4RJFA

Crystal structure of the human sliding clamp at 2.0 angstrom resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
255
structure length
255
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Proliferating cell nuclear antigen
publication title p21 Exploits Residue Tyr151 as a Tether for High-Affinity PCNA Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 255
sequence length 255
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2014-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4rjfA00
3K4XA 3AIZC 1UL1A 2IJXA 1ISQA 1RWZA 5H0TA 3AIXA 4D2GA 3HSLX 2AVTA 4ZTDA 2IZOC 5IY4A 2ZVKA 2HIKA 3A1JC 2AWAA 5HACA 2NTIA 2Z0LA 3V61B 4L6PA 5A6DA 5DA7A 3I2MX 1YYPA 3V60B 1UD9A 3A2FB 5B7OA 2ZVVA 5E0VA 3P87A 4RJFA 1B77A 1CZDA 2HIIB 3AIXB 4YHRA 3GGRC 1VYJA 2OD8A 3AIZA 2IX2B 1T6LA 1VYMA 5DAIA 2HIKB 2ZVMA 2NTIB 3LX1A 1IZ4A 4TR6A 1SXJF 3F1WA 4HK1A 1PLQA 3G65A 1AXCA 2HIIC 3V62B 1B8HA 3P83A 1RXZA 3A1JA 2IX2C 1PLRA 3FDSD 3GPNA 5JNED 5CFKA 3VKXA 3U60F 1RXMA 1IZ5A 3LX2A 3FDSC 5E0UA 3GGRA 1U7BA 2IO4A 3U61F 3G65B 3IFVA 3GPMA 4L60A 3A1JB 2ZVWA 3P91A 2HIKC 4CS5A 1U76A 2NTIC 3HI8A 3WGWA 2ZVLA 2HIIA 3U5ZF 2IX2A 3G65C 5IXAA 1DMLA 1W60A 3GGRB 2IO4B 5E0TA 1GE8A 3TBLA 5AUJA 2IZOB 5IWDA
chains in the Genus database with same CATH superfamily
3K4XA 3AIZC 1UL1A 2IJXA 1ISQA 1RWZA 5H0TA 3AIXA 4D2GA 3HSLX 2AVTA 4ZTDA 2IZOC 5IY4A 2ZVKA 2HIKA 3A1JC 2AWAA 5HACA 2NTIA 2Z0LA 3V61B 4L6PA 5A6DA 5DA7A 3I2MX 1YYPA 3V60B 1UD9A 3A2FB 5B7OA 2ZVVA 5E0VA 3P87A 4RJFA 1B77A 1CZDA 2HIIB 3AIXB 4YHRA 3GGRC 1VYJA 2OD8A 3AIZA 2IX2B 1T6LA 1VYMA 5DAIA 2HIKB 2ZVMA 2NTIB 3LX1A 1IZ4A 4TR6A 1SXJF 3F1WA 4HK1A 1PLQA 3G65A 1AXCA 2HIIC 3V62B 1B8HA 3P83A 1RXZA 3A1JA 2IX2C 1PLRA 3FDSD 3GPNA 5JNED 5CFKA 3VKXA 3U60F 1RXMA 1IZ5A 3LX2A 3FDSC 5E0UA 3GGRA 1U7BA 2IO4A 3U61F 3G65B 3IFVA 3GPMA 4L60A 3A1JB 2ZVWA 3P91A 2HIKC 4CS5A 1U76A 2NTIC 3HI8A 3WGWA 2ZVLA 2HIIA 3U5ZF 2IX2A 3G65C 5IXAA 1DMLA 1W60A 3GGRB 2IO4B 5E0TA 1GE8A 3TBLA 5AUJA 2IZOB 5IWDA
chains in the Genus database with same CATH topology
3K4XA 3AIZC 1UL1A 2IJXA 1ISQA 1RWZA 5H0TA 3AIXA 4D2GA 3HSLX 2AVTA 4ZTDA 2IZOC 5IY4A 2ZVKA 2HIKA 3A1JC 2AWAA 5HACA 2NTIA 2Z0LA 3V61B 4L6PA 5A6DA 5DA7A 3I2MX 1YYPA 3V60B 1UD9A 3A2FB 5B7OA 2ZVVA 5E0VA 3P87A 4RJFA 1B77A 1CZDA 2HIIB 3AIXB 4YHRA 3GGRC 1VYJA 2OD8A 3AIZA 2IX2B 1T6LA 1VYMA 5DAIA 2HIKB 2ZVMA 2NTIB 3LX1A 1IZ4A 4TR6A 1SXJF 3F1WA 4HK1A 1PLQA 3G65A 1AXCA 2HIIC 3V62B 1B8HA 3P83A 1RXZA 3A1JA 2IX2C 1PLRA 3FDSD 3GPNA 5JNED 5CFKA 3VKXA 3U60F 1RXMA 1IZ5A 3LX2A 3FDSC 5E0UA 3GGRA 1U7BA 2IO4A 3U61F 3G65B 3IFVA 3GPMA 4L60A 3A1JB 2ZVWA 3P91A 2HIKC 4CS5A 1U76A 2NTIC 3HI8A 3WGWA 2ZVLA 2HIIA 3U5ZF 2IX2A 3G65C 5IXAA 1DMLA 1W60A 3GGRB 2IO4B 5E0TA 1GE8A 3TBLA 5AUJA 2IZOB 5IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K4X A;  3AIZ C;  1UL1 A;  2IJX A;  1ISQ A;  1RWZ A;  5H0T A;  3AIX A;  4D2G A;  3HSL X;  2AVT A;  4ZTD A;  2IZO C;  5IY4 A;  2ZVK A;  2HIK A;  3A1J C;  2AWA A;  5HAC A;  2NTI A;  2Z0L A;  3V61 B;  4L6P A;  5A6D A;  5DA7 A;  3I2M X;  1YYP A;  3V60 B;  1UD9 A;  3A2F B;  5B7O A;  2ZVV A;  5E0V A;  3P87 A;  4RJF A;  1B77 A;  1CZD A;  2HII B;  3AIX B;  4YHR A;  3GGR C;  1VYJ A;  2OD8 A;  3AIZ A;  2IX2 B;  1T6L A;  1VYM A;  5DAI A;  2HIK B;  2ZVM A;  2NTI B;  3LX1 A;  1IZ4 A;  4TR6 A;  1SXJ F;  3F1W A;  4HK1 A;  1PLQ A;  3G65 A;  1AXC A;  2HII C;  3V62 B;  1B8H A;  3P83 A;  1RXZ A;  3A1J A;  2IX2 C;  1PLR A;  3FDS D;  3GPN A;  5JNE D;  5CFK A;  3VKX A;  3U60 F;  1RXM A;  1IZ5 A;  3LX2 A;  3FDS C;  5E0U A;  3GGR A;  1U7B A;  2IO4 A;  3U61 F;  3G65 B;  3IFV A;  3GPM A;  4L60 A;  3A1J B;  2ZVW A;  3P91 A;  2HIK C;  4CS5 A;  1U76 A;  2NTI C;  3HI8 A;  3WGW A;  2ZVL A;  2HII A;  3U5Z F;  2IX2 A;  3G65 C;  5IXA A;  1DML A;  1W60 A;  3GGR B;  2IO4 B;  5E0T A;  1GE8 A;  3TBL A;  5AUJ A;  2IZO B;  5IWD A; 
#chains in the Genus database with same CATH topology
 3K4X A;  3AIZ C;  1UL1 A;  2IJX A;  1ISQ A;  1RWZ A;  5H0T A;  3AIX A;  4D2G A;  3HSL X;  2AVT A;  4ZTD A;  2IZO C;  5IY4 A;  2ZVK A;  2HIK A;  3A1J C;  2AWA A;  5HAC A;  2NTI A;  2Z0L A;  3V61 B;  4L6P A;  5A6D A;  5DA7 A;  3I2M X;  1YYP A;  3V60 B;  1UD9 A;  3A2F B;  5B7O A;  2ZVV A;  5E0V A;  3P87 A;  4RJF A;  1B77 A;  1CZD A;  2HII B;  3AIX B;  4YHR A;  3GGR C;  1VYJ A;  2OD8 A;  3AIZ A;  2IX2 B;  1T6L A;  1VYM A;  5DAI A;  2HIK B;  2ZVM A;  2NTI B;  3LX1 A;  1IZ4 A;  4TR6 A;  1SXJ F;  3F1W A;  4HK1 A;  1PLQ A;  3G65 A;  1AXC A;  2HII C;  3V62 B;  1B8H A;  3P83 A;  1RXZ A;  3A1J A;  2IX2 C;  1PLR A;  3FDS D;  3GPN A;  5JNE D;  5CFK A;  3VKX A;  3U60 F;  1RXM A;  1IZ5 A;  3LX2 A;  3FDS C;  5E0U A;  3GGR A;  1U7B A;  2IO4 A;  3U61 F;  3G65 B;  3IFV A;  3GPM A;  4L60 A;  3A1J B;  2ZVW A;  3P91 A;  2HIK C;  4CS5 A;  1U76 A;  2NTI C;  3HI8 A;  3WGW A;  2ZVL A;  2HII A;  3U5Z F;  2IX2 A;  3G65 C;  5IXA A;  1DML A;  1W60 A;  3GGR B;  2IO4 B;  5E0T A;  1GE8 A;  3TBL A;  5AUJ A;  2IZO B;  5IWD A; 
#chains in the Genus database with same CATH homology
 3K4X A;  3AIZ C;  1UL1 A;  2IJX A;  1ISQ A;  1RWZ A;  5H0T A;  3AIX A;  4D2G A;  3HSL X;  2AVT A;  4ZTD A;  2IZO C;  5IY4 A;  2ZVK A;  2HIK A;  3A1J C;  2AWA A;  5HAC A;  2NTI A;  2Z0L A;  3V61 B;  4L6P A;  5A6D A;  5DA7 A;  3I2M X;  1YYP A;  3V60 B;  1UD9 A;  3A2F B;  5B7O A;  2ZVV A;  5E0V A;  3P87 A;  4RJF A;  1B77 A;  1CZD A;  2HII B;  3AIX B;  4YHR A;  3GGR C;  1VYJ A;  2OD8 A;  3AIZ A;  2IX2 B;  1T6L A;  1VYM A;  5DAI A;  2HIK B;  2ZVM A;  2NTI B;  3LX1 A;  1IZ4 A;  4TR6 A;  1SXJ F;  3F1W A;  4HK1 A;  1PLQ A;  3G65 A;  1AXC A;  2HII C;  3V62 B;  1B8H A;  3P83 A;  1RXZ A;  3A1J A;  2IX2 C;  1PLR A;  3FDS D;  3GPN A;  5JNE D;  5CFK A;  3VKX A;  3U60 F;  1RXM A;  1IZ5 A;  3LX2 A;  3FDS C;  5E0U A;  3GGR A;  1U7B A;  2IO4 A;  3U61 F;  3G65 B;  3IFV A;  3GPM A;  4L60 A;  3A1J B;  2ZVW A;  3P91 A;  2HIK C;  4CS5 A;  1U76 A;  2NTI C;  3HI8 A;  3WGW A;  2ZVL A;  2HII A;  3U5Z F;  2IX2 A;  3G65 C;  5IXA A;  1DML A;  1W60 A;  3GGR B;  2IO4 B;  5E0T A;  1GE8 A;  3TBL A;  5AUJ A;  2IZO B;  5IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...