The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
76
|
structure length |
76
|
Chain Sequence |
PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVSLVYKTDQAQDVKKIEKFHSQLMRLMVAKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Retrotransposition and Crystal Structure of an Alu Rnp in the Ribosome-Stalling Conformation.
pubmed doi rcsb |
| molecule keywords |
SIGNAL RECOGNITION PARTICLE 9 KDA PROTEIN
|
| molecule tags |
Translation
|
| source organism |
Homo sapiens
|
| total genus |
20
|
| structure length |
76
|
| sequence length |
76
|
| chains with identical sequence |
D
|
| ec nomenclature | |
| pdb deposition date | 2015-09-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05486 | SRP9-21 | Signal recognition particle 9 kDa protein (SRP9) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 |
#chains in the Genus database with same CATH superfamily 2W9J A; 1914 A; 1E8O A; 1E8O B; 4UYJ A; 4UYJ B; 4UYK A; 4UYK B; 5AOX B; 5AOX A; #chains in the Genus database with same CATH topology 3BT3 A; 1914 A; 4N3A A; 2X5T A; 1UJR A; 1X4R A; 4XI9 A; 4AY6 A; 4UYK A; 5BNW A; 2FJA B; 2FFG A; 3TU3 B; 5AOX A; 4AKX B; 2KJZ A; 2DK6 A; 2X5G A; 2RSF A; 3VCX A; 4N3B A; 2FJB B; 3PE4 A; 4UYJ A; 4UYK B; 5AOX B; 1QMO E; 3ITW A; 4AY5 A; 4GZ6 A; 2X5H A; 4GYW A; 2A90 A; 1E8O A; 3SK1 A; 3TAX A; 1U7I A; 1JNZ B; 2FJD B; 2FJE B; 3GYX B; 4GYY A; 4XIF A; 5C1D A; 4UYJ B; 3PE3 A; 4GZ5 A; 2K4N A; 2W9J A; 1E8O B; 1JNR B; 3OMS A; 4CDR A; 4N3C A; 4N39 A; 3V3L A; 4GZ3 A; #chains in the Genus database with same CATH homology 3BT3 A; 1914 A; 4N3A A; 2X5T A; 1UJR A; 1X4R A; 4XI9 A; 4AY6 A; 4UYK A; 5BNW A; 2FJA B; 2FFG A; 3TU3 B; 5AOX A; 4AKX B; 2KJZ A; 2DK6 A; 2X5G A; 2RSF A; 3VCX A; 4N3B A; 2FJB B; 3PE4 A; 4UYJ A; 4UYK B; 5AOX B; 1QMO E; 3ITW A; 4AY5 A; 4GZ6 A; 2X5H A; 4GYW A; 2A90 A; 1E8O A; 3SK1 A; 3TAX A; 1U7I A; 1JNZ B; 2FJD B; 2FJE B; 3GYX B; 4GYY A; 4XIF A; 5C1D A; 4UYJ B; 3PE3 A; 4GZ5 A; 2K4N A; 2W9J A; 1E8O B; 1JNR B; 3OMS A; 4CDR A; 4N3C A; 4N39 A; 3V3L A; 4GZ3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
