4L60A

Structure of c81r mutant pcna protein defective in mismatch repair
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
256
structure length
256
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRRGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Distinct structural alterations in proliferating cell nuclear antigen block DNA mismatch repair.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 54
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4l60A00
3P91A 5H0TA 2ZVMA 3V61B 3HSLX 5HACA 2ZVLA 3A2FB 3V62B 1U7BA 2IO4A 3U60F 2IZOB 1IZ5A 1RXMA 3A1JB 3AIXB 3FDSD 1W60A 1ISQA 2Z0LA 3GGRB 4L6PA 3F1WA 5B7OA 2ZVVA 3FDSC 2HIIA 1B77A 3G65B 4CS5A 3P83A 5CFKA 4TR6A 1CZDA 2NTIC 5JNED 4D2GA 3I2MX 1SXJF 1RWZA 1VYJA 2HIKA 4ZTDA 1GE8A 2IJXA 3GGRC 2IO4B 5IY4A 2IX2C 3TBLA 3G65C 2AVTA 2OD8A 5A6DA 2HIIB 3VKXA 1UD9A 1RXZA 1PLQA 1VYMA 3U61F 1U76A 5IWDA 4HK1A 3GGRA 3AIZC 2IX2A 5DAIA 5DA7A 5E0VA 2IZOC 1YYPA 3A1JC 3K4XA 1B8HA 1DMLA 2HIKB 3GPNA 2ZVKA 3P87A 1IZ4A 2NTIA 3V60B 3LX1A 3GPMA 3HI8A 4YHRA 3AIZA 1UL1A 5AUJA 1AXCA 3A1JA 3AIXA 5E0UA 1PLRA 3IFVA 4L60A 3U5ZF 5IXAA 3LX2A 2ZVWA 3G65A 1T6LA 5E0TA 2IX2B 2HIKC 3WGWA 4RJFA 2AWAA 2HIIC 2NTIB
chains in the Genus database with same CATH superfamily
3P91A 5H0TA 2ZVMA 3V61B 3HSLX 5HACA 2ZVLA 3A2FB 3V62B 1U7BA 2IO4A 3U60F 2IZOB 1IZ5A 1RXMA 3A1JB 3AIXB 3FDSD 1W60A 1ISQA 2Z0LA 3GGRB 4L6PA 3F1WA 5B7OA 2ZVVA 3FDSC 2HIIA 1B77A 3G65B 4CS5A 3P83A 5CFKA 4TR6A 1CZDA 2NTIC 5JNED 4D2GA 3I2MX 1SXJF 1RWZA 1VYJA 2HIKA 4ZTDA 1GE8A 2IJXA 3GGRC 2IO4B 5IY4A 2IX2C 3TBLA 3G65C 2AVTA 2OD8A 5A6DA 2HIIB 3VKXA 1UD9A 1RXZA 1PLQA 1VYMA 3U61F 1U76A 5IWDA 4HK1A 3GGRA 3AIZC 2IX2A 5DAIA 5DA7A 5E0VA 2IZOC 1YYPA 3A1JC 3K4XA 1B8HA 1DMLA 2HIKB 3GPNA 2ZVKA 3P87A 1IZ4A 2NTIA 3V60B 3LX1A 3GPMA 3HI8A 4YHRA 3AIZA 1UL1A 5AUJA 1AXCA 3A1JA 3AIXA 5E0UA 1PLRA 3IFVA 4L60A 3U5ZF 5IXAA 3LX2A 2ZVWA 3G65A 1T6LA 5E0TA 2IX2B 2HIKC 3WGWA 4RJFA 2AWAA 2HIIC 2NTIB
chains in the Genus database with same CATH topology
3P91A 5H0TA 2ZVMA 3V61B 3HSLX 5HACA 2ZVLA 3A2FB 3V62B 1U7BA 2IO4A 3U60F 2IZOB 1IZ5A 1RXMA 3A1JB 3AIXB 3FDSD 1W60A 1ISQA 2Z0LA 3GGRB 4L6PA 3F1WA 5B7OA 2ZVVA 3FDSC 2HIIA 1B77A 3G65B 4CS5A 3P83A 5CFKA 4TR6A 1CZDA 2NTIC 5JNED 4D2GA 3I2MX 1SXJF 1RWZA 1VYJA 2HIKA 4ZTDA 1GE8A 2IJXA 3GGRC 2IO4B 5IY4A 2IX2C 3TBLA 3G65C 2AVTA 2OD8A 5A6DA 2HIIB 3VKXA 1UD9A 1RXZA 1PLQA 1VYMA 3U61F 1U76A 5IWDA 4HK1A 3GGRA 3AIZC 2IX2A 5DAIA 5DA7A 5E0VA 2IZOC 1YYPA 3A1JC 3K4XA 1B8HA 1DMLA 2HIKB 3GPNA 2ZVKA 3P87A 1IZ4A 2NTIA 3V60B 3LX1A 3GPMA 3HI8A 4YHRA 3AIZA 1UL1A 5AUJA 1AXCA 3A1JA 3AIXA 5E0UA 1PLRA 3IFVA 4L60A 3U5ZF 5IXAA 3LX2A 2ZVWA 3G65A 1T6LA 5E0TA 2IX2B 2HIKC 3WGWA 4RJFA 2AWAA 2HIIC 2NTIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P91 A;  5H0T A;  2ZVM A;  3V61 B;  3HSL X;  5HAC A;  2ZVL A;  3A2F B;  3V62 B;  1U7B A;  2IO4 A;  3U60 F;  2IZO B;  1IZ5 A;  1RXM A;  3A1J B;  3AIX B;  3FDS D;  1W60 A;  1ISQ A;  2Z0L A;  3GGR B;  4L6P A;  3F1W A;  5B7O A;  2ZVV A;  3FDS C;  2HII A;  1B77 A;  3G65 B;  4CS5 A;  3P83 A;  5CFK A;  4TR6 A;  1CZD A;  2NTI C;  5JNE D;  4D2G A;  3I2M X;  1SXJ F;  1RWZ A;  1VYJ A;  2HIK A;  4ZTD A;  1GE8 A;  2IJX A;  3GGR C;  2IO4 B;  5IY4 A;  2IX2 C;  3TBL A;  3G65 C;  2AVT A;  2OD8 A;  5A6D A;  2HII B;  3VKX A;  1UD9 A;  1RXZ A;  1PLQ A;  1VYM A;  3U61 F;  1U76 A;  5IWD A;  4HK1 A;  3GGR A;  3AIZ C;  2IX2 A;  5DAI A;  5DA7 A;  5E0V A;  2IZO C;  1YYP A;  3A1J C;  3K4X A;  1B8H A;  1DML A;  2HIK B;  3GPN A;  2ZVK A;  3P87 A;  1IZ4 A;  2NTI A;  3V60 B;  3LX1 A;  3GPM A;  3HI8 A;  4YHR A;  3AIZ A;  1UL1 A;  5AUJ A;  1AXC A;  3A1J A;  3AIX A;  5E0U A;  1PLR A;  3IFV A;  4L60 A;  3U5Z F;  5IXA A;  3LX2 A;  2ZVW A;  3G65 A;  1T6L A;  5E0T A;  2IX2 B;  2HIK C;  3WGW A;  4RJF A;  2AWA A;  2HII C;  2NTI B; 
#chains in the Genus database with same CATH topology
 3P91 A;  5H0T A;  2ZVM A;  3V61 B;  3HSL X;  5HAC A;  2ZVL A;  3A2F B;  3V62 B;  1U7B A;  2IO4 A;  3U60 F;  2IZO B;  1IZ5 A;  1RXM A;  3A1J B;  3AIX B;  3FDS D;  1W60 A;  1ISQ A;  2Z0L A;  3GGR B;  4L6P A;  3F1W A;  5B7O A;  2ZVV A;  3FDS C;  2HII A;  1B77 A;  3G65 B;  4CS5 A;  3P83 A;  5CFK A;  4TR6 A;  1CZD A;  2NTI C;  5JNE D;  4D2G A;  3I2M X;  1SXJ F;  1RWZ A;  1VYJ A;  2HIK A;  4ZTD A;  1GE8 A;  2IJX A;  3GGR C;  2IO4 B;  5IY4 A;  2IX2 C;  3TBL A;  3G65 C;  2AVT A;  2OD8 A;  5A6D A;  2HII B;  3VKX A;  1UD9 A;  1RXZ A;  1PLQ A;  1VYM A;  3U61 F;  1U76 A;  5IWD A;  4HK1 A;  3GGR A;  3AIZ C;  2IX2 A;  5DAI A;  5DA7 A;  5E0V A;  2IZO C;  1YYP A;  3A1J C;  3K4X A;  1B8H A;  1DML A;  2HIK B;  3GPN A;  2ZVK A;  3P87 A;  1IZ4 A;  2NTI A;  3V60 B;  3LX1 A;  3GPM A;  3HI8 A;  4YHR A;  3AIZ A;  1UL1 A;  5AUJ A;  1AXC A;  3A1J A;  3AIX A;  5E0U A;  1PLR A;  3IFV A;  4L60 A;  3U5Z F;  5IXA A;  3LX2 A;  2ZVW A;  3G65 A;  1T6L A;  5E0T A;  2IX2 B;  2HIK C;  3WGW A;  4RJF A;  2AWA A;  2HII C;  2NTI B; 
#chains in the Genus database with same CATH homology
 3P91 A;  5H0T A;  2ZVM A;  3V61 B;  3HSL X;  5HAC A;  2ZVL A;  3A2F B;  3V62 B;  1U7B A;  2IO4 A;  3U60 F;  2IZO B;  1IZ5 A;  1RXM A;  3A1J B;  3AIX B;  3FDS D;  1W60 A;  1ISQ A;  2Z0L A;  3GGR B;  4L6P A;  3F1W A;  5B7O A;  2ZVV A;  3FDS C;  2HII A;  1B77 A;  3G65 B;  4CS5 A;  3P83 A;  5CFK A;  4TR6 A;  1CZD A;  2NTI C;  5JNE D;  4D2G A;  3I2M X;  1SXJ F;  1RWZ A;  1VYJ A;  2HIK A;  4ZTD A;  1GE8 A;  2IJX A;  3GGR C;  2IO4 B;  5IY4 A;  2IX2 C;  3TBL A;  3G65 C;  2AVT A;  2OD8 A;  5A6D A;  2HII B;  3VKX A;  1UD9 A;  1RXZ A;  1PLQ A;  1VYM A;  3U61 F;  1U76 A;  5IWD A;  4HK1 A;  3GGR A;  3AIZ C;  2IX2 A;  5DAI A;  5DA7 A;  5E0V A;  2IZO C;  1YYP A;  3A1J C;  3K4X A;  1B8H A;  1DML A;  2HIK B;  3GPN A;  2ZVK A;  3P87 A;  1IZ4 A;  2NTI A;  3V60 B;  3LX1 A;  3GPM A;  3HI8 A;  4YHR A;  3AIZ A;  1UL1 A;  5AUJ A;  1AXC A;  3A1J A;  3AIX A;  5E0U A;  1PLR A;  3IFV A;  4L60 A;  3U5Z F;  5IXA A;  3LX2 A;  2ZVW A;  3G65 A;  1T6L A;  5E0T A;  2IX2 B;  2HIK C;  3WGW A;  4RJF A;  2AWA A;  2HII C;  2NTI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...