DAIA 2VIIA 1IN8A 2ZJYA 1CR1A 4G5OA 2JLYA 2DWQA 3LVRE 1CJKC 2K5UA 2YYZA 3ND8A 2X2FA 3T06B 4BECA 3CPHA 1Z8FA 2KI5A 5HR5A 3CZQA 3PCRB 3B60A 5TB5A 3Q5EA 4BFSA 4DLZA 5JSZA 2ZEJA 2C04A 1CULC 2BEJA 4C0KA 5FTMA 1D2EA 2ASEA 1G8GA 3TUJC 2WWHA 1WMSA 5FPHA 1YE8A 1DAGA 1U8YA 1BO6A 2EFGA 1DADA 2ZI5A 2PCLA 5J5CA 1QBKC 2ZJ2A 2YWFA 3RAPR 4EJSC 1SULA 2BM0A 5DE3A 1KY3A 4PHTA 2O5VA 5EUMA 4BLOA 4EPVA 2C9YA 3TW8B 5JWHA 4UNRA 1YJ5A 3CPEA 3OF5A 4LBVA 4CW7A 3TR5A 1DAMA 2VRWA 3EXAA 3ZVNA 1GDDA 1XPOA 1NG9A 2F1IA 3K09A 1JB1A 1UKEA 4JT4A 1Z5ZA 4TLDA 4YC7A 1AZSC 4A92A 1CIPA 3SC3A 2O8CA 2HCJB 1BMFD 1U8ZA 1ZM7A 2C9OA 2H8KA 5CYOA 4Q9HA 4A6PA 5FBVB 4OK3A 2ZU0C 5FPYA 2AFHE 4DIDA 2QNRA 3PENA 1N5IA 2ZUDA 3LV8A 2W0MA 3KZ1E 3SHFA 3WP1B 4DHEA 3RDPA 3KUDA 1GKYA 4WZAE 2XNSA 2Z0MA 1DG3A 4TT3D 1Z0AA 2Q3MA 1UAAA 1UADA 2JLWA 4ZIRA 2F1JA 5SZIA 3NBXX 3VR4A 4YMUA 4RFVA 3W9YA 2CHGA 4IVRA 3UG7A 4Q7LA 2BMEA 1T91A 2KBFA 4IDNA 3KQHA 4Q4LA 4X8OA 5M04A 1BMFA 2H57A 2R62A 5BWMA 2QGZA 2KJQA 4XH9B 2XJ4A 5KPJA 2Z4SA 3GJ6A 4OI1A 2CDNA 2IX3A 4QM7A 1UBCA 2XX3A 4ITRC 4IHQA 5E7JA 4M4SA 4TT3A 5GJVC 3THWB 1EFRD 1SVLA 2H1LA 4O2RA 1JNYA 5G40A 2AKYA 2QY9A 4LCBA 1E2KA 1RFLA 2V7QD 3HPQA 4PZZA 3J81k 1RKBA 2J7PD 1O3YA 4C7OB 3BXZA 1U8AA 2JCSA 4NKRA 4C4PA 1MO5A 1ZAKA 3O8BA 2AR7A 1SKYB 1KK0A 1RYFA 3OIVA 2ORVA 2PEZA 1GL9B 1KSHA 3TIFA 4QM6A 2V55B 1JQLB 3IIJA 1Z6GA 4RD0A 4L4UA 4Q4HB 2DFNA 2W2VA 1E2DA 1NJGA 1EFRA 2VTKA 4QKQA 2MSEB 3PVSA 3CX7A 4B2PA 2Q0HA 5IDVA 2WV9A 3GEIA 2O8BB 2ZVPX 4US1R 2V7QA 3THWA 1JAHA 2J7PA 5TXGA 3EIQA 1KSFX 2QAJA 2QQEA 1IY1A 1XMIA 4RY2A 4URUR 3DDCA 5EXXA 1GNRA 3CPJB 3X1XA 5AK0A 3NDPA 2GXAA 2E1RA 4NTZA 1XEWY 4C7OA 3VHLB 2ZAOA 4QOSA 4YMTA 5KO2A 4MYTA 2W0SA 1I4TD 4OQXA 2ZM5A 3ICEA 1DPFA 1VKJA 4Q4JA 3CONA 3AKCA 3WY9A 1K5GA 3QOFA 4W5HA 1IN7A 4TLAA 1CU1A 2G0NA 3G5UA 5GVSA 3L0OA 1Y3AA 2ZUCA 4Q4HA 1VCNA 4PHHA 4F4CA 1XD9A 3PEUA 4IOJA 2VHUA 1W49A 4BGDA 1B23P 2O8BA 1ELOA 1YZGA 2JLQA 4PFSA 2RAPA 1E99A 1I4DD 2KE5A 2WICA 5FOVA 3SHWA 3QG1A 3WBJA 3FKQA 3GLIE 2R9VA 1IXRC 5SZKB 1GZSA 4IEEA 3SR0A 1F3OA 4Q9IA 2BBOA 2C98A 4MYCA 3L8ZA 3O8DA 3EPHA 2CVFA 5EE5B 1NBMD 1VPLA 3GLGA 2V3CC 1ZW6A 3IQXA 2VA8A 1E9RA 3E70C 4JL6A 5L3RA 1II8B 3A1UA 3ASZA 3IEUA 2ZRFA 4BLRA 4ZDJA 5BXQC 1U0JA 3BB4A 2PCJA 4ZV4A 1NRJB 2I3BA 4PAOA 1UM8A 2P3SA 1E0KA 1EGAA 1SVOA 4MKHA 3TVTA 3H0KA 3UANA 3W8NA 2ZE8A 1R0YA 4ZI3A 5DN6D 4NCIA 4BRUA 1G4UR 5DH9A 2GAAA 3KQNA 1TEVA 2IUTA 2XAUA 4ESVA 3BERA 2J87A 1NBMA 3T1QA 3NC1C 2FH5B 4OHYA 1NKTA 3AKDA 2HV8A 2HT1A 2AKAB 3V4FA 2V6IA 3RYTC 1ZM2A 2Q3FA 5FOUA 1J70A 1IXZA 1II8A 4XJXA 2QGNA 4FI3C 4X8HA 5BN3A 2IS4A 4L5BA 2QMEA 1G20E 2D2EA 4UQOA 1E96A 5DN6A 4TQAA 4BLTA 1ZUHA 1CXZA 2HF9A 2P6NA 3ZD7A 1Q3HA 3IO5A 1E2IA 2VP5A 1GAJA 5FTKA 4AWXA 4PO9A 3VX3A 3WRYC 4B3GA 2CVHA 2DPXA 4LPSA 1TEXA 3G82C 4UXHA 4JVSB 4ZDIA 1Z3IX 3CRQA 3K0SA 1M1YE 4D25A 4U00A 2XOKD 3B85A 2OG2A 5DNYB 2J3EA 2OO7A 5IK2D 1XJ0A 2I4IA 1XU4A 3AUYA 5FOSA 1RC8A 1OFIA 3BJIC 1WCV1 4L15A 1KGDA 3TVDA 2X8AA 4UNPA 3QPUA 3CWQA 3NC0C 1RJ9B 3MD0A 2GEDA 4B2IA 5EE0A 2XITA 1SVSA 1MO3A 5SZHB 2HCBA 2KB0A 4CEJA 5J4YA 1PZNA 4L9WA 4MRPA 2VHCA 1HY3A 4W5WA 4ZCLA 5LB4A 421PA 4HATA 2XOKA 3DMDA 5SZJA 3REFA 1GP2A 1LW7A 3CIOA 5CYPA 2BBTA 4EPWA 1R0XA 2W58A 1MABB 4GOKA 4I99A 3W90A 4LBYA 2FF7A 3QVVA 5IK2A 4RZ2A 4JLPA 5CM9C 1ZD1A 3I92A 4M1KA 4RFSA 3RSLA 1Q22A 3EX7C 1SVMA 2VSFA 2OCBA 1VIAA 2NQ2C 4BFTA 3I8XA 2YHSA 1V5WA 821PA 2BJWA 5KHOC 3ADDA 3FMFA 3WNCA 2QROA 1XTQA 4TL6A 3P32A 3Q7QA 4TTRA 5JZVA 1TL7C 2FGKA 3BWDD 2OEPA 4YMVA 3TJZA 4D2IA 1OKKD 2JJ2D 4E5UA 1MABA 2C78A 1R6BX 5KSOA 4OJKA 5CB6A 1AA9A 1COWD 2IYXA 3R9IA 3SDZA 1NVUQ 2G1KA 1G8PA 2I1QA 1E6CA 1EX6A 1UKZA 3KKMA 1VG9B 4MYHA 1E2GA 3ICQB 1AGPA 5HCIA 3GP8A 1S1CA 1M8PA 2NZ8A 3R20A 1DS6A 5K8TA 2OXRA 5HCNA 3TUZC 4TSFD 4JIMA 3MWJA 1T5IA 1HQCA 1PUJA 4U5XA 5H1YA 2C5LA 4NZYA 3TW4A 5FOTA 3CH5A 4OBEA 3AB3A 4JKIA 3FB4A 4LI0A 1OKKA 3EW9A 1ZBDA 2GVDC 2JJ2A 2IF2A 3S1AB 1Q0UA 3EPKA 3IEVA 1AZTA 2NTYC 2QP4A 4PX9A 1JR3E 3EPJA 1TUEA 4DLTA 3A8TA 4BWYA 1COWA 4B33A 1HYQA 5H68A 1YZTA 1YR6A 3SEAA 2WMOB 2GZDA 3QKSB 4RD3A 2SHKA 1OW3B 4GP7A 1PV4A 4D4KA 2GK7A 5EXTA 3CRVA 5A5GA 1G1MA 2XSZD 5IHPA 3LQQA 3VNVA 2BCJQ 4DDTA 3SU8A 4TSFA 1GIAA 1E2FA 2XB2A 3A4NA 5FR1A 1U81A 3ZVRA 1E94E 4D4JA 4LHYA 3GLFB 3NHBA 4XTRA 3TNFA 4KXFB 1LY1A 2A2ZA 2QM8A 2D7DA 2XZPA 2FG5A 4BZPA 1GOTA 3S1AA 2WWFA 4G5RA 3U7EB 2EWWA 5FUVA 1YHNA 1ZD8A 3GJ5A 4BLPA 5CDFA 3OEHD 3PUWA 1NJFA 3AP3A 2IUUA 2XSZA 3QY0A 1CLUA 1GL7A 1ETUA 1GNPA 2AWOA 4EJSB 3SYKA 3VAAA 5JS7A 1P7CA 1S9HA 2O0KA 2HF8A 3THXA 4ZDKA 1EK0A 3GLHE 1VTKA 2A3RA 1CKEA 3N2IA 2FNAA 3GLFA 4CEHB 1JQJC 5BYKA 1L4YA 2C9CA 1FOEB 3X1DA 3IPYA 1NMXA 3QBVA 3QENA 3SQXA 1OB5A 3KJGA 1P62B 4LJ9A 4W5JA 3SBDA 3OEHA 2GF0A 2YKGA 1Q12A 4D81A 4ZCMA 4A0GA 2HXSA 2QPOA 4O3MA 5FTLA 4BASA 3K0CA 4R98A 4MRSA 2GRJA 5KNCA 4EJSA 2R8RA 1AQYA 2QL6A 2OAQ1 3TQFA 3EIHA 4G5GA 4JYCA 4LJ8A 3FHOA 4KU4A 3U4QB 2AFIE 2A7QA 3ZIAD 1KZGB 4GBMA 4BLQA 2FZ4A 2CEAA 4CEHA 2RGNC 1IBRA 3HYTA 3U3RA 3W6OA 4D0NA 3BRWD 3SJCA 4PQRA 4WBSA 4R71A 4C0BA 3HU3A 5F98A 2KBEA 4NU0A 1P2TA 5FI1B 5ANRB 2TMKA 4JLDA 1UBFA 3A36A 4G01B 1G291 3WHLA 3DM5A 4RKFA 2ZTSA 3IIKA 1W2GA 4JL5A 3RHFA 1OSNA 4BLSA 1AKEA 4NYMQ 4M21A 4S35A 1QVAA 3ZIAA 2N42A 1F6BA 1W5SA 521PA 1S3GA 3FMOB 3U4QA 1Q1QA 1FX0B 1T3LA 2ZR9A 1TQ6A 1Z07A 2WSMA 4HDCA 1TNDA 1Z08A 5FOXA 1HURA 4HLUC 1I4LD 4BUJA 5G3ZA 1H8ED 4W7SA 1JI0A 2JEOA 3A4LA 3LXXA 2DB3A 3H84A 4FCTA 1R4AA 3DOEA 1ESNA 2J41A 5K8IA 1G8HA 2IXEA 1MO4A 2WWXA 4HB3A 4GMDA 4GRAA 3MGCA 3RVBA 3VU9B 1GUAA 2ZJBA 1Q20A 1XTKA 4TWZA 4XVQA 4ERNA 2QEQA 3GFTA 1P5ZB 4I1UA 1RZ3A 3EG5A 4Q1EA 3SE0A 1R8QA 1H8EA 3FKSD 3NIBA 3UK6A 2IBMA 4PO8A 3QEOA 1X6VA 2YC2C 4DLWA 5E4FA 1W4AA 1Z0JA 2WPDD 2QRZA 2J0SA 4CT4B 4LJYA 4LJAA 4PAQA 2IXFA 2QM7A 3DZ8A 4MRRA 2Y8EA 2QA5A 5KU1A 1KSGA 4RD4A 4LGMA 4B75A 1TF7A 3N2EA 4MGKR 3T5GA 3OHMA 4M1SA 3VU9A 2H17A 3B1XA 4PSVA 2OUKA 1X1RA 1SQ5A 3IUYA 2Z6VA 5KTYA 4NDZA 4AKHA 4KSCA 2B7BA 4MUAA 3LQRA 4X8MA 4V0MA 4DJTA 3FKSA 1QVRA 1QHGA 4B3CA 3SFZA 4AD8A 2RCNA 1E32A 2WPDA 3OAAD 1VMAA 4EPYA 4ON9A 4TMKA 2IYLD 3VHXA 1KI3A 3DO6A 2ZAMA 4G5SA 3V9PA 3WNDA 4BEJA 2DWPA 1PLLA 4DLSA 3QXCA 1OH7A 1IM2A 1UKVY 1W0KD 2JJ1D 3H2YA 4URZR 3CH4B 4R7ZA 5GVRA 3RWOA 1ZVQA 2BOVA 3HPRA 4Z8YA 2MSCB 2QE7D 1W4BA 5EE3A 3PEYA 5AJXA 1N0VC 2FFBA 4LRWA 2GJSA 3OAAA 3DKPA 3B82A 2BKUA 1FMLA 2FOLA 3K9HA 2GZHA 4LC0A 5G3YA 4PHGA 4UNNA 4P32A 3L0PA 1BOFA 1CS4C 1DG1G 1YZQA 4I4LA 1AS0A 3QE0A 4NYJR 2PLFA 3VR1A 4B76A 2IS6A 2J59A 1AKYA 2Q6TA 1IONA 1W0KA 1A82A 2FSFA 2JJ1A 3BAFA 1ZJ6A 2ZRPA 2RGDA 3BB3A 3QPVA 3QUSA 4ACAA 3OE7D 1YR9A 4XTCS 2QE7A 2ZSDA 3IGFA 4TYNA 4MUBA 4HAUA 2Q21A 4FMCB 4NPHA 4B3FX 1WQ1R 4JL8A 3I5YA 3WMEA 1XMSA 2VP4A 2P5TB 3C16C 3MWKA 3KUCA 1G7TA 2QT1A 1AJEA 3LAWA 4QG7A 1Z6AA 3VKGA 1XTRA 3UWKA 1IJFA 3RRYA 4Q02A 3RS3A 1GRNA 2ZUBA 5JHHB 3K53A 3AGQA 2G1JA 4POAA 4IXMA 3OE7A 4B48A 2Q9AA 4IDPA 2ZS7A 2BJVA 4IDOA 4ASUA 4XSGA 1XCPA 4A0RA 1G8FA 1Q44A 1EWQA 1TQ4A 5JHGB 5FBWB 4LJ6A 4D80A 2IYYA 3SN6A 2VHJA 3HU1A 4DZZA 1G64A 4NCKA 1HQYE 2QSYA 5CM8B 1AN0A 4HAVA 4DEYA 4ZDWA 2H92A 1Z6TA 3OIUA 1ZC3A 5FI0B 3R7WB 4DDWA 4IFBA 4HEJA 2O8EB 4ZKDA 5EXPA 3QPWA 2YV5A 3GJ3A 1ODFA 4B71A 1N5LA 3KFVA 3L0IB 3A1VA 4LHZA 2FWRA 4CZ2A 1P9NA 4KFUA 4PC7A 1R5BA 2HJGA 1N6HA 1Z0FA 4HB4A 4KO8A 3C5HA 4U02A 4CT5A 1CR4A 4LV8B 3N5CA 5CLLA 2P2LA 4FD2A 4UXIA 1WXQA 5KDLA 5EZ6B 2A5JA 1P72A 4HZIA 3PUYA 4PPNA 1HT1E 1CJMA 1W2HA 1KHTA 1YKSA 5L8VA 2EFHB 2GBLA 2QMUA 1DO2A 2BWJA 5JEDA 4MDEA 4M1OA 3WYGA 3CF6R 2JIZD 2CL7X 3R7WA 3EIEA 1DBSA 3Q5DA 2AXNA 2GXSA 2D06A 2XEXA 2B8WA 4M2LA 4Q47A 3SFVA 4DLVA 4LY6A 4M53A 1FNNA 1TF2A 3DMNA 3WHKA 1QHNA 3K1JA 4LV6A 1D5CA 5E7MA 2OFOA 3EZ9A 3AEZA 4AI6A 4I1OA 4HUQB 3AVUA 2FJUA 4NYIR 2XXAB 2VP6A 1DARA 2X19A 4Q7KA 3FMPB 4IXNA 5FUXA 2QBYB 1FUUA 1ONBA 3LA6A 1YRAA 2OBLA 2VF7A 4F38A 3U44B 3K0FB 2QI9C 5KOYA 1ZYUA 4PPGA 1CEEA 5BN4A 1FL9A 2JIZA 2G77B 2OV2A 4TYPA 4BE7B 4GP6A 2DFKB 4XOIA 5FL7D 3C14C 3GMTA 3AM1A 1NLFA 3MG9A 4TTPA 3Q72A 2NIPA 3F5FA 5KSZA 4GSYA 3HDTA 2ZU6A 5H8WA 4PXAA 1WB9A 2ZPTX 4HB2A 4B74A 3LO5A 1S3SA 5EP4A 3ZLJA 1NSFA 5E95A 2GF9A 2XXAA 4A36A 4TZ0A 4MKFA 5GJCA 2QPAA 1AS3A 2C95A 3VR5A 3U2QA 1DAEA 1X86B 1RRCA 5AJVB 3GFOA 2WJHA 1OIXA 4FWIB 1OHHD 5FL7A 3W5IA 4ZCIA 2ZRCA 3P26A 2QG6A 2J45A 5TMPA 3QXSA 3WYAA 4B43A 4PSKA 1T8TA 3PG5A 1MO6A 1EFHA 3EZ6A 4OI4A 2MMCA 5KDDA 1NF3A 3ZYCA 2C99A 2ZVQX 3CB4A 3NBYC 4E22A 1IQPA 3O8CA 4A2WA 1VYTA 4JBXA 1GM5A 1LS6A 2NO6A 1IJEA 2AX4A 4EQ6B 2WKPA 1BIFA 3BC1A 1VG8A 4DRZA 1QRAA 2GVZC 1OHHA 2X77A 4AKGA 1FQJA 4R2HA 1NN3A 2REBA 4HDOB 3PEWA 1S2MA 2ODBA 3RLFA 1OXUA 3SQWA 3RWMB 2YOHA 3NG1A 1QHHB 3AF3A 3U7FB 1N6IA 1P75A 4FWTA 1NMYA 1U9IA 2VH5R 4G1UC 2WAYA 3NEYA 2WWWA 4A82A 4DLUA 3UATA 4EPRA 3DZDA 1PLJA 1DEKA 2PL3A 1ZU4A 2B92A 2YWEA 5A4JA 3JZAA 4UKDA 4Q1AA 4KFTA 2IYTA 4PC3A 1QG4A 1GNQA 3H4MA 1OH6A 4PO1A 3IKJA 4P0TA 1G3IA 3DEFA 1JR6A 1E0SA 1E9EA 2CLDX 4NYMR 1GFIA 4OYHA 2BVNA 4N3NA 4P4UA 2BBSA 1A7JA 3VR6A 4ABYA 3KQUA 1XXHE 2F3TA 2R65A 2RGGA 1QHHA 5K8LA 4OQLA 4OHWA 2WWYA 5G53C 3B2EA 1TPZA 3P20A 2MMGA 2ZRNA 3CX6A 2N1BA 3ADCA 2BMDA 2NPIA 3FDIA 4KAXA 4QHYA 1HTWA 2A9KA 4KI0A 4IVQA 4BRWA 5F2EA 3W6PA 1S1MA 3GJ7A 5JJKA 1P2UA 3F0TA 4C3ZA 1MRNA 2RGNA 1NY6A 3IO3A 3ND9A 1E2HA 1OXVA 3R9WA 3RRMA 2IF0A 2R6FA 2O52A 5JCZA 4BFXA 2DR3A 5IT5A 1K6MA 5A0FA 1YVDA 3U3MA 1MH1A 1B0UA 4F91B 4LYAA 3T61A 2RH5A 1NKSA 3BB1A 4NBSA 1JPJA 1WE2A 3VMFA 3PUXA 2G0TA 2ZSBA 2QMHA 2WKQA 3EZ2A 4WA7A 2XZLA 1E9CA 1OXTA 5C1BA 4BFYA 1I2MA 4IOMA 1E9SA 4AC9A 3E5HA 3GEHA 1Z06A 4JS0A 1F48A 1YR7A 2XJ9A 4US2R 2JLZA 1D6JA 4O2LA 2N46A 4NCHA 3CRRA 1R8SA 1W0JD 4HLUA 1DOAA 4MQBA 1E9AA 3GFPA 3N70A 1W46A 3OIWA 4WOPA 1MT0A 2A5YB 1T3SA 1KI4A 1OFTA 2ZRLA 3AVQA 3LLMA 4QC2A 3PV0A 3FHTA 5D3QA 3KJHA 4N0EA 2BHRA 1UEIA 5EJEA 4QBHA 4B3BA 3TMKA 1Z63A 5LBIA 4KFRA 3MSXA 4A1FA 2ORWA 2GDJA 4LX0A 2YINC 1BKDR 1FMJA 2CHQA 3C8UA 3FWYA 4BFVA 1FTSA 3AUXA 3ZZ0A 4YQFA 1GL6A 4K81B 1HE1C 2XGJA 3LY5A 4M9XA 1EFTA 1W0JA 2OM2A 3HJNA 1IY2A 1ZUNB 1W4RA 4NYJQ 3ZDQA 1GG2A 1G41A 1E2JA 1QHYA 5C4MA 4UNSA 1NVVQ 4D26A 1KI9A 2G83A 2CHVA 3U3KA 1KI8A 1YRBA 4WAUA 2V54A 4Q9JA 1NVXQ 1W44A 1Q1ZA 3U60B 4ZI2A 2FV8A 4GZMA 1GITA 2HLDD 1MR3F 3E1SA 3RC3A 3FTQA 2H5EA 4MKIA 3ZS8A 2FSGA 1R0ZA 3BH0A 2AK2A 2VL7A 2W2TA 1KO4A 4OQNA 3AVVA 3A37A 4RD6A 4CVNA 3U6BA 4MGIR 2NO0A 2OSBA 2LKCA 4DDVA 4OKSA 3CNOA 5JECA 2QUZA 5CITA 1PJRA 1RRPA 4CGZA 5J4LA 3VFDA 4JZKA 2B21A 1SVIA 4AG6A 3K0AB 2HLDA 2P6RA 1XD8A 4PQFA 3QJYA 4Q21A 721PA 1GRRA 5J4HA 2ZI9A 4A0HA 3I32A 1DVRA 4JBWA 2GA8A 1W36C 1XNJA 3I3SR 2W83A 4G5QA 4FMCF 4Q7JB 4M9QA 1KJZA 4Q9KA 5TV2A 3RS5A 1RJ9A 3DOFA 1J7KA 5EXSA 2GCOB 1VIYA 4OHXA 3C7KA 2V1UA 4IOKA 1F2UB 4FW9A 2JDID 1CRQA 1KSJA 2W6JD 4FCWA
chains in the Genus database with same CATH superfamily
1R2QA 2AK3A 4XASA 2GBPA 1OA0A 3OPXA 3E0XA 1FRFS 3DEZA 4RH3A 4W9NA 3EHDA 4ENQA 5CBPA 4Q7MB 4O2BF 1HR0B 3UGJA 4JYBA 4CF6A 3K0AA 1CW2B 4P3OA 3NNNA 1WUKS 1FFSA 4UEQA 3ZLTA 3ZZ1A 3TRFA 4BMVA 2AFHB 2HI0A 3DHWC 3GFVA 5KDOA 1E3TA 3BL5A 2VJKA 1PL6A 2DVMA 3CY6A 3L6OO 4GXRA 4JT2A 3B9PA 3LHSA 4AF8A 3QYAA 3W5HA 3ZKWB 3U7IA 4HQ0A 1OPXA 1WIWA 3FCOA 2UUCB 3OQHA 3Q3JB 8ATCA 1IHUA 1JHXA 4L07A 3T7EA 5GJBA 2O4CA 4LY3A 1YZUA 2C5AA 3OZSA 4OM7A 2JDIA 4OJQA 1P1HA 5IJ0B 1P73A 1S6YA 1E59A 1OVGA 1OVMA 2X0FA 2HY7A 1ZRHA 2G28A 2W4MA 1BDIA 9GPBA 4M6WA 2VC2B 2E2WA 3GW8A 3HYSA 1TX4B 3QWAA 4U2KA 5BW6B 4IS2A 4QGAA 4UTPA 2AJDA 4KN9S 4M8SA 1GYRA 1O8CA 1QIIA 2FX3A 3WJ2A 3AJDA 1SK9A 1ONSA 2HQRA 3DZCA 1VSVA 1LRJA 3IXLA 2HJSA 3NV7A 4H16A 4RVSA 4RHFA 1DKNA 2WVHA 3B1WA 3HRHA 4QRHA 3KKNA 1M7GA 3VKWA 1DWUA 9ATCA 3PKJA 3HVIA 5DHTA 1DC4A 4KX5A 3NV9A 4RSHA 3S4YA 4ZO4A 2RD2A 2J9GA 3KOXA 5J63A 3E35A 1QGUA 3IRVA 1LJ8A 1O5OA 2QNBA 1FU4A 3INYA 4DWVA 1TW2A 1T3HA 1YVEI 4FUQA 3I9NA 4TYMA 4DSOA 4I6JA 5U4QA 2ZRKA 2P9QA 1ZBQA 3GHYA 4PGGA 3CUUA 1VL0A 4KWIA 3ELBA 4MW0A 3T1YB 1RXVA 3LBNA 4U7PB 4MKZA 1FCJA 3CE6A 4YJGA 4D4LA 5T7BA 1B6GA 3RS0A 5BVGB 3VKHA 1F60A 1QQ6A 1INLA 1WQ3A 1O96A 4V3BA 2IYVA 4N39A 1P4SA 4LDNA 4EMTA 1MJNA 1L4MA 4BFUA 1HEIA 1X15A 2UUOA 5HTKA 3RU7A 3WTCA 3ZHUA 2VQ3A 3ABOB 3L43A 3R0IA 2A5DA 4OCZA 2QYTA 3KX2A 2YBEA 1MVNA 1VFPA 3BXEA 5FNVF 3TMYA 2R87A 2VXYA 3BD9A 3VH3A 1Z4JA 1VSTA 2EP8A 5DV9A 3UXYA 2PX8A 5CGQB 1UDWA 1KI7A 3UOWA 3U4DA 4DLNA 1BDMA 2YDYA 2DHEA 5LCXA 3PYMA 2R66A 2Y1EA 4XIYA 4YRFA 4CMAA 3U7HB 2ZBPA 3NT4A 1TAQA 4JWKA 4YUWA 1EYZA 1IK6A 4OK6A 3JQFC 1J0BA 4YRQA 3G0HA 1UZLA 1AM4D 1Z47A 2DUMA 4H1VA 3TDNA 3TFOA 2PWYA 2IIBA 1S8OA 4XPZA 5MN5A 3I23A 1ZMTA 3SD7A 2QMYA 3VUFA 2F4NA 2ZVDA 4FFBB 2JFGA 3VZSA 1KK3A 4S05A 4PQYA 3M9WA 3QI2A 3UK2A 2DLCX 1XZJA 2IL1A 2RAUA 4IG4A 5T8KA 2XQIA 4XB1A 4N40A 2AR9A 5CLHA 2P65A 2RGEA 2ZRBA 3ON5A 4MW9A 3SMVA 3UV3A 1F0NA 3H9GA 4S2UA 1JXMA 4JXKA 3L8HA 4JLBA 2B8TA 5F9HA 4IZ6A 4RTPA 4RA6B 3GPCA 2IK8A 4CMCA 2OGUA 3QA3E 4QWWA 3LBFA 3CX8A 2LW7A 2CXRA 4NENA 4AJ1A 1R4MB 1B6RA 3GV0A 3I3OA 1DIHA 5DX8A 5AI8A 3SOPA 3V33A 4A2QA 4DABA 5J43A 5L6MB 3RTCA 4QE3A 1II0A 2IPXA 1W25A 2WUEA 1L8OA 3ZG6A 1NYLA 4B8ZA 1O0SA 4UZFA 2WRZA 1C3XA 2F67A 1RYMA 4BVKA 1E60A 4WRRA 1G4AE 2PLNA 3MWEB 3H5RA 4Q48A 4DVGA 4DTIA 2YVUA 2I54A 2QRJA 1LRKA 3PF8A 2NU9B 3ISTA 5CLIA 3GDFA 3AQ4A 4AXBA 4N48A 4V2UA 4RKEA 4DA4A 4D97A 3P2EA 2QLMA 3PQEA 3VVBA 4GX0A 2DPLA 1SUEA 1E7SA 1AK1A 3BE4A 2AG1A 2QP3A 3WIUA 1E77A 1CP2A 1PGJA 2VZEA 1RYYA 3I73A 1JWBB 3UT5A 3GLIA 1YVPA 4GGMX 2X23A 3NOVA 1QIEA 2IEDA 4Y9RA 1HDYA 5AOAA 3D0QA 4KSBA 1ZRMA 4L0MA 4Y0VA 1U2RA 3DMRA 4YJHA 5CIYA 1N8TA 2O2IA 4GPIB 2G9NA 1JG2A 3H1PA 4Y9UA 5FT9A 4EG0A 1QZXA 1UBEA 4LZZA 5DHQA 4QAQA 4O4LF 3D6VA 4MLCA 4G1BA 5LNK1 2B1QA 4PS0A 1P4HA 3TEMA 1GGMA 1YKFA 2IUYA 4JUIA 621PA 1PDOA 3TIGA 5CPFA 1KDYA 4D6PA 3EA5A 3ETLA 3EC2A 3JD3A 4IMJB 4CMJA 3TGPA 2IEIA 5C9ZA 2QLLA 5EIEA 2CLCX 1UCFA 4GHWA 4WBNA 1ADBA 2RHGB 4IQFA 2ZQYA 1RBZA 2R8XA 1C1DA 2V7TA 2D54A 1UQTA 3DTVB 3NIDB 1X1SA 3EULA 4KP7A 4R1MA 3E2IA 3DTYA 4MQ6A 4BVAA 2Q6IA 2ES4A 4QQNA 4RJ2A 3UUFA 3GZTB 1LS1A 1ZU5A 4BE9A 1RTTA 3LYHA 1JDTA 9LDBA 1JDBB 1KETA 4TS1A 3QF4A 3RAFC 1XDGA 4QPJC 3DGFC 5KQLA 2C8JA 2XGSA 1Z2DA 3PUVA 3F3MA 1H2XA 3TW0A 1IG3A 1FQKA 1GN9A 1I51A 5K8UA 2PUFA 5BSMA 1WP9A 1U0NA 2DKOA 2NQTA 3D8TA 1VKHA 5H70A 5HQJA 3VH1A 3I1YA 4CR7A 5ICMA 4AWBA 4IUYA 1PZFA 2Q5OA 3A6PC 1UEXC 4UATA 1LK5A 1D6SA 1M5TA 2EKPA 3ROFA 1NMZA 3EDYA 3V1TC 4QX6A 3T41A 4G41A 2PKQP 3GA0A 4GW3A 3SJZA 3GK3A 4IDDA 8ADHA 4PNEA 3GWGA 2RK6A 2VJYA 3GAFA 1O95D 3LP5A 3ONEA 4JI0B 5DTQA 4Z1MD 1G17A 1ORVA 1KK2A 2A0KA 2ODNA 2EKQA 4HQFA 1KK1A 4KI7A 4RACA 1I01A 2IYRA 2MTBA 1N3IA 1E64A 1HG0A 1VGRA 2J33A 3TVYA 1NFFA 1J99A 2I7CA 1IWPB 1ZGJA 2GZAA 2VDNB 1EWTA 4L9SA 5PGMA 4ZHQF 3R8CA 2QD1A 3M70A 3RGWS 2A1UA 3PHHA 5C4GB 2DBZA 4ZK2A 1U94A 1UWVA 2GYUA 2NUPA 2VPPA 3KUKA 2BW0A 2OTCA 2ZYHA 4B6EA 5A6SA 2WA1A 2QJOA 1KP9A 1O95A 4YAGA 3MOGA 1YJAA 1AS2A 2OORA 2SECE 3IPAA 4Z1MA 5A2QA 2FUG6 4JJEA 3W7AA 1A2KC 3VQTA 1GGFA 2QJWA 3FPLA 3ZK9A 1RCTE 2PANA 3C41J 3T5DA 4EDFA 2IDKA 4HYTA 3TKAA 4XFDA 1T5BA 4PANA 2BRUC 4WLEA 4QFMA 1MUUA 2BFDA 4CYMA 3GJXC 1DXYA 2NTVA 5CA1B 2W42A 3RYHB 3UN1A 2QAGC 1F12A 1XPUA 1JAZA 1QKKA 2TMYA 4G89A 3WL8A 3COVA 5IYZA 4ODIA 3KLNA 2ZI3A 3WYFA 1TTTA 3AF1A 4R41A 4JMLA 2HA7A 4XQ9A 3ND5A 2AI2A 3E7PA 4ER6A 1NW8A 2DT8A 2R6R1 1NQUA 3CHYA 5I8ZA 4CM9D 3S2ZA 4EA6A 1N8KA 5CR9A 2P62A 3RSOA 4DBLE 1JEOA 1Y3IA 3CZRA 3UHOA 3E03A 3EZLA 5JH7B 2ZR8A 5HF6A 1N3BA 1GUFA 3ZWOA 1RYHA 3K70C 3I62A 1T25A 3RHZA 3ZXIA 5MFPA 4Q01A 2XUJA 5JUWA 2NV2B 3GJZA 1G0NA 3G6WA 5EJIA 3F3YA 2H4XA 1I80A 1UKCA 1K8QA 3OPYB 1CS0A 2C94A 1JB9A 4DLYA 2ECFA 2BYTA 2QJTA 1BX1A 1O5TA 3CX3A 4XSVA 4I55B 4CUJA 3BFJA 3N0TA 1KWGA 1FFXB 4CM9A 1YUNA 3R0XA 4P33A 1NVEA 4ZOCA 4XJVA 5LB2A 3U3JA 3ZDRA 3BKWA 1QC5A 3DKVA 4F2PA 4N9QA 1KI2A 4AS2A 1FFGA 1ISPA 2A9QA 4QHSA 4OFXA 1WB5A 1XLUA 3HU2A 1AQLA 4XYMA 4ZICA 4CG2A 1B1CA 2Z4RA 3Q5PA 4YB8A 1THTA 4KV7A 1DJNA 1SIUA 3IB6A 3WKEA 1TU4A 1TIKA 2WKRA 3DNFA 2HW8A 3PLNA 1QIGA 5EMHA 1E0JA 2ZJ1A 1DAHA 1PEYA 4DEXA 1AKMA 4WKCA 1W36D 4A0SA 1U3CA 2O8DB 2ZS9A 5EZYF 3JAKA 4Z53A 3PDIB 4JWTA 5L3SA 2WIBA 3W6UA 2YV1A 3R0ZA 1BXZA 3EJWA 3L6DA 2DLDA 3ZGXA 2WFAA 1ATZA 1NUTA 2YXDA 2I3AA 5EJ7A 4C5CA 1JU3A 4FBGA 3K92A 5E0OA 2JAXA 3F6YA 4PYLA 2CCKA 2XWSA 4UHFA 4NBLA 3OPNA 3KDSE 3PLRA 4N5MA 3RSCA 3CE9A 5MGNA 2I2AA 4Z3OA 3X1ZA 3WAKA 1VB5A 2W7TA 1GZHB 1MP0A 1A5TA 1D2HA 4R51A 4X93A 5LZ5A 1R74A 3H0CA 1M7HA 4FJ1A 5FBQB 3SM9A 1J0XO 1FU7A 4UU0A 3OQVA 1I30A 2WHPB 4BP3A 3SZLA 2HFJA 2I03A 2ZI7A 3B1KA 5IDWA 4D44A 1ZKMA 1DTWB 3ZY6A 4K2HA 4RDXA 4S12A 4YFYA 1ZLXA 3PRKE 4I50B 1WZUA 2ZWAA 4EUKA 3ORFA 2QS9A 1I2AA 4OGWA 4EGQA 4F6CA 3GJ8A 4YFVA 2JGIA 4RV5A 4UULA 3WGQA 4KQWA 1T8PA 3FF1A 3DE3X 3BFKA 4OH1A 2HQOA 3NPMA 2ZIAA 1X39A 3PS9A 3ZDCA 4M0FA 4N12A 5EJ8A 1SNYA 2XRFA 3EAGA 1T4BA 3F7MA 3QRWA 5GTDA 2O8CB 5CFZA 1QS0B 3IP6A 3MWGA 3OOJA 5KTOA 4C0AC 4TKZA 3JRWA 2G6BA 4S24A 1UMBB 1FJGB 4LNHA 4N65A 4C87A 5A9RA 2BGRA 2POCA 2P7IA 2V9PA 2G07A 1GPUA 5K20A 2XODA 1I3MA 3OOHA 1JZSA 3P2MA 3UB2A 3AH8A 2WHXA 2PKQO 4UM9B 1I3NA 1KMHB 2XRYA 2QN6A 3R9XB 5LA6B 3VO8A 3NIFB 4KOAA 3UHFA 3K0CC 2HDNB 4B40A 3HUDA 1W47A 4PLWA 5K3FA 1NF2A 3FOEC 4HHEA 3WL3A 4RHYA 1LKZA 4HQRA 3N2LA 4UVDA 2F90A 1PX0A 5B57C 2Y6UA 2YRXA 3TS1A 3DSRA 1QQAA 2Z08A 1H9BA 2ORIA 1DG9A 1U6KA 3DB1A 1Q1NA 3SX2A 4EMSA 1YXMA 2QZ4A 2AWNA 2AFIA 3O31A 3WFIA 3R6TA 5GWXA 1U3DA 3EZYA 4U7JA 3IP8A 4DIUA 4W82A 3UT0A 3M4XA 5KVQA 4JQOA 2W8BA 1ZISA 1E1RD 4CE6A 3UF0A 1EGVB 2XZTA 1V25A 4QARA 5B5SA 3H6KA 2Q6VA 1IH8A 3AHDA 3BMNA 3LKBA 3LSYA 3E5RA 1QP7A 3A4TA 4JUCA 1LNZA 2OGWA 3SHTA 3CZPA 1KTIA 1UQUA 1JKMA 3H8WA 5MF6A 3NBKA 5FWYA 3B8HA 1GPWB 1NLUA 3GJYA 2C9ZA 6NULA 5GIOE 1X1AA 3MK31 4M98A 3BSSA 3SJUA 3MUEA 2WWVD 2IHZA 2J09A 2XADA 2Z3ZA 2H6EA 4JBYA 3M3DA 5AVRA 3VGPA 4C4ZA 2PQMA 3CEHA 2F8TA 4IJUA 2A9OA 1ISHA 1JILA 2BMJA 2ARKA 2Q50A 3CO5A 1OF1A 1SUPA 3OLZA 1EJ2A 4HZUB 1P5JA 1E1RA 1QE3A 4EGAA 1AQUA 2G80A 2VQ6A 2R1TA 2JJYA 1HNZB 3FFBA 4DAOA 3G7UA 3KUUA 4KH0A 2IWHA 5BQXA 1U0TA 1J0AA 4IFTA 3V4SA 5LMCA 5B30A 1NE7A 4CN9A 1PJSA 1CRZA 2FA9A 3BFVA 4ZJPA 5C80A 1K2WA 2ID4A 3HJFA 1PG5A 3ZWKA 1GQ2A 1H0SA 5D3MB 1EXWA 4TUYB 3JYNA 4MO9A 3GLFE 1Y5NA 3AR7A 1DUIA 4GMGA 4E94A 1QANA 3H8SA 1G63A 1W8IA 3OX3A 3N58A 3SBEA 3ZNQA 5JC1A 1RXEA 2NXWA 3VVLA 1ZR4A 2UUBB 1SFRA 1KI6B 3FFXA 4D9HA 1WA5A 3TIIA 4DZTA 2FVYA 3H1FA 2GXQA 3MS2A 3SNHA 3C3JA 2FW1A 4CF5A 2Q2OA 3M34A 3GHHA 4IO1A 3HB1A 4NOLA 4RZ3A 2ZI4A 1XGKA 2ERYA 1Z34A 1Q07A 3A9SA 1HXHA 2W37A 3NM5A 4XR9A 5BN5B 2V6JA 3BJMA 3V4PB 3AETB 5LD2C 3RIXA 4IYJA 4IDHA 5I5EA 1SAYA 1JBKA 4FQ5A 1YDMA 2YIMA 3KB2A 1JFSA 5BP7A 4UMEA 3OQPA 2WUDA 2DP4E 1G55A 2Q5HA 5AXCA 3AILA 1MJFA 1NRIA 4M0CA 4X44A 3S8EA 4O4LA 2ZBVA 2BTEA 2W2XA 1C3JA 1YL6A 1L4NA 2AE1A 1U3TA 2UZIR 1RTKA 2CXXA 5BYJA 4AKIA 3V4OA 3PRYA 2PGDA 1ZZGA 1MXHA 3MWFA 2IYWA 2QORA 2D2VA 3NH6A 1UAYA 1E9FA 5DU2A 5KYVA 5JNLA 2PJRA 2JHFA 1GGNA 4IO0A 5IT0A 3GLGB 3SMQA 1OROA 1CNEA 3BEOA 2GJKA 2J48A 2XHZA 1IN6A 4D46A 4HQOA 4AMVA 5CFPA 1CDZA 1OLOA 2EX1A 1R6AA 2UYGA 3LHKA 4PXSA 4IIXA 1L1FA 4HRXA 1L7MA 1SVUA 2WU1A 4R81A 1JG4A 1QHSA 4JGIA 3LPLA 4F9FA 3Q9UA 4A0QA 1MZVA 1GUBA 3GLUA 4X66B 2HD4A 5FH9A 4CLXA 1KDPA 1SKBA 5INTA 2Z95A 2FPXA 5JS6A 3LQKA 4K2AA 3RVOA 4FQ8A 1UC8A 3N8HA 3NOQA 1CRWG 2CKDA 1PZGA 2GAJA 1RRGA 1Z4OA 3R3JA 3OESA 4MLZA 4NEGA 5DEIA 2GFIA 4QGSA 2GEKA 2Z09A 4IIFA 1NW7A 4ZP1A 1ECPA 1DQRA 1XO1A 3KM0A 3A10A 4Z86A 3DE6X 4PPQA 4TS9A 3RC2A 1E89A 3ZN2A 1V7ZA 4UDNA 1XWIA 4BFWA 5K3BA 3VRHA 4MITA 1NQ5A 1N2IA 3BWVA 3HKCB 1C3VA 1Z2AA 2CZGA 3GU3A 3B5JA 4DM4A 1TM7E 4CT0A 3I2GA 1ORWA 2ZROA 2GESA 1ENOA 3LY7A 4TXJA 2VXOA 2AXPA 4LEIA 4OI0A 4AQYB 4PTYA 1DT3A 5JI3E 4WKOA 1F8FA 2O2GA 3KYCA 4G9EA 4GP9A 4URYR 1X9HA 3L8YA 4WK4B 4XD7D 5ECGC 1G16A 2AI3A 2GSDA 4TQGA 1EKXA 2MYPA 4BIMA 1BXGB 4EY4A 4LRTB 2DYKA 4BQQA 4ARVA 2JL1A 1L7XA 3RFCA 1PJ4A 1GSIA 3C3DA 2PY6A 4B4OA 1OV4A 1WF3A 1IULA 1NQWA 1CB0A 1LLQA 3C24A 3FBTA 4Q1DA 1Q3TA 1SBQA 1IQUA 4O5AA 1EHYA 3NHSA 3MJHA 1KQ3A 3HBNA 4P8RA 1KYTA 2NYUA 3I0NA 4CKBB 5CFLA 3ECAA 3F47A 4DSTA 1OPRA 2B5OA 1SZPA 1JBQA 1ZK3A 1YB1A 1EFVA 4N5HX 4NXNB 1R6XA 4RLSA 2O9JA 2QX8A 1CZRA 3N0XA 4G8CA 5C31A 2OZLA 3GLTA 2FLWA 2W2MA 4XD7A 3WXMA 1VYHA 2ZBRA 1JVBA 3FDFA 4U0JA 4ZFNA 2CFCA 4KJZA 4Y8VA 3JAWA 3R40A 5IBRA 1A76A 2D4HA 3W8DA 1ID1A 1HMYA 3F4KA 2G3YA 4MIYA 1FS6A 1YO6A 1F0YA 3FPSA 4EAAA 1QTIA 3ZZTA 2GS9A 3DZGA 3FCAA 2CB9A 2NUTA 3V6MA 4C0JA 1MB3A 5CA1F 1UPFA 3A4MA 5DZSA 5C53B 4YJ3B 1O4WA 2CL5A 1ETHA 1PS9A 2WAOA 3DBLA 1GYPA 3ER6A 4BXOA 1QF9A 1D2NA 1T43A 5EAIA 1K3UB 1KBQA 4LSGA 4AKEA 1E4VA 1HNWB 2BFWA 5H81A 1Z4PX 5A5DA 4JJ8A 3CUSA 1LSUA 1Q08A 2YJGA 1I6MA 1NUSA 2G36A 1DCMA 3KB6A 4BRSA 3SBOA 2QN9A 2FETA 3OCZA 4TL9A 3ZI7A 3EWAA 4F0JA 3CR7A 3AERB 1IJKA 1UMCA 2ONZA 2QTZA 4P53A 3B3QA 2GBLC 1WEHA 3HEBA 4HPWA 4E31A 4CKEB 3VJRA 1CY6A 2A94A 1EINA 4JD5A 3EUWA 4N7JA 4FYIA 3VX4A 1CUVA 2XVAA 3QKRB 3O2JA 3B53X 4Z5XA 5AM0A 1UK6A 4FYJA 5CB8A 1PJBA 4XX0B 2QTVA 1NR7A 4OY3A 3MPUA 1Y63A 3IBYA 3HCNA 2R2AA 4DB4A 3ZY4A 4WKBA 1XMJA 1XZQA 2NTEA 4MR8A 5LIPA 1VLMA 5EMKA 1RABA 3I4FA 1XN1A 3MWYW 1NYTA 3D59A 3C6KA 4V24A 5HBRA 1K75A 1JV2B 2P41A 3DV0B 3HCAA 5CX1A 3V2GA 1PI3A 3D2CA 4I55F 2QRPA 4GNKA 4RADA 4B3IA 3T9BA 1M5UA 2E3JA 2REXB 1TI7A 4ZEWA 2ZUTA 1E2PA 3TNDA 1QLHA 1Q95A 4TTAA 3UKOA 1AK9A 2Q27A 2XOEA 3CCCA 4O4IA 2IDJA 1NDUA 4NL4H 3T34A 3NAMA 5GGYA 1OAAA 4OL0A 3KQVA 5DKFA 1G3QA 1SPXA 4DYHA 2ZM6B 3NFRA 2P67A 221PA 2ONJA 1XLWA 2R1VB 4WNCA 2AMVA 1EMDA 3ASVA 3BTSA 1NPTO 1PT9A 3AGPA 3QITA 4OF4A 3FOZA 4RESA 1EWVA 4RH1A 5K7SA 2GHQA 4H0FA 2FPOA 3ROZA 3NRBA 3MLEA 4CRWB 4TKUA 4L73A 4CIDA 2AD1A 3JRNA 4R9UC 1XL1A 5ICEA 3ER9A 5JAIA 2VHQA 3WC4A 4B9AA 4J3FA 3DXZA 1RIIA 1NYRA 3CNQS 4C0XA 2FSVA 1ZN7A 1E4EA 2Q5QA 1IPEA 1TVEA 4I81A 3WL4A 1DJMA 3ZKWA 4ZU1X 2JFXA 1ONPA 3MZ0A 4YH1A 4YECA 4TYYA 1FP4B 2ZB8A 2Q5IA 4CDNA 5HQ3A 1FVOA 2OE2A 4Q03A 3ONVA 3IBGA 4HJXA 4NQZA 4TMTA 4C88A 1HE8B 4TLBA 3UH1A 2SKCA 2WB2A 4Z7QB 1OWOA 4ZT5A 3EE6A 1D9XA 3TTVA 2E85A 2ZIEA 1KDRA 2PT6A 1K2VN 4FBMA 4BZZA 4DUGD 5MN4A 3LIPA 4RGVA 4QT0A 3LRPA 3MMSA 3LDAA 3T7DA 3IQDB 5A3VA 2C2BA 4I50F 4DIEA 2AG5A 3L07A 3OCJA 5KCZA 3ISVA 4EHJA 1L4BA 1NR1A 4DCSA 3F71A 4MZDA 1OREA 1NN5A 1ULSA 3HGMA 3L0SA 5CPBA 2NZWA 3TE6A 1T2UA 4A1OA 2AJ8A 2QJFA 5BVHB 1D8TA 2XDQA 3BGIA 4Q00A 2Y27A 1ESMA 1T9GS 3SF8A 3T1VA 3UWMA 1N2OA 1NQXA 4JQCA 5JLJA 3BK1A 3K9BA 4US0R 4YRJA 1G2PA 1ADFA 4FGKA 1I2BA 2ZBQA 4X84A 2NYAA 4FYVA 3HLYA 2FPUA 4DUGA 1KVSA 4O4HA 3OFSA 3VI3B 1VP3A 1YTUA 1ORIA 4OHPA 3BHMA 4KO3S 1FTYA 2Q3LA 3MTJA 3JARB 1XEFA 4JQYA 5LA6F 1S0UA 2B82A 2RHDA 3D6TB 3RYIA 1TT5B 2XVYA 1VHDA 1XCMA 2EQBA 3CKMA 3EMKA 5D85A 5ELMA 5FIUA 1EE2A 3TX2A 3B8EA 5C0OE 4Z7OB 2NXCA 3EHEA 1TECE 2AQHA 7REQB 3QLJA 4MMXB 2HDOA 2IYFA 3OU6A 1TVKB 4XIGS 3ZIUA 3VYWA 5BWBA 3MQ4A 3FOWA 5F12A 5BORA 2PV0A 5GJWC 4Z4QA 3ZU5A 2IT1A 3UCFA 2BSXA 2XUOA 3KKKA 4LJ4A 3C8DA 1BE1A 2CNWD 2VP2A 4KL8S 1N1GA 1D04A 3D6AA 3QJ5A 1QZUA 2PR7A 3FPHA 3UIEA 3ZY5A 1SBZA 5GY7A 1WOMA 1L9KA 3EEIA 3VNAA 3FFTA 2ZSIA 2J9YB 2F55A 2DLNA 3W5CA 3P9XA 1SUSA 3ZCXA 4BEBA 5IBQA 4Y9DA 2AZMA 4AZ0A 4ZTUB 4DC9A 4Q9AA 2NAFA 1YI0A 2L82A 2VDJA 3E2MA 1NJ6A 5ESRA 3HSKA 1XXHA 2FFHA 3UMGA 3R8XA 5C35A 2P68A 1FYFA 3K8YA 2H18A 4LBWA 2Y76A 4MJXA 4WLSA 1RMTA 2AEJA 4RSRA 4ZPXA 1Z0DA 2BGLA 2GZMA 2HZ7A 3GRPA 2XTZA 3JQQA 1O97D 1VCOA 1DE0A 2CNWA 4JJGA 5CX4A 1PD1A 3FI9A 3O3NB 3OO1A 4UCQA 4FJ2A 5KTPA 1VKRA 2QDKA 4NS4A 1G6OA 1KARA 1WPGA 3ORHA 2OXCA 2AHRA 3GUVA 3NKVA 4DARA 3PFGA 4Q4AA 3HJRA 3TDMA 2XV1A 2YXBA 4FS3A 1Z35A 1TD9A 3KEFA 2BBWA 2K87A 3Q11A 1QYCA 3D31A 1R88A 2VP9A 4FONA 1L7RA 4Y1FA 3ZBPA 4EO4A 3RVRA 1ONOA 3EEQA 2B7LA 1T9AA 3R24A 2XR1A 5FX2A 4EDHA 5CFOA 3HA3A 1GUDA 4TUYF 4ZQFA 4BVGA 2JLVA 3N2KB 2PX0A 2NU9A 4QJ5A 4DDKA 4S1VA 1AO0A 1OA1A 1SXJD 1HE5A 4C9BA 4Q1BA 1NL3A 1YBAA 3AEKB 4B4VA 3ENWA 1UJNA 1V9SA 4DRXB 3GGCA 1OFHA 4YONB 3R7SA 1H3NA 1PFWA 1PKXA 3WSVA 2NQ8A 3EODA 1SCKA 3ETEA 1JQAA 3G2NA 2IYUA 1SXHA 1SHKA 2GCNA 1CEXA 4DIKA 3V7YA 4YP5A 2NN3C 3QJGA 5K45A 3RSFA 4DBLC 1PNOA 4RXTA 1G18A 2QYOA 4KG7A 3AVYA 2XWBF 1P0QA 4GOMD 3EH1A 1Y3HA 2MYUA 4R1TA 3VKVA 1U0FA 4RL6A 1CF4A 2FSIA 2IP1A 4DGSA 3L40A 5IMBA 2PX5A 4N1AA 4RPKA 3KQYA 3ROKA 3EGDB 3OA0A 4P3YA 1SXJA 1XCJA 2BKEA 1BE0A 5IAKA 3OUTA 2PM8A 4QJ4A 2QSUA 1UJCA 3OC6A 4DY6A 3BJZA 3WLNA 1KXZA 2Z2ZA 2R5WA 4RTLA 4WV3A 5HS6A 1C9DB 1Z4NA 2NV6A 3TRJA 4YCCA 4C4SA 5CDTA 2GRAA 3EC7A 4QLAA 4A8PA 2JVJA 3HGTA 3H86A 3M4YA 4H27A 3W4JA 3KSBC 4LDRA 3BXOA 4RCYA 2FPKA 1A9PA 1IVNA 2PL9A 1OT3A 3H75A 4U63A 3VSAA 2Q07A 5AFSA 1E1MA 1ADYA 5BW4A 2PGNA 3CSDA 1WLSA 1E3MA 1SB9A 1HORA 3KB1A 1J06A 3A14A 2FWNA 3BGVA 4D41A 4ZOQI 3AVPA 2QRNA 3OU7A 1WY5A 3OIYA 4R01A 4S1NA 3ILYA 4F56A 3CG4A 3DVAA 2AVNA 3KYBA 1GEEA 1B8UA 2QUKA 2ZSAA 2E18A 3EXG2 4PIMA 4XWAA 3S70A 4ETIA 1DFIA 4HGYA 1FP1D 2EYUA 4QTXA 5T67A 4TMXA 4RBNA 3T7JA 1Q7GA 1TKCA 2RGUA 1KU6A 3KLBA 3ZDYB 1J33A 2KHZA 4R4JA 2H29A 2PZKA 4JUAA 2A0WA 2G82A 5DLQC 5FBZA 3TQHA 3SJBA 1BX0A 3TH5A 4ECAA 1ACJA 2IWRA 3ENQA 4IVPA 2CUZA 3T12A 2ZP1A 1JJ7A 4DNOA 5K99A 4WVFA 4C5BA 2AKEA 1RXWA 4I4NA 5H80A 3AR3A 1Y8AA 2C9BA 1GPJA 3G68A 4Y67A 2CD7A 4IWXA 1KAOA 4L4RA 3CRW1 4F7WA 4KR2A 3I58A 2IXTA 4UBJA 4RE6A 4TMFA 3O0DA 1SK8A 1Z26A 1AMUA 2CSUA 3Q8MA 3GJ0A 1JXAA 1HE4A 4LF6B 4Z7JA 1SC4A 1A7AA 4GR5A 1KO1A 1Z28A 2R96A 2NO9A 2XB6A 4M8LA 4E5SA 2Q4TA 3PR1A 2Y9MB 4A23A 1LCIA 3ZE1B 4F96A 5GADl 2OGTA 1RHKA 1EJ0A 3AB7A 1P39A 1L5LA 2XE6A 3TEJA 3M1AA 2ZRJA 3DWGA 4KTTE 4OUDB 2NVOA 3AP1A 3NOXA 3H2ZA 1IG0A 3ADKA 2FP4B 2FSUA 2W6NA 1KJWA 4K6FA 1YBVA 2J9XB 4CCWA 3H2SA 3NTUA 4CN8A 4I66A 1T34A 2UZAA 4B4DA 2XNHA 3KR0A 2XUPA 1SXPA 1D2GA 4YDRA 3REQB 3TZBA 3OSUA 1QRSA 4HO1X 3HFSA 1UOQA 2YYAA 2J31A 2C3MA 3JVUA 1LBQA 3VC3A 3QBDA 2BIFA 1DBVO 1KPGA 1VKZA 2V98A 4KQ1A 1XV5A 4HDRA 1J8FA 1PT7A 3QLVC 3TINA 3L6CA 2WQZA 1NAHA 1D0SA 1Q0ZA 3H9EO 3R0QA 2V3WA 1YD7A 2Y05A 1VJ5A 4HAYA 1E1LA 3D6JA 4K9SA 2WLSA 3OZBA 4ZYVA 1KEEB 3ZHTA 1XTPA 4RO0A 3C0KA 3FG9A 4JC8A 3SEZA 3WMFA 4LMPA 5CT8A 3LYLA 5I7UA 1SOMA 4YJ3F 3RC9A 5B58T 2JF0A 3O91A 2XKJE 4QYTA 3RRJA 4FC7A 1JHZA 3C8HA 3ECCA 3ZE0B 1N2CA 4D9GA 3ZLVA 5DMHA 4GDMA 1KJYA 4DLRA 3NTQA 5BMVA 4PAWA 1LX6A 1XCGB 5JY6A 5AYVA 4OYYA 4CQMB 1ZH4A 1E3SA 1LBIA 4EYQA 3FRIA 1TU3A 4D9EA 1TOAA 1JQ5A 4LK2A 1PNTA 3MGBA 3SYTA 4D56A 4JP1A 3ZGZA 2ZIZA 4NE2A 2X4GA 3LQYA 1GJRA 1HA3A 3KSMA 4GMHA 2PA0A 4MOWA 4Y6RA 1JECA 1PJ8A 4I55A 1FFXA 1JLHA 2IEGA 3HJUA 4CU5A 1Y5LA 1J0DA 1UIRA 1HSZA 1Z5GA 5KSPA 3ZDEA 1M34B 4G4IA 2FB9A 2L18A 1HDRA 4TLEA 1Y82A 3QE4A 4HWPA 2B9EA 2I71A 2K7FA 2J0QA 3GQVA 3D8RA 1QGOA 1UANA 4G0QA 1RMYA 1WQ4A 1DAIA 1ZMOA 1IN8A 2EZ4A 1U0RA 3PXBA 5BWLA 2DWQA 1F3LA 2NXEA 2GM3A 4LTDA 4NMLA 3LQ4A 1Z8FA 2KI5A 4IUCS 3F6RA 3ABIA 5HR5A 4YEDA 4KIWA 2TMGA 2REQB 5BN4B 1IUPA 3DR5A 4P82A 1RH6A 3IEXA 2O2DA 2VDKB 1DBQA 2CYCA 2C04A 2P2GA 1RJDA 3L79A 3FYDA 3OA2A 5FTMA 1KH1A 3EF1A 1D2EA 3TCKA 3A05A 3TUJC 1IK4A 5BT8A 1MPXA 3ZLBA 4CU2A 1BO6A 1RM4A 1TUGA 1DADA 2EFGA 4XE5A 2A67A 5AQ1A 1YB6A 2J4DA 5BW5A 3A2MA 4OG2A 1LQUA 5A5FA 4E1AA 1WW3A 2ZW9A 4R1LA 4Z4HA 2ADOA 3AI3A 5DNWA 4DQKA 3FN4A 2BM0A 3OJXA 4UM9D 5EUMA 4EPVA 1PV1A 4UNRA 1ICIA 2C9YA 2EX4A 5JWHA 4FX2A 3CPEA 4ZI7A 5F23A 2VT2A 3VR4D 4CW7A 4F21A 1GTRA 2VRWA 1NG9A 3SWWA 1D0VA 2TECE 4KH1A 5E4YA 4BX2A 2F1IA 3K09A 1JB1A 1MB9A 1UKEA 2C4UA 2BEWB 4JT4A 4YC7A 4ARBA 3SC3A 1QFXA 2O8CA 4U0KA 5JISA 2HCJB 3Q41A 1OFGA 2BR3A 1C1HA 4Q9HA 1V0JA 4OK3A 4UEKA 5FPYA 3HK2A 3WK6A 3MAGA 3P7MA 3PENA 3K0BA 1X70A 1XZFA 2UZ0A 1EDBA 4OSOA 1I5OA 2W0MA 3K9FC 2IE8A 3SHFA 3E22B 3Q7TA 4JKOA 4DHEA 1IDN1 2VWPA 1RHUA 2FCAA 3A3PA 4BV8A 1AGYA 4EL0A 5EJ2A 3PTAA 1RKVA 3KPUA 2F1JA 1WWKA 3VR4A 4HX9A 3TW8A 1YB4A 2IOFA 2VSQA 3U7JA 2QHXA 2AZXA 3DNPA 3KXDA 4IVRA 4MVYA 4CV2A 2XQVA 1T91A 4GX2A 1BOOA 1V1MA 3RBXA 4MVJF 3ZE9A 2EIXA 1KGSA 2KJQA 4XH9B 4UM8B 4MS1B 3EEFA 3FUCA 3GJ6A 5CCDA 3IV9A 1UBUS 4WY5A 3RVLA 1GNSA 1WNFA 1C9NA 3KQTA 3MMXA 4ITRC 2X4IA 4IHQA 1T5HX 2GPBA 3P9SA 1PGOA 1V11B 3OQBA 4Z0HO 3THWB 4PXYA 3OZ7A 1G21B 1QSGA 3NATA 2QY9A 4PCAA 1KQGA 3FOCA 4RDIA 1E2KA 1IRXA 1B0AA 4MV4A 3VBEA 2BR4A 4TROA 1E20A 4RSMA 2P9HA 1FFBA 1P0IA 4C7OB 2CNDA 3RIYA 4OSPA 2K4MA 1U8AA 3O8QA 5AIBA 2JI6A 2JCSA 3G89A 4C4RA 1MO5A 4PRLA 4BLUA 5J1TB 2VF2A 2YMQA 4DY4A 3JQ8B 5FJIA 2DX7A 1CVRA 1SKYB 1KK0A 2C5FA 1RYFA 2Y1CA 3DT8A 3MIZA 3IKLA 3S1SA 1GL9B 1LFAA 2DSTA 3IDSA 1K1EA 5LXTB 4YJDA 1ZGGA 3S2IA 2VDLB 4RPCA 4Z4EA 4WBXC 2DFNA 3NHPA 2NAPA 4AVYA 3PVSA 1RSZA 2M6SA 4EB3A 3NYWA 2AN3A 1M2WA 2Q0HA 1AKNA 2W22A 3GEIA 4U7WA 4N47A 2V7BA 5EMJA 3ONDA 2O2HA 4DPKA 3EIQA 3OICA 3V3KA 3KZKA 1IY1A 2QW8A 4RY2A 3VZRA 3HWRA 4QVIA 4Y6QA 3X1XA 3UWPA 1BN6A 2IV7A 3T7KA 1QIFA 4PCVA 3EQZA 3NDPA 4TUYA 1Z74A 5ALUA 2E37A 2QJRA 3BQNB 5JATA 2RJNA 4AY5A