4L6PA

Structure of c22y mutant pcna protein defective in dna mismatch repair
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
255
structure length
255
Chain Sequence
HMLEAKFEEASLFKRIIDGFKDYVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Distinct structural alterations in proliferating cell nuclear antigen block DNA mismatch repair.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 61
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4l6pA00
1AXCA 3LX2A 3VKXA 4L6PA 4RJFA 3F1WA 5E0TA 2IO4B 3GGRB 3FDSC 3P87A 5H0TA 2IX2B 1PLQA 2HIKB 5IWDA 2OD8A 4D2GA 3K4XA 2ZVVA 3P91A 1YYPA 3G65B 3HI8A 3AIXB 3U60F 5DA7A 5B7OA 1ISQA 4HK1A 2NTIC 3TBLA 1VYJA 4TR6A 1DMLA 1UL1A 1CZDA 1U7BA 1VYMA 4YHRA 4CS5A 2AWAA 5E0VA 5IY4A 2IZOC 2NTIA 4L60A 1U76A 1UD9A 3P83A 5HACA 1IZ4A 3LX1A 1RXZA 2IJXA 2ZVLA 5IXAA 5A6DA 1PLRA 2ZVMA 1GE8A 2Z0LA 1RXMA 3A1JA 3AIZA 2HIIA 2ZVWA 3V62B 3GGRC 2ZVKA 5DAIA 2IX2C 3WGWA 1IZ5A 2AVTA 3U61F 2HIKC 5CFKA 5AUJA 2NTIB 2IO4A 3GGRA 1RWZA 5JNED 3GPMA 3A2FB 1W60A 1SXJF 2IX2A 3A1JC 2HIIC 3AIZC 2HIKA 2IZOB 3G65C 1T6LA 4ZTDA 5E0UA 3G65A 3FDSD 3AIXA 1B8HA 3GPNA 3A1JB 2HIIB 1B77A 3V61B 3I2MX 3U5ZF 3IFVA 3V60B 3HSLX
chains in the Genus database with same CATH superfamily
1AXCA 3LX2A 3VKXA 4L6PA 4RJFA 3F1WA 5E0TA 2IO4B 3GGRB 3FDSC 3P87A 5H0TA 2IX2B 1PLQA 2HIKB 5IWDA 2OD8A 4D2GA 3K4XA 2ZVVA 3P91A 1YYPA 3G65B 3HI8A 3AIXB 3U60F 5DA7A 5B7OA 1ISQA 4HK1A 2NTIC 3TBLA 1VYJA 4TR6A 1DMLA 1UL1A 1CZDA 1U7BA 1VYMA 4YHRA 4CS5A 2AWAA 5E0VA 5IY4A 2IZOC 2NTIA 4L60A 1U76A 1UD9A 3P83A 5HACA 1IZ4A 3LX1A 1RXZA 2IJXA 2ZVLA 5IXAA 5A6DA 1PLRA 2ZVMA 1GE8A 2Z0LA 1RXMA 3A1JA 3AIZA 2HIIA 2ZVWA 3V62B 3GGRC 2ZVKA 5DAIA 2IX2C 3WGWA 1IZ5A 2AVTA 3U61F 2HIKC 5CFKA 5AUJA 2NTIB 2IO4A 3GGRA 1RWZA 5JNED 3GPMA 3A2FB 1W60A 1SXJF 2IX2A 3A1JC 2HIIC 3AIZC 2HIKA 2IZOB 3G65C 1T6LA 4ZTDA 5E0UA 3G65A 3FDSD 3AIXA 1B8HA 3GPNA 3A1JB 2HIIB 1B77A 3V61B 3I2MX 3U5ZF 3IFVA 3V60B 3HSLX
chains in the Genus database with same CATH topology
1AXCA 3LX2A 3VKXA 4L6PA 4RJFA 3F1WA 5E0TA 2IO4B 3GGRB 3FDSC 3P87A 5H0TA 2IX2B 1PLQA 2HIKB 5IWDA 2OD8A 4D2GA 3K4XA 2ZVVA 3P91A 1YYPA 3G65B 3HI8A 3AIXB 3U60F 5DA7A 5B7OA 1ISQA 4HK1A 2NTIC 3TBLA 1VYJA 4TR6A 1DMLA 1UL1A 1CZDA 1U7BA 1VYMA 4YHRA 4CS5A 2AWAA 5E0VA 5IY4A 2IZOC 2NTIA 4L60A 1U76A 1UD9A 3P83A 5HACA 1IZ4A 3LX1A 1RXZA 2IJXA 2ZVLA 5IXAA 5A6DA 1PLRA 2ZVMA 1GE8A 2Z0LA 1RXMA 3A1JA 3AIZA 2HIIA 2ZVWA 3V62B 3GGRC 2ZVKA 5DAIA 2IX2C 3WGWA 1IZ5A 2AVTA 3U61F 2HIKC 5CFKA 5AUJA 2NTIB 2IO4A 3GGRA 1RWZA 5JNED 3GPMA 3A2FB 1W60A 1SXJF 2IX2A 3A1JC 2HIIC 3AIZC 2HIKA 2IZOB 3G65C 1T6LA 4ZTDA 5E0UA 3G65A 3FDSD 3AIXA 1B8HA 3GPNA 3A1JB 2HIIB 1B77A 3V61B 3I2MX 3U5ZF 3IFVA 3V60B 3HSLX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AXC A;  3LX2 A;  3VKX A;  4L6P A;  4RJF A;  3F1W A;  5E0T A;  2IO4 B;  3GGR B;  3FDS C;  3P87 A;  5H0T A;  2IX2 B;  1PLQ A;  2HIK B;  5IWD A;  2OD8 A;  4D2G A;  3K4X A;  2ZVV A;  3P91 A;  1YYP A;  3G65 B;  3HI8 A;  3AIX B;  3U60 F;  5DA7 A;  5B7O A;  1ISQ A;  4HK1 A;  2NTI C;  3TBL A;  1VYJ A;  4TR6 A;  1DML A;  1UL1 A;  1CZD A;  1U7B A;  1VYM A;  4YHR A;  4CS5 A;  2AWA A;  5E0V A;  5IY4 A;  2IZO C;  2NTI A;  4L60 A;  1U76 A;  1UD9 A;  3P83 A;  5HAC A;  1IZ4 A;  3LX1 A;  1RXZ A;  2IJX A;  2ZVL A;  5IXA A;  5A6D A;  1PLR A;  2ZVM A;  1GE8 A;  2Z0L A;  1RXM A;  3A1J A;  3AIZ A;  2HII A;  2ZVW A;  3V62 B;  3GGR C;  2ZVK A;  5DAI A;  2IX2 C;  3WGW A;  1IZ5 A;  2AVT A;  3U61 F;  2HIK C;  5CFK A;  5AUJ A;  2NTI B;  2IO4 A;  3GGR A;  1RWZ A;  5JNE D;  3GPM A;  3A2F B;  1W60 A;  1SXJ F;  2IX2 A;  3A1J C;  2HII C;  3AIZ C;  2HIK A;  2IZO B;  3G65 C;  1T6L A;  4ZTD A;  5E0U A;  3G65 A;  3FDS D;  3AIX A;  1B8H A;  3GPN A;  3A1J B;  2HII B;  1B77 A;  3V61 B;  3I2M X;  3U5Z F;  3IFV A;  3V60 B;  3HSL X; 
#chains in the Genus database with same CATH topology
 1AXC A;  3LX2 A;  3VKX A;  4L6P A;  4RJF A;  3F1W A;  5E0T A;  2IO4 B;  3GGR B;  3FDS C;  3P87 A;  5H0T A;  2IX2 B;  1PLQ A;  2HIK B;  5IWD A;  2OD8 A;  4D2G A;  3K4X A;  2ZVV A;  3P91 A;  1YYP A;  3G65 B;  3HI8 A;  3AIX B;  3U60 F;  5DA7 A;  5B7O A;  1ISQ A;  4HK1 A;  2NTI C;  3TBL A;  1VYJ A;  4TR6 A;  1DML A;  1UL1 A;  1CZD A;  1U7B A;  1VYM A;  4YHR A;  4CS5 A;  2AWA A;  5E0V A;  5IY4 A;  2IZO C;  2NTI A;  4L60 A;  1U76 A;  1UD9 A;  3P83 A;  5HAC A;  1IZ4 A;  3LX1 A;  1RXZ A;  2IJX A;  2ZVL A;  5IXA A;  5A6D A;  1PLR A;  2ZVM A;  1GE8 A;  2Z0L A;  1RXM A;  3A1J A;  3AIZ A;  2HII A;  2ZVW A;  3V62 B;  3GGR C;  2ZVK A;  5DAI A;  2IX2 C;  3WGW A;  1IZ5 A;  2AVT A;  3U61 F;  2HIK C;  5CFK A;  5AUJ A;  2NTI B;  2IO4 A;  3GGR A;  1RWZ A;  5JNE D;  3GPM A;  3A2F B;  1W60 A;  1SXJ F;  2IX2 A;  3A1J C;  2HII C;  3AIZ C;  2HIK A;  2IZO B;  3G65 C;  1T6L A;  4ZTD A;  5E0U A;  3G65 A;  3FDS D;  3AIX A;  1B8H A;  3GPN A;  3A1J B;  2HII B;  1B77 A;  3V61 B;  3I2M X;  3U5Z F;  3IFV A;  3V60 B;  3HSL X; 
#chains in the Genus database with same CATH homology
 1AXC A;  3LX2 A;  3VKX A;  4L6P A;  4RJF A;  3F1W A;  5E0T A;  2IO4 B;  3GGR B;  3FDS C;  3P87 A;  5H0T A;  2IX2 B;  1PLQ A;  2HIK B;  5IWD A;  2OD8 A;  4D2G A;  3K4X A;  2ZVV A;  3P91 A;  1YYP A;  3G65 B;  3HI8 A;  3AIX B;  3U60 F;  5DA7 A;  5B7O A;  1ISQ A;  4HK1 A;  2NTI C;  3TBL A;  1VYJ A;  4TR6 A;  1DML A;  1UL1 A;  1CZD A;  1U7B A;  1VYM A;  4YHR A;  4CS5 A;  2AWA A;  5E0V A;  5IY4 A;  2IZO C;  2NTI A;  4L60 A;  1U76 A;  1UD9 A;  3P83 A;  5HAC A;  1IZ4 A;  3LX1 A;  1RXZ A;  2IJX A;  2ZVL A;  5IXA A;  5A6D A;  1PLR A;  2ZVM A;  1GE8 A;  2Z0L A;  1RXM A;  3A1J A;  3AIZ A;  2HII A;  2ZVW A;  3V62 B;  3GGR C;  2ZVK A;  5DAI A;  2IX2 C;  3WGW A;  1IZ5 A;  2AVT A;  3U61 F;  2HIK C;  5CFK A;  5AUJ A;  2NTI B;  2IO4 A;  3GGR A;  1RWZ A;  5JNE D;  3GPM A;  3A2F B;  1W60 A;  1SXJ F;  2IX2 A;  3A1J C;  2HII C;  3AIZ C;  2HIK A;  2IZO B;  3G65 C;  1T6L A;  4ZTD A;  5E0U A;  3G65 A;  3FDS D;  3AIX A;  1B8H A;  3GPN A;  3A1J B;  2HII B;  1B77 A;  3V61 B;  3I2M X;  3U5Z F;  3IFV A;  3V60 B;  3HSL X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...