4D2GA

Crystal structure of human pcna in complex with p15 peptide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
258
Chain Sequence
GPHMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PROLIFERATING CELL NUCLEAR ANTIGEN
publication title Structure of P15(Paf)-PCNA Complex and Implications for Clamp Sliding During DNA Replication and Repair.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4d2gA00
2IX2B 5B7OA 2IO4A 3AIXB 1PLRA 3A1JB 2ZVLA 3AIZA 2HIKA 3AIZC 3G65C 1SXJF 1RXMA 2ZVWA 5E0TA 5A6DA 1B8HA 5E0VA 1DMLA 2ZVMA 3GGRC 1T6LA 2ZVVA 3V62B 3V60B 3P87A 1CZDA 1IZ4A 2IZOB 4YHRA 1VYMA 2NTIA 1PLQA 2HIIA 2HIKC 4TR6A 3LX2A 3TBLA 1RXZA 4ZTDA 3HSLX 4CS5A 3GPNA 3AIXA 2Z0LA 5DA7A 1W60A 2AVTA 5HACA 3U5ZF 3U60F 1ISQA 3F1WA 3G65B 3HI8A 5E0UA 3I2MX 4HK1A 3LX1A 1U76A 3K4XA 4L60A 3GGRB 4D2GA 2AWAA 2NTIC 3V61B 2HIIC 3IFVA 3FDSD 2IX2A 1IZ5A 3P83A 2IX2C 3A2FB 3A1JA 4L6PA 2IO4B 5CFKA 1GE8A 3VKXA 1UL1A 1B77A 2HIIB 2HIKB 3P91A 5AUJA 3FDSC 1RWZA 1YYPA 1U7BA 5H0TA 5IWDA 1AXCA 5JNED 2IJXA 3G65A 1VYJA 3U61F 2ZVKA 5IY4A 3GGRA 1UD9A 2IZOC 2OD8A 3A1JC 3GPMA 3WGWA 2NTIB 5IXAA 5DAIA 4RJFA
chains in the Genus database with same CATH superfamily
2IX2B 5B7OA 2IO4A 3AIXB 1PLRA 3A1JB 2ZVLA 3AIZA 2HIKA 3AIZC 3G65C 1SXJF 1RXMA 2ZVWA 5E0TA 5A6DA 1B8HA 5E0VA 1DMLA 2ZVMA 3GGRC 1T6LA 2ZVVA 3V62B 3V60B 3P87A 1CZDA 1IZ4A 2IZOB 4YHRA 1VYMA 2NTIA 1PLQA 2HIIA 2HIKC 4TR6A 3LX2A 3TBLA 1RXZA 4ZTDA 3HSLX 4CS5A 3GPNA 3AIXA 2Z0LA 5DA7A 1W60A 2AVTA 5HACA 3U5ZF 3U60F 1ISQA 3F1WA 3G65B 3HI8A 5E0UA 3I2MX 4HK1A 3LX1A 1U76A 3K4XA 4L60A 3GGRB 4D2GA 2AWAA 2NTIC 3V61B 2HIIC 3IFVA 3FDSD 2IX2A 1IZ5A 3P83A 2IX2C 3A2FB 3A1JA 4L6PA 2IO4B 5CFKA 1GE8A 3VKXA 1UL1A 1B77A 2HIIB 2HIKB 3P91A 5AUJA 3FDSC 1RWZA 1YYPA 1U7BA 5H0TA 5IWDA 1AXCA 5JNED 2IJXA 3G65A 1VYJA 3U61F 2ZVKA 5IY4A 3GGRA 1UD9A 2IZOC 2OD8A 3A1JC 3GPMA 3WGWA 2NTIB 5IXAA 5DAIA 4RJFA
chains in the Genus database with same CATH topology
2IX2B 5B7OA 2IO4A 3AIXB 1PLRA 3A1JB 2ZVLA 3AIZA 2HIKA 3AIZC 3G65C 1SXJF 1RXMA 2ZVWA 5E0TA 5A6DA 1B8HA 5E0VA 1DMLA 2ZVMA 3GGRC 1T6LA 2ZVVA 3V62B 3V60B 3P87A 1CZDA 1IZ4A 2IZOB 4YHRA 1VYMA 2NTIA 1PLQA 2HIIA 2HIKC 4TR6A 3LX2A 3TBLA 1RXZA 4ZTDA 3HSLX 4CS5A 3GPNA 3AIXA 2Z0LA 5DA7A 1W60A 2AVTA 5HACA 3U5ZF 3U60F 1ISQA 3F1WA 3G65B 3HI8A 5E0UA 3I2MX 4HK1A 3LX1A 1U76A 3K4XA 4L60A 3GGRB 4D2GA 2AWAA 2NTIC 3V61B 2HIIC 3IFVA 3FDSD 2IX2A 1IZ5A 3P83A 2IX2C 3A2FB 3A1JA 4L6PA 2IO4B 5CFKA 1GE8A 3VKXA 1UL1A 1B77A 2HIIB 2HIKB 3P91A 5AUJA 3FDSC 1RWZA 1YYPA 1U7BA 5H0TA 5IWDA 1AXCA 5JNED 2IJXA 3G65A 1VYJA 3U61F 2ZVKA 5IY4A 3GGRA 1UD9A 2IZOC 2OD8A 3A1JC 3GPMA 3WGWA 2NTIB 5IXAA 5DAIA 4RJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IX2 B;  5B7O A;  2IO4 A;  3AIX B;  1PLR A;  3A1J B;  2ZVL A;  3AIZ A;  2HIK A;  3AIZ C;  3G65 C;  1SXJ F;  1RXM A;  2ZVW A;  5E0T A;  5A6D A;  1B8H A;  5E0V A;  1DML A;  2ZVM A;  3GGR C;  1T6L A;  2ZVV A;  3V62 B;  3V60 B;  3P87 A;  1CZD A;  1IZ4 A;  2IZO B;  4YHR A;  1VYM A;  2NTI A;  1PLQ A;  2HII A;  2HIK C;  4TR6 A;  3LX2 A;  3TBL A;  1RXZ A;  4ZTD A;  3HSL X;  4CS5 A;  3GPN A;  3AIX A;  2Z0L A;  5DA7 A;  1W60 A;  2AVT A;  5HAC A;  3U5Z F;  3U60 F;  1ISQ A;  3F1W A;  3G65 B;  3HI8 A;  5E0U A;  3I2M X;  4HK1 A;  3LX1 A;  1U76 A;  3K4X A;  4L60 A;  3GGR B;  4D2G A;  2AWA A;  2NTI C;  3V61 B;  2HII C;  3IFV A;  3FDS D;  2IX2 A;  1IZ5 A;  3P83 A;  2IX2 C;  3A2F B;  3A1J A;  4L6P A;  2IO4 B;  5CFK A;  1GE8 A;  3VKX A;  1UL1 A;  1B77 A;  2HII B;  2HIK B;  3P91 A;  5AUJ A;  3FDS C;  1RWZ A;  1YYP A;  1U7B A;  5H0T A;  5IWD A;  1AXC A;  5JNE D;  2IJX A;  3G65 A;  1VYJ A;  3U61 F;  2ZVK A;  5IY4 A;  3GGR A;  1UD9 A;  2IZO C;  2OD8 A;  3A1J C;  3GPM A;  3WGW A;  2NTI B;  5IXA A;  5DAI A;  4RJF A; 
#chains in the Genus database with same CATH topology
 2IX2 B;  5B7O A;  2IO4 A;  3AIX B;  1PLR A;  3A1J B;  2ZVL A;  3AIZ A;  2HIK A;  3AIZ C;  3G65 C;  1SXJ F;  1RXM A;  2ZVW A;  5E0T A;  5A6D A;  1B8H A;  5E0V A;  1DML A;  2ZVM A;  3GGR C;  1T6L A;  2ZVV A;  3V62 B;  3V60 B;  3P87 A;  1CZD A;  1IZ4 A;  2IZO B;  4YHR A;  1VYM A;  2NTI A;  1PLQ A;  2HII A;  2HIK C;  4TR6 A;  3LX2 A;  3TBL A;  1RXZ A;  4ZTD A;  3HSL X;  4CS5 A;  3GPN A;  3AIX A;  2Z0L A;  5DA7 A;  1W60 A;  2AVT A;  5HAC A;  3U5Z F;  3U60 F;  1ISQ A;  3F1W A;  3G65 B;  3HI8 A;  5E0U A;  3I2M X;  4HK1 A;  3LX1 A;  1U76 A;  3K4X A;  4L60 A;  3GGR B;  4D2G A;  2AWA A;  2NTI C;  3V61 B;  2HII C;  3IFV A;  3FDS D;  2IX2 A;  1IZ5 A;  3P83 A;  2IX2 C;  3A2F B;  3A1J A;  4L6P A;  2IO4 B;  5CFK A;  1GE8 A;  3VKX A;  1UL1 A;  1B77 A;  2HII B;  2HIK B;  3P91 A;  5AUJ A;  3FDS C;  1RWZ A;  1YYP A;  1U7B A;  5H0T A;  5IWD A;  1AXC A;  5JNE D;  2IJX A;  3G65 A;  1VYJ A;  3U61 F;  2ZVK A;  5IY4 A;  3GGR A;  1UD9 A;  2IZO C;  2OD8 A;  3A1J C;  3GPM A;  3WGW A;  2NTI B;  5IXA A;  5DAI A;  4RJF A; 
#chains in the Genus database with same CATH homology
 2IX2 B;  5B7O A;  2IO4 A;  3AIX B;  1PLR A;  3A1J B;  2ZVL A;  3AIZ A;  2HIK A;  3AIZ C;  3G65 C;  1SXJ F;  1RXM A;  2ZVW A;  5E0T A;  5A6D A;  1B8H A;  5E0V A;  1DML A;  2ZVM A;  3GGR C;  1T6L A;  2ZVV A;  3V62 B;  3V60 B;  3P87 A;  1CZD A;  1IZ4 A;  2IZO B;  4YHR A;  1VYM A;  2NTI A;  1PLQ A;  2HII A;  2HIK C;  4TR6 A;  3LX2 A;  3TBL A;  1RXZ A;  4ZTD A;  3HSL X;  4CS5 A;  3GPN A;  3AIX A;  2Z0L A;  5DA7 A;  1W60 A;  2AVT A;  5HAC A;  3U5Z F;  3U60 F;  1ISQ A;  3F1W A;  3G65 B;  3HI8 A;  5E0U A;  3I2M X;  4HK1 A;  3LX1 A;  1U76 A;  3K4X A;  4L60 A;  3GGR B;  4D2G A;  2AWA A;  2NTI C;  3V61 B;  2HII C;  3IFV A;  3FDS D;  2IX2 A;  1IZ5 A;  3P83 A;  2IX2 C;  3A2F B;  3A1J A;  4L6P A;  2IO4 B;  5CFK A;  1GE8 A;  3VKX A;  1UL1 A;  1B77 A;  2HII B;  2HIK B;  3P91 A;  5AUJ A;  3FDS C;  1RWZ A;  1YYP A;  1U7B A;  5H0T A;  5IWD A;  1AXC A;  5JNE D;  2IJX A;  3G65 A;  1VYJ A;  3U61 F;  2ZVK A;  5IY4 A;  3GGR A;  1UD9 A;  2IZO C;  2OD8 A;  3A1J C;  3GPM A;  3WGW A;  2NTI B;  5IXA A;  5DAI A;  4RJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...