4CS5A

Crystal structure of pcna from litopenaeus vannamei
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
255
structure length
255
Chain Sequence
MFEARLVQGSLLKKVLEAIKDLLNEASWDCADSGIQLQAMDNSHVSLVSLNLRAKGFDKYRCDRNLIMGMNLTSMSKILKCAANDDIITMKAQDNADTVTFMFESPNQEKVSDYEMKLMNLDQEHLGIPETDYACVIKLPSGEFARICRDLSQFGESIVIACTKEGVKFSAAGDIGTANIKLAQTSSVDKEEEAVVIEMQEPVTLTFACRYLNMFTKATPLSPQVSLSMSPDVPLVVEYAIGEIGHIRYFLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords PROLIFERATING CELL NUCLEAR ANTIGEN
publication title Crystal Structure of the Shrimp Proliferating Cell Nuclear Antigen: Structural Complementarity with Wssv DNA Polymerase Pip-Box.
pubmed doi rcsb
source organism Litopenaeus vannamei
total genus 52
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4cs5A00
2ZVWA 3GPMA 5E0VA 3VKXA 1PLRA 4TR6A 3AIXB 3LX2A 1GE8A 3GGRC 3GPNA 1T6LA 3GGRA 4ZTDA 1U76A 5JNED 2ZVLA 3I2MX 1DMLA 5A6DA 3A1JA 2AWAA 3AIZC 3V62B 3AIZA 3IFVA 3WGWA 1RXZA 4RJFA 1VYMA 2OD8A 5IWDA 2IZOC 5IY4A 1RWZA 3K4XA 2NTIB 3HSLX 3P87A 3HI8A 3U5ZF 1UL1A 2HIKB 1U7BA 4L6PA 3A1JC 2IX2B 3FDSD 2IO4B 5AUJA 2ZVMA 3V60B 3U60F 1UD9A 3A2FB 1AXCA 3LX1A 2HIIB 4L60A 4D2GA 2IJXA 3AIXA 1IZ4A 2ZVKA 5CFKA 1W60A 5IXAA 3FDSC 5DA7A 2IX2A 1IZ5A 1VYJA 2IO4A 5E0UA 2AVTA 2ZVVA 3U61F 5E0TA 3P91A 5H0TA 3G65B 3TBLA 3V61B 1CZDA 5HACA 2HIIC 2NTIC 2HIIA 4YHRA 2NTIA 2Z0LA 4HK1A 2IZOB 1PLQA 1SXJF 1B77A 4CS5A 1B8HA 1ISQA 1RXMA 3P83A 3F1WA 3GGRB 5DAIA 2HIKC 2HIKA 2IX2C 3G65C 1YYPA 3G65A 5B7OA 3A1JB
chains in the Genus database with same CATH superfamily
2ZVWA 3GPMA 5E0VA 3VKXA 1PLRA 4TR6A 3AIXB 3LX2A 1GE8A 3GGRC 3GPNA 1T6LA 3GGRA 4ZTDA 1U76A 5JNED 2ZVLA 3I2MX 1DMLA 5A6DA 3A1JA 2AWAA 3AIZC 3V62B 3AIZA 3IFVA 3WGWA 1RXZA 4RJFA 1VYMA 2OD8A 5IWDA 2IZOC 5IY4A 1RWZA 3K4XA 2NTIB 3HSLX 3P87A 3HI8A 3U5ZF 1UL1A 2HIKB 1U7BA 4L6PA 3A1JC 2IX2B 3FDSD 2IO4B 5AUJA 2ZVMA 3V60B 3U60F 1UD9A 3A2FB 1AXCA 3LX1A 2HIIB 4L60A 4D2GA 2IJXA 3AIXA 1IZ4A 2ZVKA 5CFKA 1W60A 5IXAA 3FDSC 5DA7A 2IX2A 1IZ5A 1VYJA 2IO4A 5E0UA 2AVTA 2ZVVA 3U61F 5E0TA 3P91A 5H0TA 3G65B 3TBLA 3V61B 1CZDA 5HACA 2HIIC 2NTIC 2HIIA 4YHRA 2NTIA 2Z0LA 4HK1A 2IZOB 1PLQA 1SXJF 1B77A 4CS5A 1B8HA 1ISQA 1RXMA 3P83A 3F1WA 3GGRB 5DAIA 2HIKC 2HIKA 2IX2C 3G65C 1YYPA 3G65A 5B7OA 3A1JB
chains in the Genus database with same CATH topology
2ZVWA 3GPMA 5E0VA 3VKXA 1PLRA 4TR6A 3AIXB 3LX2A 1GE8A 3GGRC 3GPNA 1T6LA 3GGRA 4ZTDA 1U76A 5JNED 2ZVLA 3I2MX 1DMLA 5A6DA 3A1JA 2AWAA 3AIZC 3V62B 3AIZA 3IFVA 3WGWA 1RXZA 4RJFA 1VYMA 2OD8A 5IWDA 2IZOC 5IY4A 1RWZA 3K4XA 2NTIB 3HSLX 3P87A 3HI8A 3U5ZF 1UL1A 2HIKB 1U7BA 4L6PA 3A1JC 2IX2B 3FDSD 2IO4B 5AUJA 2ZVMA 3V60B 3U60F 1UD9A 3A2FB 1AXCA 3LX1A 2HIIB 4L60A 4D2GA 2IJXA 3AIXA 1IZ4A 2ZVKA 5CFKA 1W60A 5IXAA 3FDSC 5DA7A 2IX2A 1IZ5A 1VYJA 2IO4A 5E0UA 2AVTA 2ZVVA 3U61F 5E0TA 3P91A 5H0TA 3G65B 3TBLA 3V61B 1CZDA 5HACA 2HIIC 2NTIC 2HIIA 4YHRA 2NTIA 2Z0LA 4HK1A 2IZOB 1PLQA 1SXJF 1B77A 4CS5A 1B8HA 1ISQA 1RXMA 3P83A 3F1WA 3GGRB 5DAIA 2HIKC 2HIKA 2IX2C 3G65C 1YYPA 3G65A 5B7OA 3A1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVW A;  3GPM A;  5E0V A;  3VKX A;  1PLR A;  4TR6 A;  3AIX B;  3LX2 A;  1GE8 A;  3GGR C;  3GPN A;  1T6L A;  3GGR A;  4ZTD A;  1U76 A;  5JNE D;  2ZVL A;  3I2M X;  1DML A;  5A6D A;  3A1J A;  2AWA A;  3AIZ C;  3V62 B;  3AIZ A;  3IFV A;  3WGW A;  1RXZ A;  4RJF A;  1VYM A;  2OD8 A;  5IWD A;  2IZO C;  5IY4 A;  1RWZ A;  3K4X A;  2NTI B;  3HSL X;  3P87 A;  3HI8 A;  3U5Z F;  1UL1 A;  2HIK B;  1U7B A;  4L6P A;  3A1J C;  2IX2 B;  3FDS D;  2IO4 B;  5AUJ A;  2ZVM A;  3V60 B;  3U60 F;  1UD9 A;  3A2F B;  1AXC A;  3LX1 A;  2HII B;  4L60 A;  4D2G A;  2IJX A;  3AIX A;  1IZ4 A;  2ZVK A;  5CFK A;  1W60 A;  5IXA A;  3FDS C;  5DA7 A;  2IX2 A;  1IZ5 A;  1VYJ A;  2IO4 A;  5E0U A;  2AVT A;  2ZVV A;  3U61 F;  5E0T A;  3P91 A;  5H0T A;  3G65 B;  3TBL A;  3V61 B;  1CZD A;  5HAC A;  2HII C;  2NTI C;  2HII A;  4YHR A;  2NTI A;  2Z0L A;  4HK1 A;  2IZO B;  1PLQ A;  1SXJ F;  1B77 A;  4CS5 A;  1B8H A;  1ISQ A;  1RXM A;  3P83 A;  3F1W A;  3GGR B;  5DAI A;  2HIK C;  2HIK A;  2IX2 C;  3G65 C;  1YYP A;  3G65 A;  5B7O A;  3A1J B; 
#chains in the Genus database with same CATH topology
 2ZVW A;  3GPM A;  5E0V A;  3VKX A;  1PLR A;  4TR6 A;  3AIX B;  3LX2 A;  1GE8 A;  3GGR C;  3GPN A;  1T6L A;  3GGR A;  4ZTD A;  1U76 A;  5JNE D;  2ZVL A;  3I2M X;  1DML A;  5A6D A;  3A1J A;  2AWA A;  3AIZ C;  3V62 B;  3AIZ A;  3IFV A;  3WGW A;  1RXZ A;  4RJF A;  1VYM A;  2OD8 A;  5IWD A;  2IZO C;  5IY4 A;  1RWZ A;  3K4X A;  2NTI B;  3HSL X;  3P87 A;  3HI8 A;  3U5Z F;  1UL1 A;  2HIK B;  1U7B A;  4L6P A;  3A1J C;  2IX2 B;  3FDS D;  2IO4 B;  5AUJ A;  2ZVM A;  3V60 B;  3U60 F;  1UD9 A;  3A2F B;  1AXC A;  3LX1 A;  2HII B;  4L60 A;  4D2G A;  2IJX A;  3AIX A;  1IZ4 A;  2ZVK A;  5CFK A;  1W60 A;  5IXA A;  3FDS C;  5DA7 A;  2IX2 A;  1IZ5 A;  1VYJ A;  2IO4 A;  5E0U A;  2AVT A;  2ZVV A;  3U61 F;  5E0T A;  3P91 A;  5H0T A;  3G65 B;  3TBL A;  3V61 B;  1CZD A;  5HAC A;  2HII C;  2NTI C;  2HII A;  4YHR A;  2NTI A;  2Z0L A;  4HK1 A;  2IZO B;  1PLQ A;  1SXJ F;  1B77 A;  4CS5 A;  1B8H A;  1ISQ A;  1RXM A;  3P83 A;  3F1W A;  3GGR B;  5DAI A;  2HIK C;  2HIK A;  2IX2 C;  3G65 C;  1YYP A;  3G65 A;  5B7O A;  3A1J B; 
#chains in the Genus database with same CATH homology
 2ZVW A;  3GPM A;  5E0V A;  3VKX A;  1PLR A;  4TR6 A;  3AIX B;  3LX2 A;  1GE8 A;  3GGR C;  3GPN A;  1T6L A;  3GGR A;  4ZTD A;  1U76 A;  5JNE D;  2ZVL A;  3I2M X;  1DML A;  5A6D A;  3A1J A;  2AWA A;  3AIZ C;  3V62 B;  3AIZ A;  3IFV A;  3WGW A;  1RXZ A;  4RJF A;  1VYM A;  2OD8 A;  5IWD A;  2IZO C;  5IY4 A;  1RWZ A;  3K4X A;  2NTI B;  3HSL X;  3P87 A;  3HI8 A;  3U5Z F;  1UL1 A;  2HIK B;  1U7B A;  4L6P A;  3A1J C;  2IX2 B;  3FDS D;  2IO4 B;  5AUJ A;  2ZVM A;  3V60 B;  3U60 F;  1UD9 A;  3A2F B;  1AXC A;  3LX1 A;  2HII B;  4L60 A;  4D2G A;  2IJX A;  3AIX A;  1IZ4 A;  2ZVK A;  5CFK A;  1W60 A;  5IXA A;  3FDS C;  5DA7 A;  2IX2 A;  1IZ5 A;  1VYJ A;  2IO4 A;  5E0U A;  2AVT A;  2ZVV A;  3U61 F;  5E0T A;  3P91 A;  5H0T A;  3G65 B;  3TBL A;  3V61 B;  1CZD A;  5HAC A;  2HII C;  2NTI C;  2HII A;  4YHR A;  2NTI A;  2Z0L A;  4HK1 A;  2IZO B;  1PLQ A;  1SXJ F;  1B77 A;  4CS5 A;  1B8H A;  1ISQ A;  1RXM A;  3P83 A;  3F1W A;  3GGR B;  5DAI A;  2HIK C;  2HIK A;  2IX2 C;  3G65 C;  1YYP A;  3G65 A;  5B7O A;  3A1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...