5A6DA

Proliferating cell nuclear antigen, pcna, from thermococcus gammatolerans
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
PFEIVFDGAKEFADLIATASNLIDEAAFKITEEGVSMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDHFKKILKRGKSKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELELELPELPFTAKVVLLGEVLKEAIKDASLVSDSLKFIAKEDEFTMKAEGETNEVEIKLTLEDEGLLDLEVEEETRSAYGISYLADMVKGIGKADEVTLRFGTEMPLQMDYFIRDEGKLTFLLAPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA POLYMERASE SLIDING CLAMP
publication title Cloning, recombinant production and crystallographic structure of Proliferating Cell Nuclear Antigen from radioresistant archaeon Thermococcus gammatolerans.
pubmed doi rcsb
source organism Thermococcus gammatolerans
total genus 60
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5a6dA00
1IZ5A 4RJFA 5IXAA 1W60A 2ZVKA 2HIIC 2HIKA 3K4XA 1IZ4A 3V61B 3GGRC 3F1WA 3G65A 3IFVA 3TBLA 2IO4A 3WGWA 3FDSC 1VYJA 2IX2A 1U7BA 5DAIA 5CFKA 2AWAA 5B7OA 2HIKC 1CZDA 2NTIA 3G65C 5JNED 3V60B 2IZOB 3LX2A 2IX2C 4CS5A 1ISQA 2IJXA 5IY4A 3P87A 3A1JB 5E0VA 5H0TA 3V62B 3AIZA 2NTIC 1DMLA 1PLQA 1UL1A 3HSLX 1SXJF 3AIXB 5E0UA 1B77A 2ZVMA 1AXCA 4ZTDA 3U5ZF 3VKXA 1YYPA 4HK1A 3AIZC 1B8HA 2HIIB 3FDSD 1PLRA 3GGRB 4D2GA 3A1JA 3P91A 2Z0LA 2ZVWA 3A2FB 3AIXA 1RXZA 3U60F 3P83A 5HACA 2HIKB 1RXMA 3I2MX 3HI8A 3LX1A 1RWZA 3GPNA 3G65B 3A1JC 4L60A 3U61F 5AUJA 2OD8A 1U76A 2IO4B 1T6LA 2IX2B 1GE8A 5IWDA 2HIIA 2ZVLA 3GPMA 5A6DA 3GGRA 4TR6A 4YHRA 5E0TA 1UD9A 2AVTA 4L6PA 2NTIB 1VYMA 2ZVVA 2IZOC 5DA7A
chains in the Genus database with same CATH superfamily
1IZ5A 4RJFA 5IXAA 1W60A 2ZVKA 2HIIC 2HIKA 3K4XA 1IZ4A 3V61B 3GGRC 3F1WA 3G65A 3IFVA 3TBLA 2IO4A 3WGWA 3FDSC 1VYJA 2IX2A 1U7BA 5DAIA 5CFKA 2AWAA 5B7OA 2HIKC 1CZDA 2NTIA 3G65C 5JNED 3V60B 2IZOB 3LX2A 2IX2C 4CS5A 1ISQA 2IJXA 5IY4A 3P87A 3A1JB 5E0VA 5H0TA 3V62B 3AIZA 2NTIC 1DMLA 1PLQA 1UL1A 3HSLX 1SXJF 3AIXB 5E0UA 1B77A 2ZVMA 1AXCA 4ZTDA 3U5ZF 3VKXA 1YYPA 4HK1A 3AIZC 1B8HA 2HIIB 3FDSD 1PLRA 3GGRB 4D2GA 3A1JA 3P91A 2Z0LA 2ZVWA 3A2FB 3AIXA 1RXZA 3U60F 3P83A 5HACA 2HIKB 1RXMA 3I2MX 3HI8A 3LX1A 1RWZA 3GPNA 3G65B 3A1JC 4L60A 3U61F 5AUJA 2OD8A 1U76A 2IO4B 1T6LA 2IX2B 1GE8A 5IWDA 2HIIA 2ZVLA 3GPMA 5A6DA 3GGRA 4TR6A 4YHRA 5E0TA 1UD9A 2AVTA 4L6PA 2NTIB 1VYMA 2ZVVA 2IZOC 5DA7A
chains in the Genus database with same CATH topology
1IZ5A 4RJFA 5IXAA 1W60A 2ZVKA 2HIIC 2HIKA 3K4XA 1IZ4A 3V61B 3GGRC 3F1WA 3G65A 3IFVA 3TBLA 2IO4A 3WGWA 3FDSC 1VYJA 2IX2A 1U7BA 5DAIA 5CFKA 2AWAA 5B7OA 2HIKC 1CZDA 2NTIA 3G65C 5JNED 3V60B 2IZOB 3LX2A 2IX2C 4CS5A 1ISQA 2IJXA 5IY4A 3P87A 3A1JB 5E0VA 5H0TA 3V62B 3AIZA 2NTIC 1DMLA 1PLQA 1UL1A 3HSLX 1SXJF 3AIXB 5E0UA 1B77A 2ZVMA 1AXCA 4ZTDA 3U5ZF 3VKXA 1YYPA 4HK1A 3AIZC 1B8HA 2HIIB 3FDSD 1PLRA 3GGRB 4D2GA 3A1JA 3P91A 2Z0LA 2ZVWA 3A2FB 3AIXA 1RXZA 3U60F 3P83A 5HACA 2HIKB 1RXMA 3I2MX 3HI8A 3LX1A 1RWZA 3GPNA 3G65B 3A1JC 4L60A 3U61F 5AUJA 2OD8A 1U76A 2IO4B 1T6LA 2IX2B 1GE8A 5IWDA 2HIIA 2ZVLA 3GPMA 5A6DA 3GGRA 4TR6A 4YHRA 5E0TA 1UD9A 2AVTA 4L6PA 2NTIB 1VYMA 2ZVVA 2IZOC 5DA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZ5 A;  4RJF A;  5IXA A;  1W60 A;  2ZVK A;  2HII C;  2HIK A;  3K4X A;  1IZ4 A;  3V61 B;  3GGR C;  3F1W A;  3G65 A;  3IFV A;  3TBL A;  2IO4 A;  3WGW A;  3FDS C;  1VYJ A;  2IX2 A;  1U7B A;  5DAI A;  5CFK A;  2AWA A;  5B7O A;  2HIK C;  1CZD A;  2NTI A;  3G65 C;  5JNE D;  3V60 B;  2IZO B;  3LX2 A;  2IX2 C;  4CS5 A;  1ISQ A;  2IJX A;  5IY4 A;  3P87 A;  3A1J B;  5E0V A;  5H0T A;  3V62 B;  3AIZ A;  2NTI C;  1DML A;  1PLQ A;  1UL1 A;  3HSL X;  1SXJ F;  3AIX B;  5E0U A;  1B77 A;  2ZVM A;  1AXC A;  4ZTD A;  3U5Z F;  3VKX A;  1YYP A;  4HK1 A;  3AIZ C;  1B8H A;  2HII B;  3FDS D;  1PLR A;  3GGR B;  4D2G A;  3A1J A;  3P91 A;  2Z0L A;  2ZVW A;  3A2F B;  3AIX A;  1RXZ A;  3U60 F;  3P83 A;  5HAC A;  2HIK B;  1RXM A;  3I2M X;  3HI8 A;  3LX1 A;  1RWZ A;  3GPN A;  3G65 B;  3A1J C;  4L60 A;  3U61 F;  5AUJ A;  2OD8 A;  1U76 A;  2IO4 B;  1T6L A;  2IX2 B;  1GE8 A;  5IWD A;  2HII A;  2ZVL A;  3GPM A;  5A6D A;  3GGR A;  4TR6 A;  4YHR A;  5E0T A;  1UD9 A;  2AVT A;  4L6P A;  2NTI B;  1VYM A;  2ZVV A;  2IZO C;  5DA7 A; 
#chains in the Genus database with same CATH topology
 1IZ5 A;  4RJF A;  5IXA A;  1W60 A;  2ZVK A;  2HII C;  2HIK A;  3K4X A;  1IZ4 A;  3V61 B;  3GGR C;  3F1W A;  3G65 A;  3IFV A;  3TBL A;  2IO4 A;  3WGW A;  3FDS C;  1VYJ A;  2IX2 A;  1U7B A;  5DAI A;  5CFK A;  2AWA A;  5B7O A;  2HIK C;  1CZD A;  2NTI A;  3G65 C;  5JNE D;  3V60 B;  2IZO B;  3LX2 A;  2IX2 C;  4CS5 A;  1ISQ A;  2IJX A;  5IY4 A;  3P87 A;  3A1J B;  5E0V A;  5H0T A;  3V62 B;  3AIZ A;  2NTI C;  1DML A;  1PLQ A;  1UL1 A;  3HSL X;  1SXJ F;  3AIX B;  5E0U A;  1B77 A;  2ZVM A;  1AXC A;  4ZTD A;  3U5Z F;  3VKX A;  1YYP A;  4HK1 A;  3AIZ C;  1B8H A;  2HII B;  3FDS D;  1PLR A;  3GGR B;  4D2G A;  3A1J A;  3P91 A;  2Z0L A;  2ZVW A;  3A2F B;  3AIX A;  1RXZ A;  3U60 F;  3P83 A;  5HAC A;  2HIK B;  1RXM A;  3I2M X;  3HI8 A;  3LX1 A;  1RWZ A;  3GPN A;  3G65 B;  3A1J C;  4L60 A;  3U61 F;  5AUJ A;  2OD8 A;  1U76 A;  2IO4 B;  1T6L A;  2IX2 B;  1GE8 A;  5IWD A;  2HII A;  2ZVL A;  3GPM A;  5A6D A;  3GGR A;  4TR6 A;  4YHR A;  5E0T A;  1UD9 A;  2AVT A;  4L6P A;  2NTI B;  1VYM A;  2ZVV A;  2IZO C;  5DA7 A; 
#chains in the Genus database with same CATH homology
 1IZ5 A;  4RJF A;  5IXA A;  1W60 A;  2ZVK A;  2HII C;  2HIK A;  3K4X A;  1IZ4 A;  3V61 B;  3GGR C;  3F1W A;  3G65 A;  3IFV A;  3TBL A;  2IO4 A;  3WGW A;  3FDS C;  1VYJ A;  2IX2 A;  1U7B A;  5DAI A;  5CFK A;  2AWA A;  5B7O A;  2HIK C;  1CZD A;  2NTI A;  3G65 C;  5JNE D;  3V60 B;  2IZO B;  3LX2 A;  2IX2 C;  4CS5 A;  1ISQ A;  2IJX A;  5IY4 A;  3P87 A;  3A1J B;  5E0V A;  5H0T A;  3V62 B;  3AIZ A;  2NTI C;  1DML A;  1PLQ A;  1UL1 A;  3HSL X;  1SXJ F;  3AIX B;  5E0U A;  1B77 A;  2ZVM A;  1AXC A;  4ZTD A;  3U5Z F;  3VKX A;  1YYP A;  4HK1 A;  3AIZ C;  1B8H A;  2HII B;  3FDS D;  1PLR A;  3GGR B;  4D2G A;  3A1J A;  3P91 A;  2Z0L A;  2ZVW A;  3A2F B;  3AIX A;  1RXZ A;  3U60 F;  3P83 A;  5HAC A;  2HIK B;  1RXM A;  3I2M X;  3HI8 A;  3LX1 A;  1RWZ A;  3GPN A;  3G65 B;  3A1J C;  4L60 A;  3U61 F;  5AUJ A;  2OD8 A;  1U76 A;  2IO4 B;  1T6L A;  2IX2 B;  1GE8 A;  5IWD A;  2HII A;  2ZVL A;  3GPM A;  5A6D A;  3GGR A;  4TR6 A;  4YHR A;  5E0T A;  1UD9 A;  2AVT A;  4L6P A;  2NTI B;  1VYM A;  2ZVV A;  2IZO C;  5DA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...