4ZTDA

Crystal structure of human pcna in complex with a traip peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
253
structure length
253
Chain Sequence
FEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Proliferating cell nuclear antigen
publication title TRAIP is a PCNA-binding ubiquitin ligase that protects genome stability after replication stress.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 253
sequence length 253
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4ztdA00
3GGRB 5AUJA 3LX2A 3G65B 3A1JB 3HSLX 2ZVKA 5JNED 3P91A 3U5ZF 1B8HA 3AIZC 2IZOB 2HIKA 1U76A 1RWZA 2IX2C 4L6PA 4D2GA 5A6DA 3AIXB 1DMLA 2OD8A 4CS5A 2AWAA 3GPMA 5E0TA 2HIIC 4YHRA 3AIZA 3HI8A 1IZ4A 3TBLA 3FDSD 2Z0LA 2IX2A 3GPNA 1RXMA 1RXZA 5DA7A 3G65C 3A1JC 1PLQA 5IWDA 3WGWA 2HIIA 3V60B 5HACA 3LX1A 3A2FB 2AVTA 3G65A 1T6LA 2NTIC 5H0TA 2ZVWA 1VYMA 3F1WA 4RJFA 4TR6A 1SXJF 5B7OA 3GGRC 5E0UA 3FDSC 3V61B 3K4XA 3AIXA 1YYPA 1CZDA 1UD9A 1AXCA 2NTIA 3U60F 2IZOC 3V62B 2IO4A 2ZVLA 5CFKA 2HIKB 3GGRA 4HK1A 1GE8A 3A1JA 1ISQA 2ZVMA 3VKXA 4L60A 1W60A 2IJXA 3P87A 5IY4A 3I2MX 4ZTDA 5IXAA 2IX2B 5DAIA 2ZVVA 1B77A 3U61F 1U7BA 2NTIB 1VYJA 2HIIB 1UL1A 3P83A 2HIKC 2IO4B 5E0VA 1IZ5A 3IFVA 1PLRA
chains in the Genus database with same CATH superfamily
3GGRB 5AUJA 3LX2A 3G65B 3A1JB 3HSLX 2ZVKA 5JNED 3P91A 3U5ZF 1B8HA 3AIZC 2IZOB 2HIKA 1U76A 1RWZA 2IX2C 4L6PA 4D2GA 5A6DA 3AIXB 1DMLA 2OD8A 4CS5A 2AWAA 3GPMA 5E0TA 2HIIC 4YHRA 3AIZA 3HI8A 1IZ4A 3TBLA 3FDSD 2Z0LA 2IX2A 3GPNA 1RXMA 1RXZA 5DA7A 3G65C 3A1JC 1PLQA 5IWDA 3WGWA 2HIIA 3V60B 5HACA 3LX1A 3A2FB 2AVTA 3G65A 1T6LA 2NTIC 5H0TA 2ZVWA 1VYMA 3F1WA 4RJFA 4TR6A 1SXJF 5B7OA 3GGRC 5E0UA 3FDSC 3V61B 3K4XA 3AIXA 1YYPA 1CZDA 1UD9A 1AXCA 2NTIA 3U60F 2IZOC 3V62B 2IO4A 2ZVLA 5CFKA 2HIKB 3GGRA 4HK1A 1GE8A 3A1JA 1ISQA 2ZVMA 3VKXA 4L60A 1W60A 2IJXA 3P87A 5IY4A 3I2MX 4ZTDA 5IXAA 2IX2B 5DAIA 2ZVVA 1B77A 3U61F 1U7BA 2NTIB 1VYJA 2HIIB 1UL1A 3P83A 2HIKC 2IO4B 5E0VA 1IZ5A 3IFVA 1PLRA
chains in the Genus database with same CATH topology
3GGRB 5AUJA 3LX2A 3G65B 3A1JB 3HSLX 2ZVKA 5JNED 3P91A 3U5ZF 1B8HA 3AIZC 2IZOB 2HIKA 1U76A 1RWZA 2IX2C 4L6PA 4D2GA 5A6DA 3AIXB 1DMLA 2OD8A 4CS5A 2AWAA 3GPMA 5E0TA 2HIIC 4YHRA 3AIZA 3HI8A 1IZ4A 3TBLA 3FDSD 2Z0LA 2IX2A 3GPNA 1RXMA 1RXZA 5DA7A 3G65C 3A1JC 1PLQA 5IWDA 3WGWA 2HIIA 3V60B 5HACA 3LX1A 3A2FB 2AVTA 3G65A 1T6LA 2NTIC 5H0TA 2ZVWA 1VYMA 3F1WA 4RJFA 4TR6A 1SXJF 5B7OA 3GGRC 5E0UA 3FDSC 3V61B 3K4XA 3AIXA 1YYPA 1CZDA 1UD9A 1AXCA 2NTIA 3U60F 2IZOC 3V62B 2IO4A 2ZVLA 5CFKA 2HIKB 3GGRA 4HK1A 1GE8A 3A1JA 1ISQA 2ZVMA 3VKXA 4L60A 1W60A 2IJXA 3P87A 5IY4A 3I2MX 4ZTDA 5IXAA 2IX2B 5DAIA 2ZVVA 1B77A 3U61F 1U7BA 2NTIB 1VYJA 2HIIB 1UL1A 3P83A 2HIKC 2IO4B 5E0VA 1IZ5A 3IFVA 1PLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GGR B;  5AUJ A;  3LX2 A;  3G65 B;  3A1J B;  3HSL X;  2ZVK A;  5JNE D;  3P91 A;  3U5Z F;  1B8H A;  3AIZ C;  2IZO B;  2HIK A;  1U76 A;  1RWZ A;  2IX2 C;  4L6P A;  4D2G A;  5A6D A;  3AIX B;  1DML A;  2OD8 A;  4CS5 A;  2AWA A;  3GPM A;  5E0T A;  2HII C;  4YHR A;  3AIZ A;  3HI8 A;  1IZ4 A;  3TBL A;  3FDS D;  2Z0L A;  2IX2 A;  3GPN A;  1RXM A;  1RXZ A;  5DA7 A;  3G65 C;  3A1J C;  1PLQ A;  5IWD A;  3WGW A;  2HII A;  3V60 B;  5HAC A;  3LX1 A;  3A2F B;  2AVT A;  3G65 A;  1T6L A;  2NTI C;  5H0T A;  2ZVW A;  1VYM A;  3F1W A;  4RJF A;  4TR6 A;  1SXJ F;  5B7O A;  3GGR C;  5E0U A;  3FDS C;  3V61 B;  3K4X A;  3AIX A;  1YYP A;  1CZD A;  1UD9 A;  1AXC A;  2NTI A;  3U60 F;  2IZO C;  3V62 B;  2IO4 A;  2ZVL A;  5CFK A;  2HIK B;  3GGR A;  4HK1 A;  1GE8 A;  3A1J A;  1ISQ A;  2ZVM A;  3VKX A;  4L60 A;  1W60 A;  2IJX A;  3P87 A;  5IY4 A;  3I2M X;  4ZTD A;  5IXA A;  2IX2 B;  5DAI A;  2ZVV A;  1B77 A;  3U61 F;  1U7B A;  2NTI B;  1VYJ A;  2HII B;  1UL1 A;  3P83 A;  2HIK C;  2IO4 B;  5E0V A;  1IZ5 A;  3IFV A;  1PLR A; 
#chains in the Genus database with same CATH topology
 3GGR B;  5AUJ A;  3LX2 A;  3G65 B;  3A1J B;  3HSL X;  2ZVK A;  5JNE D;  3P91 A;  3U5Z F;  1B8H A;  3AIZ C;  2IZO B;  2HIK A;  1U76 A;  1RWZ A;  2IX2 C;  4L6P A;  4D2G A;  5A6D A;  3AIX B;  1DML A;  2OD8 A;  4CS5 A;  2AWA A;  3GPM A;  5E0T A;  2HII C;  4YHR A;  3AIZ A;  3HI8 A;  1IZ4 A;  3TBL A;  3FDS D;  2Z0L A;  2IX2 A;  3GPN A;  1RXM A;  1RXZ A;  5DA7 A;  3G65 C;  3A1J C;  1PLQ A;  5IWD A;  3WGW A;  2HII A;  3V60 B;  5HAC A;  3LX1 A;  3A2F B;  2AVT A;  3G65 A;  1T6L A;  2NTI C;  5H0T A;  2ZVW A;  1VYM A;  3F1W A;  4RJF A;  4TR6 A;  1SXJ F;  5B7O A;  3GGR C;  5E0U A;  3FDS C;  3V61 B;  3K4X A;  3AIX A;  1YYP A;  1CZD A;  1UD9 A;  1AXC A;  2NTI A;  3U60 F;  2IZO C;  3V62 B;  2IO4 A;  2ZVL A;  5CFK A;  2HIK B;  3GGR A;  4HK1 A;  1GE8 A;  3A1J A;  1ISQ A;  2ZVM A;  3VKX A;  4L60 A;  1W60 A;  2IJX A;  3P87 A;  5IY4 A;  3I2M X;  4ZTD A;  5IXA A;  2IX2 B;  5DAI A;  2ZVV A;  1B77 A;  3U61 F;  1U7B A;  2NTI B;  1VYJ A;  2HII B;  1UL1 A;  3P83 A;  2HIK C;  2IO4 B;  5E0V A;  1IZ5 A;  3IFV A;  1PLR A; 
#chains in the Genus database with same CATH homology
 3GGR B;  5AUJ A;  3LX2 A;  3G65 B;  3A1J B;  3HSL X;  2ZVK A;  5JNE D;  3P91 A;  3U5Z F;  1B8H A;  3AIZ C;  2IZO B;  2HIK A;  1U76 A;  1RWZ A;  2IX2 C;  4L6P A;  4D2G A;  5A6D A;  3AIX B;  1DML A;  2OD8 A;  4CS5 A;  2AWA A;  3GPM A;  5E0T A;  2HII C;  4YHR A;  3AIZ A;  3HI8 A;  1IZ4 A;  3TBL A;  3FDS D;  2Z0L A;  2IX2 A;  3GPN A;  1RXM A;  1RXZ A;  5DA7 A;  3G65 C;  3A1J C;  1PLQ A;  5IWD A;  3WGW A;  2HII A;  3V60 B;  5HAC A;  3LX1 A;  3A2F B;  2AVT A;  3G65 A;  1T6L A;  2NTI C;  5H0T A;  2ZVW A;  1VYM A;  3F1W A;  4RJF A;  4TR6 A;  1SXJ F;  5B7O A;  3GGR C;  5E0U A;  3FDS C;  3V61 B;  3K4X A;  3AIX A;  1YYP A;  1CZD A;  1UD9 A;  1AXC A;  2NTI A;  3U60 F;  2IZO C;  3V62 B;  2IO4 A;  2ZVL A;  5CFK A;  2HIK B;  3GGR A;  4HK1 A;  1GE8 A;  3A1J A;  1ISQ A;  2ZVM A;  3VKX A;  4L60 A;  1W60 A;  2IJX A;  3P87 A;  5IY4 A;  3I2M X;  4ZTD A;  5IXA A;  2IX2 B;  5DAI A;  2ZVV A;  1B77 A;  3U61 F;  1U7B A;  2NTI B;  1VYJ A;  2HII B;  1UL1 A;  3P83 A;  2HIK C;  2IO4 B;  5E0V A;  1IZ5 A;  3IFV A;  1PLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...