3EZ7A

Partition protein apo form in space group i4122
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
b'SSQLHKVAQRANRMLNVLTEQVQLQKDELHANEFYQVYAKAALAKLPLLTRADVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGTPKYRDRYSEAYVIFISNLKGGVSQTTSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partition protein A
publication title Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 106
structure length 382
sequence length 395
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
A PF18607 HTH_54 ParA helix turn helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.30 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3ez7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ez7A02
5KOYA 2BBTA 5AJVB 3TMKA 4YQFA 3CF6R 3C7KA 3KTAA 3AQ4A 4JBXA 3SQWA 3BBPA 4IJMA 3B8HA 3WMEA 3MMPA 4AK9A 2R6CA 1E2HA 1L4UA 2GESA 2HF9A 4ZKDA 2VF8A 4P0TA 2EQBA 5AJZA 4ZCIA 1G7SA 4OK6A 1CRQA 2ZREA 2WBLC 5KU1A 3U7HB 1S9HA 2H18A 4IOLA 1VG8A 3NEJA 4GOJA 4A9AA 3A4MA 5FPKA 1UADA 2PH1A 4CEJB 1VG1A 4D0GA 3ASYA 2C5LA 3GJ0A 1TF7A 3MWLA 3PUYA 4V03A 4B35A 4B3FX 1TAGA 3LBIA 4IXNA 2P3SA 3MD0A 1JB1A 1PZNA 2FZ4A 2H1LA 4EDHA 1MRSA 2DCUA 4KSBA 4Q18A 2VTKA 2QRZA 1YE8A 2GJKA 4TTPA 3AVWA 1F5NA 3K0AA 1ZM2A 2F9LA 1KKLA 1J99A 4QRHA 1HQCA 1GZSA 1OHHD 2UZ3A 4C0BA 1E2EA 4TYNA 1SVMA 3AH8A 4FIDA 2GEUA 5E7JA 2RAPA 4WZ6A 4JVLA 2PEZA 1BH2A 3U44B 1W0KA 2PZGA 2OXRA 1JNYA 1YR7A 4WXPA 3MWKA 1WCV1 3TQFA 3OZXA 2D06A 5BWMA 5FTNA 4MGIR 4Q4HB 2V3CC 1SVKA 3GLHB 4QGHA 2IYWA 2IXGA 2GETA 2CCJA 4NCIA 2ZRFA 2FSGA 5H68A 2HJVA 4MRVA 2ZJ2A 1NLFA 5E3HA 1KNQA 2RGXA 1V43A 4CW7A 4TMXA 4OK5A 3BOSA 4B3GA 3QKSA 2EFEB 3U3RA 2A78A 3BB3A 5FBVB 1N2CE 3TQCA 3Q72A 1NF3A 1YR6A 2XTNA 4OKSA 3KUCA 2A5DA 4CT4B 3BGWA 4MA4A 3ZYCA 4B33A 2Q9CA 1G18A 1CEEA 1XTQA 1JQJC 1E9EA 3SOPA 3BD9A 1DBSA 1F2UA 3R20A 4BLSA 2AK3A 4M1MA 4BRWA 3QXCA 2G3YA 2R65A 4I4LA 1ANKA 2ZSFA 3BORA 2XNSA 3P20A 5EJEA 4RD6A 2KWIA 3GPLA 1QDEA 721PA 5TY0A 2FWRA 2CL0X 2CJWA 1E4VA 2QE7A 4B32A 1NSTA 2QI9C 2G0NA 1IN7A 1G8YA 2OILA 4IDQA 4C9BA 1DE0A 3BFVA 3DOEA 3PIRA 1E2GA 1TNDA 1WMSA 3PQCA 4JL6A 2PX0A 2V6IA 2ONJA 3SYNA 1T3HA 4BZXA 2X8AA 3UG6A 4X8OA 1SULA 4URXR 4Q4LA 3KKQA 2BBWA 4KYUA 4DJTA 2OFOA 4HZIA 1CR2A 2QTVB 1TQDA 3PEUA 2AWNA 2PLRA 2V8OA 2G6BA 1GNRA 5DHAA 3U5ZB 2MMCA 4RD2A 1AKYA 2QT1A 3LXRA 4UNRA 3CH5A 1P5ZB 1DAKA 3GJXC 3TUIC 2FU5C 1G6HA 2BBSA 4UXIA 2WJVA 1EFUA 1NIJA 1X86B 5ELXA 2CDNA 3OESA 5C2JB 4Q1AA 3DO6A 4JJKA 5JCPA 3PENA 5AJWA 3CWZA 4QGFA 2A7QA 5G3YA 3AVPA 5HE8A 2OCBA 1GNPA 1RIFA 1LTQA 4ESHA 2UZIR 2FOLA 2RGNA 4V02A 2IW3A 2ZYUX 1J8MF 1KI6A 3Q85A 1B0UA 4MRPA 3EPLA 1QHYA 4LYFA 4ZIRA 4LHXA 2B8WA 1JBKA 2VRWA 4PAMA 3VMFA 3RS0A 3VNUA 2QSYA 1UKYA 2AXPA 4XD7A 3CONA 4NDZA 3RS7A 4LPKA 1E3MA 1Q0UA 5JI3E 2F6RA 1XTRA 4QHYA 4FMDB 1IAQA 1KI8A 2KSQA 4XWAA 3AF3A 1DAFA 2J0UB 4DBLC 1VCMA 1WBDA 4I1SA 2JJ1D 2FNAA 4ZDJA 1P61B 2QPAA 1W4BA 4MYHA 4DDWA 4Q4JB 1CS4C 3I32A 3UATA 1ONBA 4UJ5A 4UNSA 4NCJA 3LBHA 1CJTC 1P2TA 2P5SA 4NU0A 5A0FA 1CIPA 2WJJA 2R2AA 1AS3A 2QP4A 4IDHA 1X1SA 5FBWB 3LO5A 2O8FA 3MUFA 4YMVA 3PVSA 4FW9A 2DR3A 2IBMA 2ORWA 4B47A 4MDFA 2Q3MA 2PT7A 4GSYA 2OCAA 4DRZA 1YKSA 2ZETA 1DEKA 4B76A 3GLIA 2G0TA 1S9DA 2GTPA 3HYTA 2V54A 2J1LA 1OV4A 3AEZA 3DL0A 4DCVA 3RRMA 3ZDQA 4D80A 2D62A 4PHFA 3AKCA 1CP2A 4WW0A 1Z2AA 4NL4H 3VTKA 2VSFA 3GCGA 4BLQA 5HKKD 4R2HA 4JBWA 2QU8A 4KU4A 3KKMA 1OSNA 1WP9A 2P2LA 3GMTA 4KLNA 4NCNA 3RVBA 1ZUIA 3MJHA 1UJ2A 4PPGA 1ZD1A 4RFSB 4WZBE 4GNKA 1EGAA 1G20E 4Q00A 3QJYA 5DN6A 3LWNA 3TNFA 4DLWA 1ZD8A 2ZJAA 3GJ6A 3K1JA 5CM8B 1HY3A 4CEHA 1ZM7A 1RPZA 4GMDA 2JLYA 1DARA 4URYR 4BEJA 3KFVA 2QBYA 2XB4A 2PJZA 3QKRA 4IDPA 1P3JA 2EYQA 4FMBB 4LV6A 2RGGA 2KBEA 5KSOA 2WJGA 1XEXA 3EIQA 4W5HA 2ZIAA 1C9KA 3KB2A 4EFLA 1EWRA 4BLRA 2ZE7A 3W5JA 5DI3B 4ZV4A 1OFHA 3CR8A 5JLJA 3K0SA 3GEIA 1ZIPA 2V1UA 1NP6A 4EQ6B 2WWYA 1GITA 2E9SA 3W8NA 4YC7A 1QRAA 4E5UA 2REXB 1AQUA 1MV5A 2EYUA 5FTKA 621PA 3KQHA 1KI1A 3R8FA 2BCJQ 2B7BA 2YOFA 2QAJA 4LI0A 4BFVA 1ZNXA 2DBYA 1NMZA 5CK5A 2W0SA 1F2TA 1VYTA 4AC9A 4MYTA 1RJ9B 1U8ZA 3Q5EA 5FPHA 3QKTA 5JEEA 4W7SA 1D2EA 3R7WA 4ACBA 1ZC3A 1K6MA 1ZM4A 2WZQA 2ZE8A 3AF1A 1UDWA 1KO1A 3WY9A 3FKSA 2BVNA 5KHOC 3EA5A 3ND9A 4DLYA 4DHEA 4L5BA 4K81B 2ODEA 4D26A 4BFZA 2GHIA 2BJVA 1NRJB 1DAMA 5EP4A 2Q21A 1E69A 2IF0A 3KTAB 1MRNA 2EWWA 3U6BA 1FOEB 2ANCA 4LJYA 2GBLC 4TMTA 2D74A 2KE5A 5FL7D 1IOZA 3QOFA 2VHUA 2WWGA 3TRFA 1RC8A 3PEVA 1M6NA 1IN8A 1OYWA 4GBMA 2LKDA 2CK3A 2G1KA 1XRJA 2NO6A 4OI4A 5B30A 3AVYA 4PHHA 3T06B 5JSZA 3LFUA 4IKEA 4RZ3A 5K8IA 2QL6A 2GRJA 2IYLD 1U0HC 2RB4A 1W44A 4LZZA 3G5UA 3E1SA 4OK3A 4XIGS 2G1JA 3O8CA 2QUZA 2V55B 4BLOA 2W6ID 1RRFA 3GD7A 5EE1A 1R7RA 3I72A 1ZNYA 4LOAA 3LW8A 1Q1ZA 2I3BA 1Y63A 3EC1A 3UMRA 2CCGA 3U7GA 5CIWA 4OI0A 3DZDA 3OFND 4FN5A 3CPEA 3K0AB 4Z51A 1W2GA 3OIUA 4XVUA 1S3SA 4G5SA 1U9IC 1UBEA 1UKVY 3KJHA 2D7CA 4MITA 4LJ4A 1R5OA 4DSNA 2KBFA 821PA 3BH7A 4PTLA 3FMFA 4M1KA 4I1VA 1RFLA 1T91A 3QPUA 3MSXA 4M1YA 3B6EA 1G3RA 1DVRA 4BFXA 2QORA 3TLXA 1LS1A 1JPNA 3IQXA 5CB6A 4PO1A 5G3ZA 1CJVC 1TEVA 3RLFA 3C15C 1DAEA 3V00A 2I1VB 4DLRA 3GLGE 2JIZD 4TSFA 3RRZA 1OH6A 1KK1A 1QBKC 2BM0A 4DSUA 1GRRA 2QPOA 1KMHA 2ZU6A 3LNCA 4QBHA 4Q7JB 5CM9C 2JATA 3B2EA 1OFUX 1Z0DA 2LKCA 1GVNB 2OCPA 1EFTA 4HATA 2Z83A 3QKSB 4IEIA 4ACAA 1E2FA 3HU3A 1E9AA 4Q66C 5J40A 3L0OA 3B60A 4IVQA 1IN6A 1FL9A 4E07A 1W36D 3QY0A 4HUQA 4BGDA 2OESA 1N0VC 1Z0JA 4M9SA 5FOUA 3SYLA 1E79A 2GILA 4FINA 4LHZA 1F2UB 3FOZA 4BWYA 5KO2A 3TAUA 1F48A 2QP3A 4HB0A 4BASA 1KO7A 1GKUB 4NPHA 4DLSA 3VR4A 1N5JA 4LBWA 3U3MA 1SVLA 3E70C 3CKLA 1ZUNB 2CJWB 1MABB 1E0SA 3IGFA 4P4SA 3AF0A 4Q1BA 1KI9A 2ZJ5A 3L0PA 5GJWC 4B34A 3VR1A 2E87A 2BMFA 2WPDA 2VO1A 4DB2A 5DIFA 5FTMA 4DC9A 5B64A 3OEHD 3WYGA 1WXQA 1ZNWA 4KV9A 4ARZA 4NCKA 4DDVA 5K8TA 1N6OA 4Q7KA 2KI5A 3BAFA 4KHZA 2OUKA 4AD8A 4YMUA 3GLGA 2C95A 3DHWC 3DKPA 4AY2A 1Z6TA 2VP9A 1DO2A 4M1TA 4QXAA 2IYSA 3RS3A 1AIPA 3V4FA 1YZNA 4B73A 3CWQA 2XAUA 2W58A 4I81A 2W00A 4NYMQ 4A0GA 1E9DA 1S8FA 2FZLA 2WKPA 1Z28A 2VP6A 4Q7LA 4TYQA 4FMCB 3X2SA 2ZS9A 4QFMA 4PANA 5KSZA 5E7MA 2XB2A 1YZTA 1T3SA 2ZJBA 1KSGA 3TSOA 3MCAA 4FCWA 1COWD 5AWFC 1I4LD 1OKKA 2DYKA 1OLOA 1S1CA 3F8TA 1JALA 1H8ED 5DISB 3R9WA 2BBOA 2F3TA 2DFNA 4MRNA 4TT3D 1N0UA 1ELOA 3D7MA 3KJGA 5D3QA 1Q3HA 1Z0AA 3UKDA 3WBKA 3K9NA 4MRRA 1HV8A 2ZUDA 1DG1G 4IHQA 4OQNA 1KI6B 1BIFA 1BMFD 2WSMA 3N2EA 2RGEA 3GFOA 3JVUA 4HLDA 4Z8XA 4DEYA 4EPTA 4JVMA 1SXJD 3CRQA 4KO8A 3QF7A 1JR3E 1CLUA 2HLDD 5LB4A 2ZUCA 4XTCS 5JWOA 4BFWA 4KXFB 3WRXC 1E1QA 1M7BA 4GP7A 1NN1A 3T1QA 2OFWA 2ZI7A 1IY2A 2Z0MA 4M1WA 3RNLA 1G4AE 1GFIA 3LA6A 1SVSA 1FZQA 4G3XA 3RWMB 5BN5A 1HTWA 2XOKD 3KKNA 1E9SA 4TMKA 3A1WA 1KSFX 2IUTA 4KFUA 1KZ7B 4MUBA 4HI0E 5FUXA 4LBYA 1XCPA 3LX5A 3WMGA 4A6XA 5TMPA 2O8FB 1GWNA 3B9PA 1R10A 3L0SA 5JWHA 3BJIC 5G40A 1JAHA 1P72A 5KSYA 2GZHA 3AKEA 5H1YA 4LC0A 5EXXA 1GL9B 2EU8A 3IHWA 4DVGA 3GLIB 1GUAA 2ASEA 3BH0A 3MGCA 5DE3A 3B1XA 1XP8A 3RWOA 2O5VA 3SFZA 5IK2D 2ZROA 2Q0HA 1M34E 4TLDA 2ZPTX 1XD9A 4DT1B 2O0HA 1OT3A 2BV3A 1NG1A 3KZ1E 5TDHA 1A4RA 4C2UA 4ZDIA 5C1BA 1N6RA 2W83A 4D82A 2VIIA 4QBGB 1M7HA 1NKTA 1U9IA 4M4SA 5DYIA 1MKYA 3P1JA 1J70A 3DMNA 2IEYA 3QI2A 1OPXA 4II7A 3W3AA 1SVWA 1OYYA 2ZRPA 2WAYA 5P21A 3K9GA 4CIDA 5JHHB 1GL7A 3W6NA 1P9RA 2BMEA 2ZRIA 3GJ4A 5EE0A 2YHSA 2V6JA 1QHGA 2BOVA 4EPYA 2J7KA 1MH1A 1SVIA 4A0FA 4CEHB 3OEEA 2QZ4A 5GVRA 1M8PA 1TF5A 2HEIA 3BWDD 3GQBA 1TX4B 4GFDA 5EZ6B 5BN4A 1IJFA 2QBYB 3QKRB 2PLFA 3VQTA 3W3ZB 4WVFA 1E9CA 2QQEA 1GDDA 4EJSC 1QF9A 1XEXB 2AK2A 5B58C 4Q19A 1IY1A 1E99A 1II8A 2QMEA 2QRNA 3U7EB 1SKQA 3T61A 4CEIB 4JJZA 1E2KA 1OXVA 2BWJA 2NOAA 4FWIB 5DI9A 3ZH9B 3A36A 3SJBA 1VDZA 3U60B 2NZ8A 3IO5A 3CLVA 3CX8A 4M22A 2EVWX 2Q3FA 1EWQA 3CO5A 4PO9A 1JEEA 1EX7A 3OAAA 4TMVA 1KI2A 1KO5A 1F2TB 1LF5A 1PUJA 5LB2A 2FF7A 3TKLA 3X1DA 3W34A 1S1MA 3A1UA 2HUPA 3R7WB 1N5LA 2REBA 3I73A 3C16C 1XPUA 4OQFA 5DI3A 3IBYA 1WF3A 2XSZD 1E94E 4EQ6A 5JJKA 2OBLA 4NMMA 4FWTA 3CPJB 2XGJA 2GCNA 1KJZA 2AHOA 4B2PA 1T6NA 4EIWA 2O0JA 3MWYW 4BZPA 4DLTA 5LD2C 2FGKA 3NTUA 4L16A 4GZLA 1OXXK 5D3MA 4PSKA 2CLSA 3ZIAD 3JZAA 4MH0R 2GCOA 3BK7A 1KAOA 1NLZA 3NBZC 4ABYA 3P32A 1SGWA 2ZRAA 4OYHA 2G77B 1VCNA 2H7VA 4O25A 4Q1EA 3SBEA 1G3MA 1E1RD 2BKUA 3I92A 1CTQA 5JSZB 3LW7A 3K0FA 3MWJA 4KYIB 4JYBA 5EE3A 1HQYE 4NYMR 4TWZA 1EFRA 2QAGC 4A0HA 1JPJA 3BC1A 5LDDC 2EFDB 4PQYA 4WAUA 5F9FA 2A9KA 3A4LA 4DSTA 3KB1A 3LXXA 3PJRA 5TVKA 3U3OA 1OXTA 3I4LA 1N6HA 5F2EA 1AZSC 3CBQA 4Y0AA 2MSCB 5FL7A 2NQ2C 3HYRA 2ONKA 3C14C 2FPKA 3PUXA 3I5YA 2XEXA 1UAAA 2GXQA 5KDOA 1SQ5A 3QXHA 3AP1A 5GJBA 3D6TB 5EQTA 3RYTC 3F5FA 2IHBA 4Q02A 2W2TA 2N46A 3HP1A 4LYJA 4AKHA 2CNWD 5C4MA 4M21A 1XZQA 4B71A 4JBYA 1CJKC 2YKGA 3RDPA 1ZD9A 2A3RA 1XXHB 3VX4A 4G5QA 3IBGA 5JWRA 2J5XA 4M2LA 2AXNA 2F3RA 2NO1A 4PXAA 4E03A 2JJ2D 1U2RA 2CL6X 1XEWY 1Q57A 4TLAA 2BCGY 1A5TA 4PPFA 4R9UC 2IL1A 2YWFA 1Q12A 4JT4A 5JEDA 3X1YA 1VIYA 2RMKA 4TYWA 2TMKA 3GJ3A 3TR5A 5C4GB 2XZLA 3K70D 1CULC 1Z29A 1R2QA 2C9CA 5GJVC 1DOAA 2QM7A 3VFDA 3DPUA 2ZYTX 5CJPA 4JLAA 2RGBA 1KMHB 1O87A 5FOXA 2F1RA 2Z4SA 4A1FA 3LDAA 4DUGD 4NYJR 3GEHA 4C0SA 4CDGA 4TL6A 4ZDKA 2HDNB 3CNLA 3FYHA 4LK2A 2ZEJA 4NHOA 4R71A 5L3SA 4OQMA 5KTYA 1MO5A 4H9GA 4XTRA 4Q7MB 2Q9AA 3P4YA 4JSYA 4JLNA 1LVGA 1BKDR 4HUQB 2FV8A 4MUAA 4OI2A 4JL8A 5F9HA 3DOFA 1ZIOA 1LV7A 2W2XA 4RY2A 2FEOA 1CJMA 3NDPA 3UWKA 1DADA 1HH4A 5DNYB 1Z0FA 4KBFA 1NG9A 3R9IA 4QBFA 4UNQA 1UBFA 1KO8A 2OBNA 1EFHA 4P4SB 3UXMA 2PCJA 2A5FA 4IVPA 4JLMA 2GXUA 1TQ2A 3P26A 1W4AA 3PV0A 3LQRA 1FTSA 2GDJA 3U6KA 5J4KA 2RH5A 1FUUA 2VQSA 3CZQA 1CR1A 4JLKA 1HT1E 4ARZB 2IX3A 2IYRA 5KNDA 3GLGB 1FPMA 4C0QC 5CJ2A 1P2UA 1JXOA 4HDQB 1MABA 3QENA 2ZTSA 5E95A 1T9HA 2D4HA 5AJYA 3TR0A 4W5JA 3QPWA 1E32A 1M74A 4EJSA 2G9NA 1E6CA 2KJQA 4A8JC 1ODFA 3C8UA 3ND8A 3NHAA 4AKGA 2ZJZA 3EPJA 1L8QA 1LS6A 1KSJA 2H5EA 3OEHA 4MQBA 4DCTA 3Q5DA 4ILEA 3G82C 1I4DD 1XF9A 2B21A 4AWXA 4FD2A 5JRZA 4D6PA 4C0KA 4L8GA 3VU9A 3LAWA 3R9XA 4RKEA 4FI3C 1IJEA 4UJ3A 1DAIA 4CGZA 3EARA 2OAP1 2J41A 1RW4A 4LSGA 2MSDB 3GLIE 3UWOA 4DKXA 1BOFA 1E0JA 2IYQA 3SN6A 4YDHB 3LLUA 1KKMA 3AM1A 1W0JD 1G291 1SKYB 1GTVA 2YWGA 4PAOA 1NN3A 2C78A 2Q3HA 4ZDWA 5KSPA 3VR2A 4US2R 3ZVLA 1KY2A 4BEBA 1COWA 1OFTA 2XJ9A 4BLPA 3C41J 2P65A 1U0LA 2IS4A 1DS6A 4RVCA 3HU1A 5CLQA 3WNDA 2I4IA 3N5CA 4R98A 4F91B 1YR9A 4TTQA 4KLZA 2WSSA 4DZZA 1W5TA 1HEIA 4WA7A 4JKIA 4KVAA 1H8HD 5L3QA 3A6PC 1W47A 4US0R 5AR1A 1G8PA 2CMKA 4PQFA 4YLGA 2QAGA 2WOOA 3IIMA 4NE2A 2ZI4A 4IXMA 1HE8B 1ZW6A 3SHWA 1NVUQ 2F1JA 3FPAA 1G8GA 3WNBA 2J45A 3K9LA 4F92B 3O8DA 4HUTA 4I1OA 1T5LA 1N6NA 3IEVA 1NBMA 1JQLB 3ASZA 1W46A 1E2MA 1G9XA 2PT5A 3N2IA 3VX3A 2ZRLA 3M4YA 4CRWB 3U61B 2OV2A 4P4UA 1FNNA 4C0HA 4MYUA 4E09A 3RABA 5IRCD 4XWOA 1II0A 3B9QA 3V9PA 221PA 1U81A 1TPZA 1UPTA 1K5GA 2F9MA 1G64A 2A5JA 4HB4A 2JDIA 4LJ5A 4ZKEA 2FPMA 3AUXA 3NHBA 2IHYA 3BIFA 4DT1A 3VR3A 4GMXA 3EPHA 2ATXA 4PHGA 4Q03A 1FMLA 3I5XA 4U5XA 2GK6A 3GLFA 2AD5A 4RD0A 2J7PD 2ZRCA 1KIMA 3VHXA 3FFBA 4YXWA 1AQYA 1PLJA 2XTZA 1Q44A 2XITA 3ZZUA 3X1ZA 1IM2A 4HB3A 4C0LA 1II8B 2ERXA 2OO7A 3MAAC 2CBZA 2YVUA 4ZPXA 1Z0IA 3BS4A 1Z83A 2MSEB 4F7WA 3OE7A 3I1FA 5EXPA 2IS2A 4MDEA 5SZKB 3DDCA 2BMDA 1YHNA 2XNDD 4HAZA 1KDPA 4XJXA 4LYAA 4D81A 2WWXA 1AA9A 4P3YA 5IHPA 5UKDA 3H1TA 1NJGA 4Q9HA 3AKYA 3SI7A 1J90A 3T12A 3VKWA 3O8BA 2O8DB 1ZNZA 4N3NA 3WRYC 4UXJA 1EX6A 5FUYA 4CEIA 3NH6A 4JT2A 1NNEA 1KO4A 3HR7A 3C5HA 2F7SA 4LY6A 1KDOA 4TLCA 1IN4A 121PA 1Q21A 2ZAMA 3SZRA 4LJ9A 3TE6A 1P62B 2J3EA 3SE0A 4U00A 1L4YA 5D3MB 2ZJOA 1T8TA 1J8YF 4DWJA 1H65A 2GCOB 1F60A 4AI6A 4TYYA 1KNXA 1P2SA 2BIFA 3LLMA 3RC8A 2PL3A 4G0NA 1KSHA 1J2JA 4U02A 2QSZA 2V7QA 1E2IA 4MRSA 2OEPA 3K0FB 1XXHE 2K5UA 2GAOA 3REFA 5LPNA 1NN0A 3QG5A 4F4JA 1RRPA 2VYFA 1NJFA 2ZI5A 1FUKA 3QVVA 5JBQA 4ESVA 1VPLA 1KJYA 4A8JA 3KFXA 4LGMA 2H17A 4O2LA 2GEVA 3MG9A 4UQOA 1S4QA 1Z47A 2DFKB 4HAVA 3ZIAA 4O3MA 3UANA 1FX0A 2ZRKA 4MGZR 1T8UA 1YU9A 3NBFA 1BO6A 5J4VA 4TL8A 1A2KC 3SJAA 3TBKA 2YZ2A 3QUSA 3DEFA 1XD8A 4G5OA 2N1BA 4I1UA 3ZZTA 1K8RA 2ERYA 5JI2E 4Q47A 1LW7A 4HZUA 1T0JB 3TGPA 2JA1A 2HCBA 1AGPA 5EE9A 2HYIC 4QGAA 2HV8A 5KNBA 4HAUA 1XCMA 2DHRA 1W48A 2FJUA 4QJ4A 2YWHA 2GF9A 5GJCA 1PLLA 1G1MA 3BFXA 1U8AA 4B2IA 1ZMXA 1JI0A 4QG7A 1WB9A 2WJIA 4V0OA 3WHKA 3Q3JB 1VYUA 4D4KA 2JLSA 2QTFA 3GFPA 4J0QA 4RCZA 4ERNA 5HZKA 3J81k 2JLXA 2HXSA 5BYJA 5JFGA 1XXHA 2ZR9A 2ORIA 2ZVPX 1NLYA 2C9YA 2ECKA 5AUPB 4L15A 5L3SB 3THOA 2V4ZA 1UKEA 2JJ8A 4WIAA 4QBIA 4B6FA 3THYA 2H92A 4IW3B 2R8RA 4US1R 1NL3A 4L9SA 1GSIA 2JJ2A 2WJYA 5AJXA 5TARA 3W8RA 3KQKA 2XZPA 4KITB 4A92A 1FNMA 3QPVA 2CVHA 2DWOA 3T5DA 3VKHA 1X6VA 3ZVRA 2QQ0A 3U7FB 1ZUHA 5CIQA 1OHHA 1A82A 2HJGA 1UF9A 1W0KD 2QMOA 4LYHA 5LBIA 1FP6A 2IXEA 2AX4A 4Q01A 1JR6A 1XTSA 1D2NA 1LY1A 4PC7A 1GILA 2J0QA 3V4RA 3ADCA 2ZRBA 2A2ZA 1D9XA 2OZEA 3PG5A 4HLQB 4HSEA 3D3QA 1IN5A 4GRAA 4URWR 2O8BA 3K8YA 4X8HA 1E9FA 3AVVA 2DFLA 2HYDA 3NWJA 4WOPA 5C46F 2NIPA 5JRJA 2ZRNA 4D4LA 3QF4A 2FH5B 1E2DA 1JXMA 3T1VA 4K8OA 6Q21A 1Z6YA 3R8CA 4DCNA 5G41A 3TIFA 1E2QA 3DZ8A 3PUZA 4PC3A 5J4HA 3M6AA 1G5TA 1GKIA 3MRSA 5CYOA 3KKOA 2ZS7A 1X8LA 4DEXA 1JECA 5DLQC 4RD3A 1LB1B 3W90A 3CUEF 5EUQB 3FMPB 1OH5A 2UKDA 2OLJA 2BKEA 1D2MA 1I4TD 4EJSB 3CZPA 2GF0A 2WIBA 3CR7A 1YR8A 1L2TA 4FMDF 4JVNA 3SEAA 1SKYE 3U3JA 4Z8YA 2VLIA 5CITA 4KFRA 4YONB 4PZYA 3A8TA 4S2EA 4EPXA 1JAIA 4IOJA 3FHCB 4C0AC 5IT5A 1NVWQ 1KK3A 2OSBA 3WNCA 4AG6A 2C77A 2RKOA 1MO6A 4F93B 3L8YA 1NI3A 4W9MC 4IOKA 3UG7A 1T4GA 2PX3A 4XVRA 2ZYVX 1HA3A 5EP1A 3VU9B 3BB1A 4TL9A 1WBBA 4KODA 2OHFA 3IPYA 4JMPA 1X1RA 2IS1A 3REGA 1J7KA 1FP7A 1IXSB 1E2LA 5FH9A 2H16A 3SNHA 1MO4A 2OCYC 3FHOA 3C4JA 2VHCA 4HLUC 5JCZA 5DYGA 3I8XA 4QHTA 4A82A 2P6RA 3ZD7A 1IQPA 4DLVA 4QHSA 4D4MA 3JZMA 4LPSA 4XOIA 4LJ8A 4D25A 5LD2B 4RD1A 5EE5B 2JLQA 2VH5R 4BFSA 5IF9A 3UIEA 3ZVNA 5KUTA 4DLUA 2FSFA 4TMWA 4S35A 3TUJC 3KX2A 1G7TA 4QM6A 3E5HA 5FBRB 1C4OA 1G19A 2EWVA 4E22A 3I62A 2H57A 2LCFA 4TTRA 3K9HA 2FDCA 2ZRMA 1GL6A 5L3QB 1ZM9A 521PA 1N3BA 3W9YA 2BC9A 2AL7A 2QAGB 2X77A 3N70A 3P4XA 4LHVA 2BJWA 1TEXA 4RD4A 3P27A 1G3UA 5FPSA 4O2RA 3A1TA 2ZSDA 3BERA 2CHQA 1HT2E 4HAXA 4RZ2A 1QHNA 1P60A 1KI7A 4JSTA 4XD7D 1VG9B 4IDOA 2YC4C 4FXPA 5EXSA 3EAQA 4I99A 2VL7A 5FUVA 5AUNB 4C30A 5F3WB 1W2HA 3PITA 2FA9A 4AURA 4JS0A 1P6XA 4NYJQ 2CHVA 3K53A 1XDBA 4ZCLA 1VECA 3SU8A 1V5WA 4M9ZA 4BFUA 3CRRA 1RZ3A 1PV4A 1Z63A 5JJLA 1TADA 3KQNA 3RRNA 2QPTA 2IUSA 3B1YA 2NG1A 1RRGA 2ZYWX 3H84A 2ZS8A 5FOWA 4NBSA 2JJ1A 3IHLA 4P4TA 2PZEA 4HAWA 4RKFA 4R2IA 4IFEA 4UNNA 5FPTA 4TQUS 3BE4A 3GLFB 1M7GA 2H8KA 1N5KA 1P9WA 3AF2A 1IXZA 2QY9A 4B3CA 5FL3A 3EIHA 3L82B 5FR1A 4LJ7A 1ZYUA 4H1UA 1W36C 1YZLA 4GP6A 3FHTA 2NZJA 1OB2A 1Q22A 4AKEA 5G53C 2ZI6A 3I61A 2OBMA 3EWSA 2JASA 5HPYB 2YOHA 1GIAA 5SZHB 2YC2C 3D8BA 3JVVA 1T3LA 3THXA 4ZI2A 4IRUB 2ZITA 1XMIA 1RYHA 2JGNA 3KQUA 1BYUA 4A15A 3PUVA 2CXXA 2WVJA 2G83A 2IEZA 5HKKA 4PFSA 4Q48A 1FTNA 5DN6D 4QGGA 1Q1BA 1TQ6A 4P32A 5CYPA 2V9PA 3SJCA 1G7CA 1GAJA 4UNPA 2W6JD 5JECA 1VCIA 1D8TA 2AFHE 3THWA 3ZLJA 1U0JA 2E1RA 4PC1A 2O8CA 1PLKA 2XZOA 4EPVA 4FCVA 1TUEA 3DKVA 4ASUD 2PJRA 4NP6A 1G7RA 2F55A 1G8HA 2F43A 3T1TA 3RRYA 4M8NE 4AKIA 4EUNA 1ESNA 4IOMA 1TF2A 2QENA 2JLUA 3LH5A 4IEEA 2BHRA 1NN5A 2QNRA 3PXGA 3AVXA 3LRPA 2XXAA 3LV8A 1CF4A 4DDUA 1XPOA 1D9ZA 2YWEA 4OQXA 3O47A 3OIYA 1YQTA 4JIMA 3GEEA 4RCYA 4YMSA 4AYXA 4C2TA 1Z07A 5KNCA 4JKYA 2B92A 1OIVA 2R6AA 2I1QA 4PPQA 4ZCMA 2WJHA 3SBDA 2DWQA 3H4MA 1KDRA 2FPLA 4A8JB 1E2JA 3QNUA 3RS2A 4URUR 2Q9BA 1CRPA 1EK0A 1AGRA 1KMQA 1GM5A 2D2EA 5FOSA 3FKSD 5EP3A 3VNVA 2VEDA 1FX0B 3ADDA 1PUIA 4EKDA 4PQRA 4XH9B 2X2EA 3CNOA 3PR1A 4M53A 1SXJC 4GPTA 4LJ6A 3KQLA 2REOA 2OM2A 3B5JA 4AYTA 1QG2A 5TXGA 3FE2A 4OL0A 1N5IA 2BEKA 3BH6A 4Q1FA 1G3IA 421PA 4HZUB 5JS7A 2UVQA 3IEUA 1FFHA 1CBUA 2PMKA 4PSAA 3TUZC 2C8VA 1A2BA 2CK3D 3BRWD 2JLRA 3ZS9A 1XMSA 2GCPA 2ZI9A 3ZGXA 4HLUA 2WKRA 3F0TA 2WMNB 2R6FA 5DSZA 3H86A 2VHTA 1GP2A 2WIAA 5BW8A 1OE0A 3IO3A 4PSVA 1NMXA 3BB4A 4PZLA 1JJ7A 1KGDA 2FFQA 5JJIA 3EZ6A 5KPDA 2HT6A 3I3SR 4RZUA 1R5NA 3FTQA 3TW4A 4JLBA 1FMJA 2WHXA 1ZU4A 1OH8A 1ZCAA 4DSOA 1ZU5A 2ZUBA 4EAQA 5GVSA 2W6IA 1EESA 4NKRA 4BQSA 4LJAA 1R6BX 3LQQA 1OIXA 1R0WA 1FQKA 1UEIA 1Z3IX 2P5TB 4EPRA 3THYB 1UBGA 1X8JA 4O0MA 4XVQA 3M1IA 5J4YA 3ADBA 2ZAOA 2PEYA 3LBNA 3OFNA 1OW3B 5J4LA 1G41A 5HE9A 1KJWA 2NTYC 4PPNA 4OBEA 4B3DA 5FTJA 3UMFA 1RVDA 4A2QA 2IK8A 3VKGA 1NVXQ 2IUUA 2QEQA 4OJQA 3KKPA 4KSCA 2RGCA 2NGRA 3AUYA 3K70B 2J46A 4LV5B 4PO8A 2P6NA 2ODBA 4MKIA 1G21E 4NONA 3T15A 2O52A 2O8BB 2FX3A 3NH9A 3FMIA 4JLJA 2IWRA 4B6EA 4CVNA 3SQXA 4G01B 2R6GA 2RGAA 3B1VA 3BXZA 3CRVA 1W49A 4M1SA 3TJZA 2RCNA 1Z6XA 3QF4B 4FMCF 5AUQA 2C03A 4TSFD 4C7OB 3EW9A 1E9BA 1R0YA 4B3XA 3K0EA 4D0LB 4M9QA 3RS4A 3EZ7A 4XWKA 2Z6VA 3EWAA 3FGNA 3SC3A 2JIZA 4B2LA 3AVUA 3UK6A 3VHLB 3E2IA 1E98A 2G88A 3NG1A 1YRBA 5CB8A 1IY0A 1NKSA 1UFQA 4ITRC 3IIKA 3WBJA 1BYIA 1WRBA 4GT1A 4Q9JA 1XMVA 2IC5A 3QEJA 3GJ8A 3L43A 2OFXA 2VPPA 1E79D 5BQ5A 3EPKA 1XJCA 5KPJA 3S1AA 4AYWA 4PZZA 2WWHA 5A5GA 1TUIA 1T5IA 2AWOA 1GKYA 2LWIA 2J0SA 4ZI3A 1QVRA 1UEJA 4GOKA 4PC6A 2J9RA 1FW6A 4TL7A 4TLEA 3AF4A 1Q3TA 1PVOA 2WPDD 2JAQA 2DWPA 3K09C 4QJ5A 3FKQA 3AKDA 4X8MA 3Q7QA 1ETUA 4DIDA 1G5PA 1SXJE 1XBTA 3T34A 4A36A 1E0AA 4PHTA 2QMUA 1MOZA 1W7AA 3U4QA 5FOTA 3LX8A 1KY3A 1R8QA 2OT3B 3SR0A 1YZQA 2ZM5A 2O8EA 2ZRGA 1GRNA 4LV8B 4MKFA 2HT1A 4QNRA 2IF2A 4B74A 4V0KA 5J5CA 2V1XA 1QHSA 4A0RA 1QHHA 4TQ9A 4LCBA 1G6OA 1G5RA 1NBME 2VHJA 2ZR0A 3LVRE 1P9NA 4W5WA 1YJ5A 2VP2A 2WOJA 3IQWA 3U2QA 3AP2A 3B85A 5E7IA 2F1HA 1BS1A 1NVVQ 1NSFA 3Q7PA 3A1VA 5FFMA 2QA5A 1OKKD 3O8RA 2WMOB 2OE2A 4JLDA 1A1VA 1VYVA 2OAQ1 5EXTA 2GJ8A 5JHGB 1YVDA 2O8DA 3B13B 1HE1C 4CT5A 4JL5A 2VP0A 5DH9A 3GLFE 1UBCA 1H8EA 2GWHA 2JEOA 5B2ZA 3LVQE 4TT3A 1JEDA 1VHLA 3WMFA 2ZSEA 2JLVA 5H8WA 1OF1A 1WDTA 1DG3A 2ZE6A 4GZMA 3TSWA 1M2OB 1BMFA 1QG4A 3SDZA 1UKZA 2QT0A 3OF5A 5BYKA 1KZGB 1N25A 3K0CC 1E1QD 1I2MA 1SHKA 5FBLB 4BUJA 1O3YA 3CF0A 1SXJA 2GXSA 4AG5A 1II9A 3H2YA 5CLLA 4LC1A 2B6HA 1XEWX 3EASA 3SFVA 2HLDA 2R44A 2GVZC 2ZRHA 2FEMA 1XFAA 4C4PA 1DELA 1QZXA 4B75A 5BXQC 1SVOA 5HCIA 1ZBDA 3HWSA 2GKSA 4DCUA 1P73A 3KJIA 2CEAA 3QEOA 1ZCBA 4HDCA 4KCGA 3K70C 1TL7C 4TZ6A 2BM1A 4U7DA 4GOXA 3RSLA 1XMJA 5FUWA 4PX9A 3KUDA 2XOKA 2IYZA 3A37A 4BE7B 1RRCA 3CRW1 2GJ9A 2HCJB 4L4UA 1AK2A 4OHZA 4URVR 3CX6A 4HAYA 2EW1A 4MGKR 3B82A 4WZAE 3OIWA 2D3WA 3AV0B 4KBGA 4D2IA 4QOSA 1AJEA 3RC3A 5EUMA 4RZXA 4PR0A 4Y0VA 2C98A 2ORVA 3QBTA 2FGJA 4LHYA 4F4CA 1E96A 5IK2A 1XCGB 2WWWA 1LF0A 1KI3A 4LBVA 3THXB 1OB5A 4QM7A 3I8SA 4M9XA 3QG1A 4CYMA 3ICEA 1ZAKA 2AKYA 3MLEA 3LD9A 3QXJA 3CNNA 2GAAA 4ON9A 2IYVA 4GL2A 1XD2A 2FFBA 1JR3D 2CE7A 5AK0A 2Q6TA 3W6PA 3WYFA 3IILA 3CRMA 1GRQA 2ANBA 2J87A 1IONA 1EFCA 3OEED 3QXXA 4MKHA 3THWB 4KVGA 1HYQA 3B78A 5JZVA 2O8CB 5KYKA 5DGXA 1EG7A 1W1WA 2RHMA 2C99A 3ECCA 4K46A 4CZ2A 3QVUA 2F43B 3KJEA 2WWIA 1RKBA 4BZQA 4F38A 2X2FA 4XSHA 4YMWA 1Z22A 3MJRA 1G17A 1TMKA 1KK2A 4IFBA 1Z0KA 2ZI3A 4KAXA 2GXAA 3AGQA 1Y3AA 2XXAB 1Z08A 1OIWA 3HU2A 4LHWA 2NPFA 1M1YE 3VAAA 5K8LA 4Q9KA 2ODNA 2W6JA 4Z1MD 1N6LA 2DY1A 3SHFA 3KDSE 3ONWA 4GI7A 4PAQA 3OAAD 2FFAA 2HF8A 4ASUA 1NIPA 1NY5A 1U94A 3QIAA 2EFHB 1N0WA 2ZRJA 4B3BA 2ZJYA 4DLXA 4LX0A 2OXCA 4EPWA 1B23P 1N6KA 2CHGA 3C5CA 4TLBA 2IWHA 3EZ2A 1WE2A 3X1XA 3ADKA 3UMSA 1UDXA 2FMXA 2VA8A 2XSZA 4R7ZA 1ZC4A 4Q4AA 2AD1A 2NMVA 4BFTA 1R8SA 3K09A 4N1AA 3NC1C 4NH0A 2R9VA 3WHLA 1Z6GA 4OQLA 4QL3A 4OI1A 1P75A 1ESMA 1SHZA 2NO0A 1U8YA 5AUOB 3BFKA 2B7CA 5K8UA 1P2VA 1VCOA 4QNMA 1N6IA 1JJVA 2CLCX 3A4NA 3IDQA 3KXKA 4URZR 1TQ4A 4UXHA 1KHTA 1EFRD 2OG2A 5ANRB 1XTKA 2QGZA 1E1RA 2XX3A 3PEYA 4JYCA 3AVOA 4L9WA 3EZ9A 1VIAA 5TV2A 1XTIA 2VSXA 1E4YA 1IXRC 1XB2A 3MFYA 2ZE5A 3EZFA 1NVVR 2WKQA 4H1VA 4RFVA 3GJ5A 4Q9LA 4DIEA 3CH4B 5EZ5A 4KFSA 3NDBB 4OHYA 3L0IB 1KOFA 2GNOA 2O0KA 3FFAA 2ZSAA 5FBQB 2YNMA 3NIBA 2J59A 4IDNA 1NY6A 3OHMA 1YZUA 2R6DA 2ZR7A 1US8A 2ZQ5A 5JS8A 1ZJ6A 4C0JA 2YYZA 2ZVQX 4QJ3A 3CF2A 3DM5A 1S3GA 3CIOA 1C1YA 5L3RA 2XTMA 3GLHE 3TVDA 2CNWA 4WXRA 1SZPA 4CF7A 2VF7A 1Q1EA 4KFTA 4NCHA 3B7GA 5CK4A 1LFDB 5FR2A 3A58B 3K0CA 2YOGA 5DO9A 4Q21A 4Q9IA 3CPHA 1HURA 2EFGA 4N0EA 2BEJA 8OHMA 2JLZA 1CU1A 4CEJA 4OJKA 3WP1B 4QKQA 4F4IA 4N0DA 3PCRB 5F98A 4A6PA 2EFCB 2ATVA 2QTHA 2AFIE 4B43A 3T5GA 1KTVA 2ZANA 4LWZA 3UPUA 5FTLA 2DFTA 3D31A 3NEYA 1XJ0A 2XJ4A 2Y8EA 5FOVA 4DUGA 5IDVA 2CE2X 3DVLA 2AN9A 3H0KA 1E0KA 4Q1DA 4YMTA 3RANA 4M0LA 4C7OA 2WTUA 2N42A 3IUYA 3S1AB 2GK7A 3ICQB 1W36B 1AM4D 3HDTA 5BN3A 2VSOA 3U44A 5M04A 4A2WA 5B57C 3TH5A 4V0ME 4NZYA 3CM0A 4C3ZA 1OXSC 1W4RA 4OHWA 1RE0A 2WICA 2PCLA 3KXIA 3GJ7A 2QM8A 4Q4HA 2ZXUA 2NO7A 1U98A 5SZIA 3GLHA 3T1OA 1XX6A 3SJZA 4JLPA 5FI1B 2VBCA 2SHKA 3AVQA 3DM9B 4XSGA 1NMYA 2IYUA 4BPBA 2GJAA 5CDFE 1G8FA 2ODWA 3X1WA 4V0LA 4D0NA 2W2VA 1U90A 3EX7C 4NYIQ 2KB0A 3B1WA 3U4QB 2ZJ8A 1R4AA 1UM8A 3L2OB 3EA0A 1GOTA 2O8EB 1QVAA 1XU4A 2QE7D 1GG2A 1A7JA 1KAGA 3NXSA 1ZM3A 1N6PA 1QHHB 4B48A 2PMDA 1VMAA 3AGPA 1GNQA 4DCSA 2NO9A 4HDOB 1TTTA 1F3OA 3U3KA 1Q1QA 1Z6AA 1RYFA 5HCNA 1CXZA 3EXAA 4BECA 3HPQA 3NKVA 3SYKA 3RHFA 2A30A 3GP8A 2VHQA 3FVQA 2F1IA 1G4UR 1XZPA 1OJLA 1MR3F 3PFIA 4HB2A 4Q5IA 3FMOB 2QP9X 4HEJA 1VTKA 4TYPA 1AZTA 1KYIA 4KJZA 5TB5A 2IYXA 4LUCA 1PJRA 2GZAA 1E2PA 1DPFA 1XNJA 4TZ0A 3A1SA 1AN0A 4V0MA 3CX7A 1MT0A 5A4JA 2RHDA 3SS8A 1AS0A 3QE0A 4RSGA 5HZHA 1XEFA 3CW2A 3ZD6A 4Z54A 3M0EA 4DLZA 3HR8A 1D5CA 1X3SA 2WM9B 3EIEA 4JZKA 3WYAA 1SXJB 5CDFA 1WQ1R 2RGDA 2VP5A 4IVRA 5DHFA 1X8KA 1FQJA 1DAGA 3HJNA 2DPXA 2W0MA 3AB3A 3QQ5A 3WP0A 4EFMA 3PEWA 1W0JA 3W5IA 1W4CA 2Z5FA 3GFTA 2P0EA 3KXLA 4G1UC 3AP3A 2P67A 2CVFA 2C04A 3NVAA 4TQAA 4ZO4A 2PZFA 3DMDA 1E9RA 2WSSD 1KI4A 4ZIRB 4PC2A 2PBRA 5EP2A 3LY5A 2BDTA 3VR6A 1Z5ZA 2HXYA 3QKUA 4MYCA 2OLKA 4G5RA 2QG6A 1YZKA 2QMHA 1H8HA 2ZRDA 1KDTA 1I2DA 4BRUA 2GBLA 2FN4A 2YINC 1QHXA 2IYTA 4DDTA 1R0XA 1OH7A 1DO0A 1G3QA 2FE4A 2WV9A 2C9OA 1NBMD 2DB3A 3Q9LA 2IS6A 1CKEA 3FDIA 1U99A 1YZGA 2L0XA 4MGYR 3IIJA 4A4DA 4JLVA 1TU4A 1Z2CA 3ZQ6A 5J47A 2ZSBA 2WAXA 1XD2B 2A5YB 2Z43A 2J0UA 2JDID 3QSYA 2IYYA 1QHIA 3FB4A 4M1OA 2JLWA 5HR5A 3FWYA 4P33A 3EC2A 3F3YA 4Q4JA 5L8VA 2MMGA 2FSIA 4OHXA 1IHUA 1YRAA 3QXSA 4POAA 1K5DA 2GVDC 4YXWD 4WBSA 2AKAB 1P7CA 4AIIA 1D6JA 4HYYA 3ZZ0A 4KI0A 2QROA 2C96A 2CL7X 2J7PA 4QC2A 2D2FA 3NBXX 3TSZA 1ZRHA 1JR3A 1VHTA 2FG5A 3EG5A 3ZVMA 1XTJA 3B1ZA 3OE7D 5E4FA 1LNZA 3TAHA 4DB4A 4P31A 1VKJA 2X1VA 2AR7A 2IA5A 2FSHA 4Q1CA 1Z06A 2YV5A 1W5SA 3ETLA 1P4SA 3RS5A 1S96A 1S0UA 3TW8B 4D4JA 4X8LA 4TMZA 3WXMA 1WA5A 1R0ZA 2B8TA 5FI0B 4RFSA 3W6OA 2XNDA 3NBYC 1G16A 3OIVA 1EXMA 5FPYA 1VG0B 5GADl 1TU3A 4TN1A 3T35A 3RAPR 2IXFA 4EFNA 1OFIA 3G0HA 4Q4AB 4Z1MA 1CJUC 5L3VA 1XJQA 4NYIR 5SZJA 2BMJA 5KDDA 2FFHA 3IKJA 4JLOA 4A2PA 2IT1A 1XWIA 2GJSA 4HLCA 2CCKA 4FCTA 1E2NA 2GEDA 2V7QD 2WWFA 4V0NA 4LDJA 3AVTA 2CLDX 4UKDA 3RSOA 2JCSA 3Q8XB 4BLTA 4LBZA 1KK0A 5H70A 2D7DA 5KDLA 4GDFA 1IBRA 1ZVQA 3ZJYA 3KL4A 5HTKA 2C2HA 2GZDA 1T0HB 4BFYA 3PUWA 1OXUA 1ZP6A 3L8ZA 3IPXA 1XPRA 2P6UA 1R5BA 3NC0C 1DAHA 1Z8FA 1CR0A 1AS2A 1AKEA 2RGNC 3TK1A 4JVSB 4NTZA 2QGNA 1RJ9A 2J0VA 3QBVA 3VR5A 2QN6A 2VP4A 1HUQA 3ZQJA 4B44A 2NPIA 2Z4RA 2A5GA 2ZU0C 2R62A 3TVTA 2GA8A 4LRWA 1CR4A 1L7VC 4G5GA 4MKGA 5C18A 4RJLA 4YDSA 1S2MA 1US8B 1MO3A 3CB4A 5JMTA 1DTSA 1ZINA 3HPRA 2X19A 4OHVA 2YJTD 1F6BA 4DXAA 3ZS8A 1Q20A
chains in the Genus database with same CATH superfamily
3TTYA 4NSNA 1WUJS 3CSUA 1X87A 1KRHA 3DW1X 4PGMA 3AQ4A 3HP4A 4MW9A 3A06A 4XYGA 5BP7A 3EVGA 3IKMB 2YHIB 2OZPA 4R1TA 3WYBA 3ENWA 2OYRA 3CVJA 4ZT6A 4O1HA 1Q84A 1H5UA 1X39A 3DV0B 3ELDA 4MR7B 1WY5A 3Q3VA 1ZVMA 4G0YA 3SC6A 3UJAA 3ROPA 4BQOA 5HSGA 2NP7A 1N2IA 3AYXB 2Q0QA 1UANA 1G8MA 3MJCA 1MJNA 3GIWA 2N9UA 3H5NA 3GJRA 4LYEA 3TMYA 4OK6A 1CRQA 2JK1A 2ZREA 1J6UA 3R7LA 2O50A 2OGTA 4KGDA 2C20A 3R77A 4R81A 3ZXYA 1VG8A 5IT0A 1J2UA 2CXRA 3BXEA 3L93A 3E84A 2PZAA 1UADA 4PONA 3UB4A 2Z56A 2YUTA 4LRTB 3UA3A 1VG1A 4D0GA 3H83A 4V03A 4B3FX 3LDGA 3EZGA 5SYMA 4WXEA 4D43A 4R1LA 5IFLA 1D3AA 1RYMA 3OZCA 4PLVA 4DR4B 1JB1A 4MUYA 3HH8A 1BWQA 2FZ4A 2H1LA 3PDJA 1ZBQA 1WPRA 3DZBA 2DCUA 4HY3A 4C30A 1H2YA 4KWEA 1GPAA 1H0RA 5CP8A 5DBGA 2R8YA 4G0QA 4Q18A 1J9GA 2GJKA 2RIPA 2Y1LA 3PSAA 4M1EA 4L8YA 3KLNA 2JCYA 4J6EA 5DTMA 4CE6A 1ZI6A 3ZKWB 3E8MA 1J99A 3F46A 4LOKA 4M3NA 5I9IA 4ECEA 1G60A 1OHHD 3VO8A 3WK6A 2W2NA 3FTEA 4DMCA 2LP4Y 1N0IA 4CLOA 2W6NA 2HJRA 2BDUA 2GEUA 3PQ8A 3O3CA 1EBFA 3AILA 1I3LA 1YJ8A 3ZE0B 1QO9A 1X15A 1UBMS 5KAMA 1W0KA 4PR3A 4M86A 1Z5PA 2ZDGA 3DMPA 1JNYA 2OYCA 4LNHA 3MWKA 3TQFA 4BNTA 4ZEMA 2R00C 2D06A 2CY0A 2BKLA 4U1RA 1GPBA 4FQ5A 3RRXA 3IQZA 3LC7O 3HJFA 3RE1A 3RSQA 4GOLD 1NATA 4EY7A 1V16A 5CEFA 5H68A 1CDZA 2C4UA 2HJVA 1M6HA 2I6QA 4TMYA 1UBRS 4ZOBA 4R2MA 3TZBA 2HNBA 4E88A 2JVIA 2V45A 4UAGA 1KNQA 2NYUA 2XYRA 1E8DA 2OVBA 3GD5A 1JVBA 1G5QA 2HO5A 3L7OA 3RK1A 3OZIA 2ZTLA 4QPZA 2XQFA 2O0MA 5TQJA 4EI7A 5FUQA 2BM8A 1R4MA 2H3HA 2A1UB 4IIJF 3KZKA 3IAS1 5K0NA 2EFEB 1E7MA 2YVLA 3IP6A 4H0FA 3U3RA 4C87A 2PUEA 3GRCA 4P34A 3T41A 1K3UB 1NF3A 1IFXA 4I9UA 2XTNA 1AQIA 3KUCA 4WCFB 2A5DA 1T5HX 3ZYCA 3EGEA 1Z25A 1GGHA 4IUCS 4EA9A 4KK4A 1G18A 4RBNA 1CEEA 2PMWB 3CEPB 2XF2A 3TZHA 2JMLA 2CZCA 1ZISA 3MGBA 4M1MA 1AB5A 3OZBA 1L5ZA 3AU9A 2HRRA 1XGKA 2R65A 3K2BA 2WDZA 1X1AA 3NIDB 4I2NA 4UVEA 3VSAA 3BORA 3ZE9A 2AYXA 2XNSA 4D8VA 4RD6A 1JQ5A 4U2BA 1QDEA 1E58A 1QU3A 1K7EB 1UWVA 2NZUG 1MGOA 5TY0A 1BQEA 5C53B 3CZ9A 4WUVA 5A3SA 2QY6A 2DLDA 4JU8A 4PNZA 2UXDB 2QI9C 4F71A 1IN7A 1G8YA 2X8BA 4XDHA 3ZHCA 4DR6B 3I53A 1AKRA 3UUGA 3C3PA 1M1UA 2XMQA 1E2GA 1TNDA 1WMSA 2J3HA 3AJ9A 2PX0A 1E1LA 3DOEA 3FAZA 3H4TA 4JL6A 4CQJA 2VT7A 3IVRA 1T3HA 4BZXA 3DD5A 3OWOA 1O2DA 4URHA 4X8OA 2P8JA 3GXBA 1ADBA 1PD0A 4KYUA 3BE8A 4ISBA 3OJCA 4IAOA 2JRLA 3D6UA 2LXNA 1NASA 3AY3A 3K31A 4MYRA 4HZIA 1F12A 4CPDA 5C7LO 1TQDA 3COZA 4CCWA 4D1YA 5ADVA 4N0MA 3DNPA 2CXSA 3Q7IA 5F77A 3SX4A 1J33A 3C2QA 1EFAA 2UU9B 4INAA 2H4WA 4MR8A 2JFVA 3B3GA 4NE9A 1UJ5A 2QT1A 4UUQA 3QH4A 4RE6A 2V7UA 3C48A 1P5ZB 5EUCA 5LDHA 2W4QA 3I64A 1CRLA 2XB8A 4M99A 2YFKA 1E6KA 2BBSA 2GR9A 3RFCA 2BONA 1EFUA 5WRFA 1GL3A 2DFVA 4NK5A 4UUOA 1X86B 4BDSA 3BQ9A 1YMQA 4HO1X 4WN9B 3OESA 3MNFA 4KC0A 2EQAA 5C2JB 5C35A 5LYYA 4H7PA 2WAOA 2QUKA 4MJLA 1UQRA 2JCVA 2EZ9A 4QGFA 5IJWA 5HE8A 1RCFA 3GAMA 3T0GA 3O93A 3ICVA 1JSCA 4XX0B 2PX8A 4DY6A 4Q7EA 1H2AS 1GO2A 4TVSA 4QTXA 5J3JA 3EZXA 1MFPA 1R0CA 4G25A 2ODTX 1J8MF 3DXZA 3Q85A 5G0VA 1QHYA 2Q4RA 4LHXA 2B8WA 4OJNA 4BV3A 4F3CA 3K1YA 5K9ZA 1EXIA 2QSYA 2AXPA 3BM5A 1QSGA 5ALRA 2QF7A 4WY2A 1PR1A 2PG3A 4PS0A 3ROKA 1QNFA 4B5KA 4LMPA 5JI3E 2B7LA 3TQIA 4BHTA 4BU0A 1N5OX 1G1AA 1IAQA 2KSQA 1DQYA 4XWAA 1R0BA 4Y2HA 1LDBA 4N7BA 1WBDA 1N1MA 3E3NA 3EJ6A 2X1HA 1FSFA 1WD7A 1YS9A 3AC0A 1NBIA 2I80A 3U13A 4DA6A 4ZDJA 4XRRA 2SCUA 1U2GA 5F73A 2XBMA 2RAFA 2YXPX 1W4BA 4MYHA 1M67A 4U7TB 4L28A 3O8OB 5D7NA 2QU7A 4OQEA 3UATA 2PIAA 1VJGA 3ADOA 3V8RA 3VVCA 2BEWB 4NU0A 1P2TA 4GR5A 2AFRA 2R2AA 1AS3A 1NW9B 1A9PA 2WJJA 3Q7SA 4UOEA 4OG2A 4YRNA 3MUFA 1U6KA 3IBSA 5EWJA 3C3WA 1P2GA 2BRUA 4F45A 4U7GA 2EP8A 2Q3MA 2NUAA 4J1SA 3KOMA 1FEZA 2OCAA 3PCTA 2Y0PA 3IP5A 2G0TA 4HEQA 4TKMA 3AEUA 1I2BA 1S9DA 3Q3DA 2A35A 2GTPA 3DBOB 5TPZD 2Q4OA 2YW9A 4EGAA 1ACMA 1T2AA 2IIVA 3ONFA 1MJGM 2GBFA 1A8QA 3RRMA 5DNVA 3I5UA 1BNCA 3AKCA 1NZFA 1ISIA 5PGMA 3VC7A 3I2JA 3D9QX 1W9MA 3DKIA 2FPPB 4NY1A 3A10A 3I30X 4C4RA 4XW2A 1HFKA 3GCGA 8AT1A 4LQLA 1NULA 4WVLA 5KQRA 2BTQB 4GXNA 3OZFA 3GMTA 3RVBA 1FTGA 1LDYA 1B8UA 2WJWA 4PPGA 3DT9A 3V4SA 1ZD1A 4RFSB 2IXAA 2OORA 2DTDA 2FCAA 5AMXA 2C58A 3RKUA 5DN6A 3DNFA 4B45A 3O1LA 1PR9A 4E5YA 4OLJA 2HW8A 1DARA 1V71A 4RF2A 2XVXA 2PJZA 4E3WA 1MV8A 2FJPA 3ZGNA 1M34B 5J43A 3EWNA 4I7EA 4XQ9A 1YT5A 3QE4A 4BP8A 4KNWA 1O95D 4V0QA 4W5RA 3WKDA 4MUFA 4W5HA 3L5KA 5CT8A 3E5NA 3BZUA 3UBTA 1KYQA 4YRDA 2ZE7A 3A3OA 5DI3B 5ALWA 4PXSA 1U0FA 1FQWA 1IB0A 2E48A 4LGCA 5COBA 1NP6A 1ZW1A 3G59A 1KU0A 1RJFA 2WWYA 4EQZA 4EMTA 2EYUA 2GEJA 3KQHA 1J0EA 4ARUA 4A16A 2HOQA 3PXUA 5KTPA 5EGNA 2D6FA 2R8EA 2CLLB 3B6JA 5IKXA 1NMZA 2J09A 1TFRA 1F2TA 1WU8A 4FGJA 1VYTA 1H5QA 1VYHA 4KN6A 4AC9A 4AJJA 4CL3A 5BWOA 1ND5A 3GRUA 1T8PA 1U8ZA 4P54A 4ZA2A 2HH9A 2QUIA 2VYNA 5ECYA 3R7WA 3EODA 4ACBA 4M54A 2FG6C 1TIBA 1ZC3A 2VJQA 4D9CA 1K6MA 4QQRA 4AZ0B 1CEYA 3LPNA 2Z8XA 4M0CA 3JAWB 1I13A 1IZZA 1NFQA 4ND8A 3QWAA 3IR6A 3SQOA 4L4XA 4INJA 5J2TA 3RUDA 4CMJA 1UPCA 3INGA 1NRJB 1CUBA 1E9VA 4PBRA 3NHUA 4O2AB 4Y7DA 5EP4A 2B37A 5J1TB 2Q21A 2VYQA 3UAVA 3ZHXA 1B0AA 1VA5A 3U6BA 1J5EB 5KHAA 1U9YA 3FG9A 2GBLC 4FFOA 4G1FA 4KXNA 5GGYA 2DQKA 3RC7A 2NTEA 4L9AA 3RLIA 2KE5A 3VZPA 1IOZA 3GEBA 4YJ3B 2VHUA 2WWGA 3BMQB 1Q6ZA 1LWOA 1S6YA 1WKVA 5GOZA 3AR4A 2QR5A 1X9GA 2WK1A 1XMQB 1M6NA 1IN8A 1VRWA 1XLWA 4NBTA 3IL2A 2LKDA 2CK3A 1RLUA 2NO6A 4UBIA 4N40A 1DU4A 3AVYA 5JSZA 2C7VA 4J7AA 5JNRA 3OT1A 3LFUA 2OOSA 2DF8A 2QL6A 5DOVA 2PMCA 2XLBA 4ZODA 1W44A 1WPGA 1DBIA 2FQYA 4NX2A 4HL6A 3OKFA 4MW4A 4F56A 4A0SA 3O90A 2DKNA 5EE1A 3CMMA 4MKXA 4YRQA 3ETDA 1TAUA 4K6CA 1D1QA 4IG9A 3MCZA 1MC4A 2VCHA 2I3BA 1S02A 2OZKA 3UMRA 5I45A 2CCGA 3QX3A 1WEHA 2H1CA 4A7PA 4W8GA 4BQIA 4H7DA 3ROTA 4MO9A 4BP1A 1A95A 4JMLA 5LYJF 4MHSA 1U9IC 3TAXA 4DMUB 1UKVY 1D2CA 4ZT5A 1WUIS 3QLVC 1ZWLA 4QDZA 4MTLA 5ESDA 5B1DA 2P1RA 4NG5A 2GM4A 1TKAA 4LJ4A 3LRXA 1R5OA 3L07A 4ENWA 4DAOA 5TLSA 2KBFA 4JR1A 2DETA 1QX3A 4K9RA 3L8EA 1SCBA 5FB3A 1P9OA 3WLTA 1MTZA 4XXHA 3MWDA 1RFLA 4FD3A 4M1YA 4KG7A 3PIRA 3UB2A 2W6OA 4E3ZA 2FG7C 3R7DA 3QOYA 1AURA 4D0SA 3FYUB 2X58A 1N2JA 3ZKWA 4KZKA 1JPNA 1YU6A 5COAA 4MXDA 4Q3LA 4KKVA 5FCDA 1P2BA 4YS6A 3ZK9A 1P1JA 2TMYA 4DLBA 2EKZA 5J1SB 3V00A 4PVDA 4DLRA 3GLGE 2JIZD 3FWZA 1P8JA 1EP9A 3OO0A 4NJMA 5CX1B 1OH6A 1UFKA 4XCVA 5JXHA 3QYFA 2Q3JA 4HG2A 4NNPA 5HIJA 4MLPA 4D46A 2WSBA 4Q7JB 5CM9C 3TTVA 2JATA 1I94B 3FTDA 1QMGA 5A2QA 1H85A 1GUBA 4PAWA 4FEYA 1SKAA 1EFTA 3I04M 2QMZA 2Z83A 4IMRA 1EK5A 2O20A 3FYSA 3HVJA 6NULA 3R23A 4Q66C 3B60A 3QP9A 2B83A 3VGJA 2OO5A 1YVPA 4CR8A 3Q88A 4PZAA 5E4TA 4QE3A 5LQJA 2I4MA 1NM5A 3ZK7A 1J9EA 1W36D 2O3UA 2YXDA 3RREA 2WYVA 2DY0A 4M9SA 4MZXA 1NE2A 1E79A 1EDZA 5JSYA 4BWYA 4CMEA 4CJXA 1F48A 2QP3A 4RXUA 1GKUB 4NPHA 1C3LA 4OEHA 3VR4A 4DLSA 5LXTF 1N5JA 3U3MA 1OFGA 5DYTA 2MT9A 3KNZA 3WLHA 1D1SA 5T4HA 1PS8A 1ZUNB 3TKAA 4CLRB 2HFKA 3PQ3A 2NWQA 4X5OA 2YFYA 5LP6B 1E0SA 1CT9A 1T5SA 2W8BB 3LO8A 4U2EA 1K6XA 4PRLA 1LLFA 4BNIA 1ZR2A 5GJWC 4WCFA 3VR1A 2E87A 2BMFA 1AUPA 3FCSB 4L2IB 2AOTA 5DIFA 4FGLA 5B64A 4L8WB 2IBTA 3A9RA 1V5IA 3TX6A 1ZNWA 4KV9A 3DQPA 1PZEA 1HKUA 4YWJA 4BQQA 4EY5A 4NI5A 1UJ6A 2DT5A 2OV6A 4I3FA 4D44A 5BSGA 3BAFA 4AD8A 3FF1A 4YMUA 2C95A 2G5TA 3DKPA 4UU8A 1Z6TA 5CB4F 4AY2A 2IHJA 2ORYA 5J5VA 4GDMA 4BJ5A 3BWMA 1UFRA 3P5SA 4M1TA 2I4OA 5DXJA 4CTNA 1C80A 2FHSA 3D2LA 5EC8A 4C29A 1D0SA 2ZBVA 4O3FA 5JTTA 4DSAA 4R6XA 1FXWA 3CWQA 3VZRA 3QVSA 4U2FA 1NMQA 4I46A 1PW5A 4UBJA 5DMHA 2XOEA 3ISTA 4Q6BA 4L73A 1Z28A 1VJCA 4DDHA 3IUQA 3EGXA 3X2SA 1I32A 2I3ZA 1K88A 1JHXA 1OYVA 4QFMA 5DRTA 1X2EA 5E7MA 2XB2A 1LTHR 3JRXA 3MTJA 5F35A 5IJ0A 4AQYB 1COWD 4ZXFA 1OKKA 4KOEC 1HI9A 1PX0A 5E4YA 1H8ED 5C5EA 3R9WA 5AT1A 1Y6UA 2F3TA 4DJDC 1HYBA 2AN5A 3O3NB 4TT3D 1Q3HA 3UKDA 1Y5MA 2VTDA 2XUFA 3K9NA 2XCRB 4OQNA 5DCWA 3V42A 5JCJA 2WT4A 1CUHA 1KYZA 1NNUA 3A3NA 2QTAA 4HLDA 9LDTA 1SB9A 1Q0TA 2CUKA 2H5IA 4H6PA 3K9FC 2RJ3A 3FXAA 3HUEA 1SIWA 1ZH6A 1CLUA 4HC4A 3B36A 4GYWA 4WN9A 1GAXA 4XTCS 4KTVE 2OV4A 1MQ9A 1WXEA 4R83A 5AI4A 1M7BA 4CCYA 3ED1A 2I7XA 1N2BA 1LPOA 4HWPA 4CUJA 1DWUA 3TOCA 1H1LB 4QUBA 3RKRA 4S05A 2H59A 4CV0A 1GFIA 5EWLA 1SVSA 1FZQA 4G3XA 4F5ZA 1R9MA 3WGMA 4WK0B 3LCVB 2YFHA 3KKNA 3UV3A 3MB5A 3OJLA 3RSFA 3A1WA 1D7OA 3PDUA 4G24A 1TZJA 1HDYA 4HH3C 1Z68A 3FTCA 3ZY2A 4JI4B 1BHSA 1DX6A 2PZ8A 1PU2A 3LX5A 1OX4A 2O8FB 1TE2A 1GWNA 1R10A 3L0SA 1AUOA 5G40A 3RVQA 3E58A 2VQ6A 3W2GA 4G09A 1PQYA 3STWA 4QLAA 2J3LA 3UH1A 2J6BA 5E3JA 4ZTZB 1Q17A 2A1TR 2GTHA 2EU8A 3L8MA 4X0EA 2ASEA 2H51A 4Z86A 3B1XA 1O77A 3QUTA 1FP2A 3SFZA 3X43A 4CQLA 2Q0HA 4F5YA 4TLDA 1JKXA 1EFLA 3DBRA 4ZVVA 4D8TA 1JHRA 1G2QA 2ZB2A 2WDPA 1XD9A 2BGLA 2G1PA 3IV9A 1KVQA 3SC2A 3REQB 3TNJA 3VH4A 1MEEA 1UOPA 4ZDIA 1ZOPA 2QM3A 4IPTA 4YXFA 5KOJB 2PUBA 1L5QA 2W83A 4G26A 1M54A 1SO8A 1C41A 2B4KA 4QBGB 4PYIA 1SK8A 1YC5A 1WZNA 3DTVD 3P1JA 3DMNA 1X94A 2WHEA 3R40A 2O54A 1XQ1A 1AXGA 1SVWA 2BY4A 3OBIA 4ES6A 2WKWA 5T4FA 2DC1A 3RU2A 2B1IA 2GO7A 4DG8A 1P29A 1N8TA 4CIDA 8GPBA 5JHHB 1OLSA 1QYDA 4EL5A 3ZU6A 3HZHA 1OTHA 4O2AF 1H0HA 2Q5LA 4XGIA 3G79A 3ZWPA 3CRZA 3UJHA 2H1RA 2OKCA 2UUCB 2IIQA 3IMFA 3W2HA 1M66A 4IILA 1DKNA 4MLCA 1UBSB 3BWDD 2HEIA 4R69A 3Q1LA 1QS0A 3K1AB 3FPSA 1EDEA 1EM8B 2GM5A 2CLFB 3AB8A 3CIFA 3KR0A 2CZQA 4DRXA 4RJJA 1L7DA 1RDFA 3ORQA 4WJZA 5D8CA 3ESBA 1E9CA 2W9XA 3USES 2QQEA 5B7GA 5JXGA 1ECFA 5EHZA 1GTSA 3OQ6A 2JPDA 1E0DA 1VB3A 1MT3A 5THKA 1II8A 3VO1A 3CJRA 1VOTA 2AG1A 4JC8A 3TQRA 1KFKB 2JAXA 3H3JA 1C29B 3I01M 3DJYA 4HH4A 4CEIB 3D0QA 3REOA 1Z2DA 1E2KA 5BOSB 2DE0X 2O2GA 2DECA 3A36A 3FH0A 5LU8A 1EP1B 3SJBA 3VYRB 3IT3A 3UAWA 1ZCJA 1IAVA 3CLVA 3IO5A 3U60B 5CNKA 3CNBA 3RBAA 4UHFA 4UUBA 1XHEA 4QXRA 3RVRA 2GK4A 1HWYA 1R9GA 2AOWA 4E30A 2BGIA 4WFQA 1U0SY 4MVJH 1AO0A 1S4MA 2PYZA 1OQAA 1NBOA 4RH1A 1ZOOA 1EPUA 3H2JA 1SMKA 1K7YA 1ZSYA 1YBFA 2IHTA 1N5LA 3KPWA 3GEMA 3C16C 4MARA 4OQFA 5K3FA 3S44A 5DI3A 7REQA 3IBYA 1WF3A 1HETA 3R3ZA 3W5BA 3KB6A 1JE0A 3OSZA 4NMMA 5EOVA 2GCNA 2VPIA 2XUJA 3B8EA 5C0OE 1C8KA 5DXAA 2O0JA 4WLNA 4DMRA 3MWYW 3RT7A 3S70A 4EHNA 5JH7B 3PYLA 4CIYA 4RULA 1H6BA 4DLTA 3QU7A 2IRWA 4N49A 4B3IA 3JALA 2CHEA 2FGKA 4BO6A 5M7EA 3JWEA 1MIHA 1O6CA 4ZT4A 1DRWA 3JZAA 4RPHA 7GPBA 2GCOA 2X1MA 1VKHA 1RWOA 5ITWA 5IUJC 4ABYA 3ZW9A 3ZHTA 4ZVKA 1SGWA 4OYHA 2H7VA 3BYZA 3PFFA 4N03A 4O25A 2WB2A 3C6BA 4J8PA 4JJ6A 1NXOA 5DTRA 3CVWA 3Q5RA 3BUSA 2D1RA 3LW7A 4W8OA 1XE3A 4GRDA 4KYIB 4NS4A 4N0QA 4WESA 2LRHA 2O5EA 5F7OA 1ES9A 2VDKB 2QAGC 2BGWA 2BJHA 1MC1A 1UAYA 1MP0A 2EFDB 4DR7B 5F9FA 1U2GC 4DSTA 2YNMD 3GU3A 2RI6A 3KB1A 3P2YA 1OXTA 4C4TA 3BMQA 3OLYA 3V8BA 5JXWA 5L4SA 3CBQA 1DP4A 3B3JA 3P9NA 1ZJYA 4IJWA 4KTTE 2V5VA 4NU5A 1IOWA 2NQ2C 3HYRA 2O7RA 3K4PA 3C14C 3DP9A 3PUXA 5AH0A 3CINA 3PFNA 2X5JO 3PRJA 1TZMA 4X1IA 1E60A 1UAAA 2F4VB 2AEEA 3FGOA 3W2TA 2WD7B 5GJBA 1C3XA 2I33A 2IHBA 2ZG6A 4MW2A 4PCAA 1CZLA 1N7JA 1ZCZA 3G23A 4OF4A 3MFQA 1ZIYA 3IMGA 1GEGA 5G02A 2A14A 3X44A 1MHPA 1A9XA 2JVKA 4B71A 1ID1A 3DFUA 4ABTA 1CJKC 1FFGA 2IUYA 5LP6F 3VH2A 4U9IS 1XXHB 2P2NA 3VX4A 4B85A 5K5EA 1R18A 1ZWKA 2QMQA 2XBLA 3PFHA 4NBNA 1SG6A 5H5JA 5EJ6A 1FSSA 4M2LA 2NO1A 4GVXA 4CETA 2QTWB 1V4VA 2VEOA 3STUA 5ENZA 2WPNA 1UAGA 4Y6QA 1KOGA 1Y8QB 1IZ8A 2IL1A 5LCXA 1Q12A 2ZQYA 1V6AA 1TOAA 2JHPA 4G1BA 1BVUA 1VIYA 2B25A 3WL6A 1Y48E 4YT4A 4EO7A 4K9MA 2SNIE 3JQRA 1A97A 1JDPA 4OO3A 3WLFA 4L4ZA 2C9CA 2VZ9A 1R2QA 3K70D 2WG0A 2POQX 4K28A 3DPUA 4QDJA 3D8RA 2RGBA 1O87A 4B7AA 5F64A 1EUCA 5LZ7A 1Z2OX 2Y1CA 4IKOA 4A1FA 3KCNA 3PIIA 1KYWA 1QCCA 4TL6A 4TKVB 2AIRA 1G38A 2EGGA 2ZEJA 4LAFA 5DULA 2I6UA 1BGXT 4F5WA 4HP8A 1MO5A 2EZTA 1Y7TA 1Z62A 3ITEA 3DWIA 5K09A 2VBGA 3RTDA 2C7GA 3HUFA 3EZNA 2HA7A 4JSYA 4IGEA 1QX4A 1TCUA 2FV8A 3BL8A 4OI2A 4GD3Q 5BWCA 2CMGA 4FFRA 4B80A 3TZQA 2BUAA 1ZIOA 2G5PA 2IZ7A 4ZOLB 3UJCA 1UL1X 3M4NA 5IZCA 1B2LA 1T3GA 4PICA 4JQCA 3DL7A 4AJEA 3ZLTA 1CJMA 4MRAA 1H1DA 4FEAA 4L5AA 2AFVA 4PINA 1DADA 2VZ8A 4QRIA 4V24A 2GPJA 1JFRA 3TW6A 1ZEJA 4PX3A 3Q2IA 2PCJA 3D0OA 3UXMA 2GXUA 3P26A 1ETHA 1ORIA 1RWBA 1ZJ5A 2AJBA 4R1OA 3LQRA 1FTSA 2JFPA 1C3VA 1VIDA 1I1QB 4FYYA 1A1SA 1PJQA 5J4KA 4H08A 2WSLA 3ABOB 2FX5A 1NZDA 1VRVA 3KSZO 4JGIA 5DBEX 4HTFA 3CLHA 4IDAA 4CTOA 2XB9A 3GLGB 1N9ZA 2BHSA 4Z0NA 1J2RA 4BB5A 3HO8A 1AGYA 3D7KA 3HWWA 2D4HA 5DNCA 3RK4A 5AJYA 5IS2A 3QPWA 4V0SA 4D3XA 4EJSA 1SA0A 3JTMA 1VCHA 1E6CA 2NUTB 4TV9A 2ZCJA 5AVSA 4EYKA 4JXXA 3C8UA 2YDYA 4MW6A 4ONEA 5K8CA 1GGVA 5KNCH 1L8QA 4C4AA 4AWBA 2P2YA 2O2DA 1AE1A 4R8MA 4B3SB 4EGCB 4DCTA 2DQYA 4TMFA 1Y4DE 2WUFA 3QBEA 3NAZA 5HM8A 2XNKA 3ESQA 5JJBA 2I2WA 2QDXA 3ESYA 1RYYA 3HZRA 3MPUA 3MWFA 4B79A 1NJ2A 1SWWA 4D6PA 1RXYA 2X5OA 4FPXA 3VU9A 4M83A 5LA6B 4EI8A 4I9NA 1IJEA 2XVAA 1Q16A 4G0MA 1U8UA 4MVYA 3II6X 2FE1A 2E82A 4RKQA 5LBUA 3UO8B 1WXIA 1FYXA 1FU8A 1U5AA 1ZLXA 2PUVA 3ABQB 2CDRA 3FDXA 3GWGA 3NUGA 5K05A 2PXXA 3WBFA 1QQBA 3E9CA 1JLLA 3SN6A 4YDHB 2W6PA 2SBTA 3COWA 3LCJA 5AKLA 4FDLA 5I9MA 1KKMA 1CRWG 4Z99A 5LZ8A 4MEBA 5KYUB 1W0JD 5KSPA 2UYOA 1CQIB 1GTVA 4IJ6A 2IUFA 4PAOA 1SUSA 3Q3CA 1N77A 3PHIA 3ZVLA 1FB5A 3B53X 1UZAA 3K6JA 1YUNA 4Z9XA 3RSCA 5CBPA 3W8FA 4P4LA 1BGVA 1JG1A 3QYPA 4BLPA 2X9GA 2CLIB 5BN5B 4XLLA 1WO8A 3HU1A 3B20A 4CLXA 1HYGA 5DP1A 4TROA 1CC1S 4RVFA 2NP6A 2WSSA 1KDVA 4NCXA 2ZKLA 3P2EA 2ZSHA 4JKIA 4KVAA 5L3QA 3WL8A 1TO6A 1XCLA 3K4QA 4B7ZA 1G8PA 4PQFA 4RORA 1Q05A 4IZHA 2CL5A 4PM4A 4XEUA 4PIVA 5E2IA 3I23A 3LZ6A 3SHWA 2O3RA 3ZCTA 1QIJA 1NVUQ 1XROA 3EOZA 1O0CA 4UUPA 1XFDA 3FPAA 4B83A 4CKWA 4BE9A 1HLPA 5EQDA 4JP5A 3FKJA 3O8DA 1B3RA 3RSSA 1R0KA 5JJ5A 1K8XB 5DM0A 1KXZA 4I1OA 1SD5A 4DLLA 3HYCA 3IEVA 3QM1A 3S7ZA 4CBVA 1KPIA 5CEJA 1W46A 1XLTC 5E1BA 4B8WA 2IKQA 2OO5C 3V7FA 3VX3A 4NAUA 4PCVA 1OXMA 2GT1A 1F0PA 1A8HA 1MB2A 2OV2A 4IS3A 4BO5A 3NVKI 3I6BA 4C0HA 4IWXA 4E09A 4EMBA 3RABA 2FQQA 1TD1A 1II0A 1JZQA 3V80A 1JBEA 2WQZA 2XRFA 2BTEA 1U81A 3HN7A 2QI9F 1K5GA 2F9MA 4CMEC 1G64A 3SY8A 2HUNA 2FQ1A 2QX6A 2JDIA 5A0VA 2PUCA 2FPMA 3NHPA 3AUXA 1T6ZA 2IHYA 1D4AA 2P0AA 5THXA 3ZEIA 4A03A 1DV1A 3BIFA 2P2CA 1WUHS 3ND6A 5HA5A 4YREA 4II2A 3FPJA 4KMSA 2IEIA 2RKWA 1LBEA 3GQBB 2JH8A 4KDEA 4Q03A 4YP6A 2GK6A 4YHHB 3GLFA 2J0EA 2AD5A 4EW2A 1LX8A 1UZLA 3KFLA 3WBBA 5I8WA 2FR8A 4JOSA 4IX9A 2J7PD 2ZRCA 2E7ZA 1KIMA 1R6DA 1J1ZA 4H3HB 4R16A 5H83A 3VHXA 1UK7A 3T1HB 5ALNA 5AOVA 4JB0A 5GM2A 1IM2A 4HB3A 4C0LA 5IJ9B 4OLAA 3PC8C 4MVXA 2ERXA 5JAOA 4HK4A 3KZMA 2CBZA 3ANSA 4ZC8A 2GAJA 1RC1A 5JADA 2CV2A 1VLZA 4D9JA 4DPKA 2X13A 3BS4A 2G5GX 2O23A 2OG1A 3VC3A 1WCWA 1YDWA 2VJAA 3PDIA 1OAOC 1OI7A 2QQFA 2YIMA 4D8UA 1JLKA 3DDCA 2LNDA 2BMDA 2HPZA 3K4HA 1YHNA 3L7CA 4ER7A 6YASA 3V55A 4UAJA 5EJ5A 4TWBA 4TRNA 1KDPA 5IHPA 4LYAA 3KT0A 2WWXA 2HLHA 2WUGA 1P44A 5KYWB 2VI5A 3SI7A 4XGRA 1MQSA 2P9GA 1J90A 3T12A 1YQUA 4QDOA 4L22A 3VKWA 2WQ6A 2O8DB 1GJRA 1ZNZA 1QV6A 1X7ZB 3LGSA 3KR2A 3NH6A 1MVOA 3T8YA 4ZI7F 4CEIA 4BV2A 5AW3A 1PEAA 1Y1PA 2LPMA 2D1YA 1KO4A 2QV7A 2Y0EA 1ECPA 3I45A 3NB0A 4HMOA 4LY6A 4RAQA 2OMEA 3UC9A 4QGSA 4F2DA 121PA 1R0LA 2F8LA 2I03A 1Q09A 2AOVA 2NZVG 3I2HA 4C88A 2FN3A 3SE7A 3SE0A 1CW2B 2VNKA 4UFOA 4V0RA 4D9EA 2EZ4A 4BKRA 1H2WA 2Y0DA 3GARA 5B1YA 4W5TA 1GSHA 1JQKA 1YQDA 1J8YF 2FKAA 5IYZA 2B8NA 4FFLA 3FOFC 2C07A 1KNXA 3QBJA 4PG4A 4G0NA 1KSHA 1J2JA 1ENOA 1PJLA 2ON6A 2QSZA 3BCSA 4FYPA 4HVAA 4RETA 1E2IA 3IJPA 1QP8A 2YV2A 2C83A 4HS9A 5U1PA 3UV6A 1L4KA 3G2QA 2ONZA 1J5XA 1UXKA 1MA0A 1FUKA 2YV4A 3OU7A 3EUAA 3QVVA 4RL4A 3WHPA 1QG6A 2RHLA 1JQEA 3FYDA 3UYLA 3BGSA 4WDRA 2ZBUA 1VPLA 3DBVO 3WLPA 5IAJA 3LS2A 3UTCA 3V2HA 5B7NA 1VSQA 2QRUA 3BCUA 3IVGA 5FEUA 2H17A 4KQGA 2GEVA 4RMNA 3CZCA 2DFKB 2P3OA 5BSKA 4O3MA 1OAKA 3P2MA 3ROXA 4IM7A 3P0IA 1QMPA 2WNHA 1N0HA 2NACA 4INPA 4Q9DA 4M7OA 5KX5B 3IEMA 1E59A 1LW6E 4J2NA 1BXZA 1E6WA 2J3KA 3A6DA 4GKVA 5HW0A 4TL8A 3SYMA 3N58A 1A76A 1U4SA 3UAOA 1BKSB 5I7EA 3EGDB 1SQ6A 2N1BA 3G8CA 1JDSA 3P52A 3B38A 3SZGA 1SQ0A 1K8RA 1H1TA 1IHOA 1T0JB 1NT4A 3UKJA 3O0TA 3ZWBA 1ODLA 2JA1A 2VNSA 4E5VA 4BCCA 3PHHA 4BE4A 2HYIC 3F96A 5CT9A 4IF6A 5LMNB 1GR0A 4DE5A 2F64A 4JYAB 1WB5A 2J9YB 1P1RA 3MRXA 1L4FA 3FSGD 4DQLA 1JRLA 5CG2A 2GF9A 2RJNA 4JJEA 2OBFA 1U8AA 4OXYA 1W73A 4W6QA 2AOUA 1YIDA 3NHJA 3CKKA 2WJIA 4MJ7A 1CUJA 4V0OA 1WB9A 3BDVA 3D8UA 4J0QA 3VOSA 3EAGA 1V3VA 4KDRA 4CM9A 4RVUA 4F1WA 5AFSA 4YMLA 4GWGA 3CXRA 5LDGA 3ZWDA 5JFGA 1LH0A 1XXHA 1I80A 3OOWA 5FBKA 5JLAA 2C9YA 4NNJA 5AUPB 4D9IA 3U80A 1PJ3A 4FOTA 3LDUA 5IU6A 5L3SB 1WTAA 1CCWA 3BHIA 3PGKA 3HFJA 2F9FA 1E3WB 2KPOA 2R8RA 2HQBA 2EG9A 4L9SA 2JJ2A 4JOCA 1H4SA 3WAJA 2XZPA 1A8SA 4IHJB 3U17A 1SVUA 2DAPA 1GHTA 4YI5A 1X6VA 3T3OA 3VKHA 2QQ0A 1OCEA 2SICE 2B34A 4UW9A 4OX9Y 2HJGA 4LYHA 5LBIA 4XD2A 3PP8A 1ZGBA 2IXEA 2AX4A 1P4HA 4A23A 4XDZA 3ETEA 3BULA 3TZ6A 3V4RA 2ZRBA 3PG5A 2PAAA 4HLQB 1U28A 5LA6F 4EHBA 1VE5A 3IR7A 4URWR 1XTVA 1E6MA 3PVCA 2O8BA 3RIYA 4RVDA 5F1YA 1FUYB 2MSKA 5JRJA 3TTXA 2JHCA 2R7AA 1TK3A 3F6BX 4YFVA 3ZDYB 1XVUA 2VJMA 3C43A 2FPWA 2XGOA 1GYPA 1VHDA 5IVPA 2PH3A 4K8OA 1XNQB 1XHFA 2HK6A 2I62A 2O3QA 5HJ7A 4Q82A 3K71B 1WPQA 4K8RB 4ZOLA 3R8CA 2I6GA 4U7PB 3R6WA 2F62A 4HLNA 2AI1A 2B4AA 3PUZA 1BU5A 1Z38A 2ILTA 4PC3A 3M6AA 4X1YA 3RYFA 1SB8A 1DQZA 5FA6A 2H6EA 2ZS7A 3N8HA 1X8LA 4W4TA 5BR8B 3PL1A 1TUGA 4LZAA 4W1PA 2LD4A 2QZSA 4F85A 1LB1B 3FSJX 4GPBA 3A6EA 1FRVA 1SOMA 1HORA 3ZUGA 3ZNOA 1XTPA 3CY6A 3ZU4A 4DPMA 1OXKB 1SCDA 1U80A 5B1EA 2UKDA 1OH5A 2BKEA 1D2MA 1I4TD 1T4BA 2X4GA 1KR5A 3CZPA 4MQMA 2GF0A 1JB9A 1I0IA 2A92A 1L2TA 4FMDF 4JVNA 4MUJA 2YY5A 4Z8YA 3LPMA 2D0PB 5CITA 3MK31 5F33A 4YONB 3ERCA 1W88B 5E9QA 1U2ZA 3PRYA 4PS1A 4MUXA 1BG6A 2E4WA 4IUYA 5C31A 1MOQA 4XPZA 3WNCA 4AG6A 1E7QA 3ZW8A 2CNOA 2EL7A 4F93B 1U7UA 4W9MC 2AHRA 3J80A 4IOKA 3UG7A 2V3VA 4TTVA 3DLAA 4AJLA 5IULC 1G9TA 1SUWA 4TL9A 3CN9A 2YIVX 3I0ZA 2HEGA 2NU6A 2NUTA 1XO1A 3ILSA 2BZSA 1E2LA 5IYZF 2V6FA 3SNHA 5CA0B 3JWGA 4I1YA 1TA9A 3WRYA 2DR0A 1YFLA 1AN9A 3CUKA 4HXGA 4ZU1X 1ONOA 3E9MA 2Q3EA 2P0YA 3ISVA 5DYGA 1EVEA 2H2WA 4EJMA 5JD4A 3KZNA 2Z2JA 4QHSA 1CQJB 1F0KA 2R96A 4QBKA 3C3CA 1Z45A 4UZEA 1UJCA 5BQPA 4LPSA 4LJ8A 4DABA 4D25A