4YHRA

Crystal structure of yeast proliferating cell nuclear antigen
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
256
structure length
256
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Dead-End Elimination with a Polarizable Force Field Repacks PCNA Models from Low-Resolution X-ray Diffraction into Atomic Resolution Structures
rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 53
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4yhrA00
3GPMA 3LX1A 2IZOB 1IZ5A 2NTIA 2IX2C 4YHRA 2NTIB 3GGRC 5E0TA 2Z0LA 5HACA 1DMLA 5B7OA 2HIKA 1VYJA 1YYPA 2HIKB 3VKXA 3U61F 3AIZA 1B77A 3IFVA 3A1JC 1GE8A 1CZDA 1B8HA 3G65C 4RJFA 1PLQA 2ZVVA 1IZ4A 1T6LA 1U76A 1SXJF 2HIIA 3A1JB 2HIIB 1U7BA 1VYMA 2ZVKA 2AVTA 4TR6A 3G65B 4ZTDA 3I2MX 5E0UA 2IX2A 3GGRA 2AWAA 2IX2B 3GGRB 3HSLX 4D2GA 3F1WA 3GPNA 5IXAA 3V60B 5IWDA 3A2FB 3P87A 3K4XA 3A1JA 4L60A 2OD8A 2NTIC 3G65A 4HK1A 3LX2A 3HI8A 2IO4A 3FDSD 3V61B 2IO4B 3AIXB 3FDSC 1RXMA 1UD9A 4CS5A 2HIKC 5DA7A 5H0TA 3AIZC 1RXZA 2ZVMA 1PLRA 5A6DA 3P83A 5JNED 5E0VA 5AUJA 2ZVWA 1RWZA 2IJXA 3U60F 1UL1A 2IZOC 5IY4A 3P91A 4L6PA 3U5ZF 3V62B 3WGWA 3TBLA 3AIXA 5DAIA 1W60A 2HIIC 5CFKA 2ZVLA 1ISQA 1AXCA
chains in the Genus database with same CATH superfamily
3GPMA 3LX1A 2IZOB 1IZ5A 2NTIA 2IX2C 4YHRA 2NTIB 3GGRC 5E0TA 2Z0LA 5HACA 1DMLA 5B7OA 2HIKA 1VYJA 1YYPA 2HIKB 3VKXA 3U61F 3AIZA 1B77A 3IFVA 3A1JC 1GE8A 1CZDA 1B8HA 3G65C 4RJFA 1PLQA 2ZVVA 1IZ4A 1T6LA 1U76A 1SXJF 2HIIA 3A1JB 2HIIB 1U7BA 1VYMA 2ZVKA 2AVTA 4TR6A 3G65B 4ZTDA 3I2MX 5E0UA 2IX2A 3GGRA 2AWAA 2IX2B 3GGRB 3HSLX 4D2GA 3F1WA 3GPNA 5IXAA 3V60B 5IWDA 3A2FB 3P87A 3K4XA 3A1JA 4L60A 2OD8A 2NTIC 3G65A 4HK1A 3LX2A 3HI8A 2IO4A 3FDSD 3V61B 2IO4B 3AIXB 3FDSC 1RXMA 1UD9A 4CS5A 2HIKC 5DA7A 5H0TA 3AIZC 1RXZA 2ZVMA 1PLRA 5A6DA 3P83A 5JNED 5E0VA 5AUJA 2ZVWA 1RWZA 2IJXA 3U60F 1UL1A 2IZOC 5IY4A 3P91A 4L6PA 3U5ZF 3V62B 3WGWA 3TBLA 3AIXA 5DAIA 1W60A 2HIIC 5CFKA 2ZVLA 1ISQA 1AXCA
chains in the Genus database with same CATH topology
3GPMA 3LX1A 2IZOB 1IZ5A 2NTIA 2IX2C 4YHRA 2NTIB 3GGRC 5E0TA 2Z0LA 5HACA 1DMLA 5B7OA 2HIKA 1VYJA 1YYPA 2HIKB 3VKXA 3U61F 3AIZA 1B77A 3IFVA 3A1JC 1GE8A 1CZDA 1B8HA 3G65C 4RJFA 1PLQA 2ZVVA 1IZ4A 1T6LA 1U76A 1SXJF 2HIIA 3A1JB 2HIIB 1U7BA 1VYMA 2ZVKA 2AVTA 4TR6A 3G65B 4ZTDA 3I2MX 5E0UA 2IX2A 3GGRA 2AWAA 2IX2B 3GGRB 3HSLX 4D2GA 3F1WA 3GPNA 5IXAA 3V60B 5IWDA 3A2FB 3P87A 3K4XA 3A1JA 4L60A 2OD8A 2NTIC 3G65A 4HK1A 3LX2A 3HI8A 2IO4A 3FDSD 3V61B 2IO4B 3AIXB 3FDSC 1RXMA 1UD9A 4CS5A 2HIKC 5DA7A 5H0TA 3AIZC 1RXZA 2ZVMA 1PLRA 5A6DA 3P83A 5JNED 5E0VA 5AUJA 2ZVWA 1RWZA 2IJXA 3U60F 1UL1A 2IZOC 5IY4A 3P91A 4L6PA 3U5ZF 3V62B 3WGWA 3TBLA 3AIXA 5DAIA 1W60A 2HIIC 5CFKA 2ZVLA 1ISQA 1AXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPM A;  3LX1 A;  2IZO B;  1IZ5 A;  2NTI A;  2IX2 C;  4YHR A;  2NTI B;  3GGR C;  5E0T A;  2Z0L A;  5HAC A;  1DML A;  5B7O A;  2HIK A;  1VYJ A;  1YYP A;  2HIK B;  3VKX A;  3U61 F;  3AIZ A;  1B77 A;  3IFV A;  3A1J C;  1GE8 A;  1CZD A;  1B8H A;  3G65 C;  4RJF A;  1PLQ A;  2ZVV A;  1IZ4 A;  1T6L A;  1U76 A;  1SXJ F;  2HII A;  3A1J B;  2HII B;  1U7B A;  1VYM A;  2ZVK A;  2AVT A;  4TR6 A;  3G65 B;  4ZTD A;  3I2M X;  5E0U A;  2IX2 A;  3GGR A;  2AWA A;  2IX2 B;  3GGR B;  3HSL X;  4D2G A;  3F1W A;  3GPN A;  5IXA A;  3V60 B;  5IWD A;  3A2F B;  3P87 A;  3K4X A;  3A1J A;  4L60 A;  2OD8 A;  2NTI C;  3G65 A;  4HK1 A;  3LX2 A;  3HI8 A;  2IO4 A;  3FDS D;  3V61 B;  2IO4 B;  3AIX B;  3FDS C;  1RXM A;  1UD9 A;  4CS5 A;  2HIK C;  5DA7 A;  5H0T A;  3AIZ C;  1RXZ A;  2ZVM A;  1PLR A;  5A6D A;  3P83 A;  5JNE D;  5E0V A;  5AUJ A;  2ZVW A;  1RWZ A;  2IJX A;  3U60 F;  1UL1 A;  2IZO C;  5IY4 A;  3P91 A;  4L6P A;  3U5Z F;  3V62 B;  3WGW A;  3TBL A;  3AIX A;  5DAI A;  1W60 A;  2HII C;  5CFK A;  2ZVL A;  1ISQ A;  1AXC A; 
#chains in the Genus database with same CATH topology
 3GPM A;  3LX1 A;  2IZO B;  1IZ5 A;  2NTI A;  2IX2 C;  4YHR A;  2NTI B;  3GGR C;  5E0T A;  2Z0L A;  5HAC A;  1DML A;  5B7O A;  2HIK A;  1VYJ A;  1YYP A;  2HIK B;  3VKX A;  3U61 F;  3AIZ A;  1B77 A;  3IFV A;  3A1J C;  1GE8 A;  1CZD A;  1B8H A;  3G65 C;  4RJF A;  1PLQ A;  2ZVV A;  1IZ4 A;  1T6L A;  1U76 A;  1SXJ F;  2HII A;  3A1J B;  2HII B;  1U7B A;  1VYM A;  2ZVK A;  2AVT A;  4TR6 A;  3G65 B;  4ZTD A;  3I2M X;  5E0U A;  2IX2 A;  3GGR A;  2AWA A;  2IX2 B;  3GGR B;  3HSL X;  4D2G A;  3F1W A;  3GPN A;  5IXA A;  3V60 B;  5IWD A;  3A2F B;  3P87 A;  3K4X A;  3A1J A;  4L60 A;  2OD8 A;  2NTI C;  3G65 A;  4HK1 A;  3LX2 A;  3HI8 A;  2IO4 A;  3FDS D;  3V61 B;  2IO4 B;  3AIX B;  3FDS C;  1RXM A;  1UD9 A;  4CS5 A;  2HIK C;  5DA7 A;  5H0T A;  3AIZ C;  1RXZ A;  2ZVM A;  1PLR A;  5A6D A;  3P83 A;  5JNE D;  5E0V A;  5AUJ A;  2ZVW A;  1RWZ A;  2IJX A;  3U60 F;  1UL1 A;  2IZO C;  5IY4 A;  3P91 A;  4L6P A;  3U5Z F;  3V62 B;  3WGW A;  3TBL A;  3AIX A;  5DAI A;  1W60 A;  2HII C;  5CFK A;  2ZVL A;  1ISQ A;  1AXC A; 
#chains in the Genus database with same CATH homology
 3GPM A;  3LX1 A;  2IZO B;  1IZ5 A;  2NTI A;  2IX2 C;  4YHR A;  2NTI B;  3GGR C;  5E0T A;  2Z0L A;  5HAC A;  1DML A;  5B7O A;  2HIK A;  1VYJ A;  1YYP A;  2HIK B;  3VKX A;  3U61 F;  3AIZ A;  1B77 A;  3IFV A;  3A1J C;  1GE8 A;  1CZD A;  1B8H A;  3G65 C;  4RJF A;  1PLQ A;  2ZVV A;  1IZ4 A;  1T6L A;  1U76 A;  1SXJ F;  2HII A;  3A1J B;  2HII B;  1U7B A;  1VYM A;  2ZVK A;  2AVT A;  4TR6 A;  3G65 B;  4ZTD A;  3I2M X;  5E0U A;  2IX2 A;  3GGR A;  2AWA A;  2IX2 B;  3GGR B;  3HSL X;  4D2G A;  3F1W A;  3GPN A;  5IXA A;  3V60 B;  5IWD A;  3A2F B;  3P87 A;  3K4X A;  3A1J A;  4L60 A;  2OD8 A;  2NTI C;  3G65 A;  4HK1 A;  3LX2 A;  3HI8 A;  2IO4 A;  3FDS D;  3V61 B;  2IO4 B;  3AIX B;  3FDS C;  1RXM A;  1UD9 A;  4CS5 A;  2HIK C;  5DA7 A;  5H0T A;  3AIZ C;  1RXZ A;  2ZVM A;  1PLR A;  5A6D A;  3P83 A;  5JNE D;  5E0V A;  5AUJ A;  2ZVW A;  1RWZ A;  2IJX A;  3U60 F;  1UL1 A;  2IZO C;  5IY4 A;  3P91 A;  4L6P A;  3U5Z F;  3V62 B;  3WGW A;  3TBL A;  3AIX A;  5DAI A;  1W60 A;  2HII C;  5CFK A;  2ZVL A;  1ISQ A;  1AXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...