5B7OA

Crystal structure of proliferating cell nuclear antigen from leishmania donovani at 2.95 angstrom resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
289
structure length
248
Chain Sequence
MLEAQVQFASLWKRLVECINGLVNEANFDCNPGGLSVQAMDSSHVALVHMLLRDDCFVKYQCGRNSILGLNLASLSKVLKIVDSNDSLSLRHDDDSDVVTLTSENPEKTRKCEYQLKLLEIEAESMGIPEMDYRSTVTLNSAEFAKIVRDMQVFGDTVTIAISKEGVKFSSSGDVGQGYTFLQAAGVEVTMEEPITLSFALRFMGIFAKGSTLSERVTLKFAKDSPCMVEYGIDNVGYLRYYLAPKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Crystal structure of proliferating cell nuclear antigen from Leishmania donovani at 2.95 Angstrom resolution.
rcsb
source organism Leishmania donovani
total genus 52
structure length 248
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5b7oA00
3AIXB 1VYJA 1VYMA 2ZVLA 3FDSC 3U60F 2IO4A 3A2FB 2HIIC 2AVTA 3A1JA 4L6PA 3F1WA 2IO4B 3P87A 3A1JB 3GGRA 1IZ5A 3G65C 5IXAA 3AIZA 4YHRA 5HACA 2ZVVA 2HIKA 2NTIA 2ZVKA 3FDSD 1B77A 2HIKB 3WGWA 1YYPA 2NTIB 3I2MX 3U61F 1U76A 5E0UA 5IY4A 4RJFA 5H0TA 1IZ4A 2IX2A 2AWAA 5IWDA 2IZOB 5B7OA 3U5ZF 2IX2B 2HIIA 3A1JC 1PLQA 3GPMA 4L60A 1W60A 3GGRB 1AXCA 4HK1A 2ZVWA 3V61B 3G65A 1T6LA 2HIKC 5DA7A 3V62B 3LX2A 2NTIC 3VKXA 5E0VA 1RXZA 1UL1A 1UD9A 5E0TA 3K4XA 3HSLX 3TBLA 1DMLA 1GE8A 2IJXA 2IZOC 5DAIA 3IFVA 3AIXA 4D2GA 2ZVMA 5AUJA 2HIIB 3GGRC 2Z0LA 2OD8A 3AIZC 1RWZA 5JNED 1CZDA 1ISQA 3V60B 3LX1A 4ZTDA 3P91A 5A6DA 3G65B 1B8HA 1U7BA 4CS5A 1PLRA 1SXJF 5CFKA 1RXMA 3HI8A 3GPNA 2IX2C 3P83A 4TR6A
chains in the Genus database with same CATH superfamily
3AIXB 1VYJA 1VYMA 2ZVLA 3FDSC 3U60F 2IO4A 3A2FB 2HIIC 2AVTA 3A1JA 4L6PA 3F1WA 2IO4B 3P87A 3A1JB 3GGRA 1IZ5A 3G65C 5IXAA 3AIZA 4YHRA 5HACA 2ZVVA 2HIKA 2NTIA 2ZVKA 3FDSD 1B77A 2HIKB 3WGWA 1YYPA 2NTIB 3I2MX 3U61F 1U76A 5E0UA 5IY4A 4RJFA 5H0TA 1IZ4A 2IX2A 2AWAA 5IWDA 2IZOB 5B7OA 3U5ZF 2IX2B 2HIIA 3A1JC 1PLQA 3GPMA 4L60A 1W60A 3GGRB 1AXCA 4HK1A 2ZVWA 3V61B 3G65A 1T6LA 2HIKC 5DA7A 3V62B 3LX2A 2NTIC 3VKXA 5E0VA 1RXZA 1UL1A 1UD9A 5E0TA 3K4XA 3HSLX 3TBLA 1DMLA 1GE8A 2IJXA 2IZOC 5DAIA 3IFVA 3AIXA 4D2GA 2ZVMA 5AUJA 2HIIB 3GGRC 2Z0LA 2OD8A 3AIZC 1RWZA 5JNED 1CZDA 1ISQA 3V60B 3LX1A 4ZTDA 3P91A 5A6DA 3G65B 1B8HA 1U7BA 4CS5A 1PLRA 1SXJF 5CFKA 1RXMA 3HI8A 3GPNA 2IX2C 3P83A 4TR6A
chains in the Genus database with same CATH topology
3AIXB 1VYJA 1VYMA 2ZVLA 3FDSC 3U60F 2IO4A 3A2FB 2HIIC 2AVTA 3A1JA 4L6PA 3F1WA 2IO4B 3P87A 3A1JB 3GGRA 1IZ5A 3G65C 5IXAA 3AIZA 4YHRA 5HACA 2ZVVA 2HIKA 2NTIA 2ZVKA 3FDSD 1B77A 2HIKB 3WGWA 1YYPA 2NTIB 3I2MX 3U61F 1U76A 5E0UA 5IY4A 4RJFA 5H0TA 1IZ4A 2IX2A 2AWAA 5IWDA 2IZOB 5B7OA 3U5ZF 2IX2B 2HIIA 3A1JC 1PLQA 3GPMA 4L60A 1W60A 3GGRB 1AXCA 4HK1A 2ZVWA 3V61B 3G65A 1T6LA 2HIKC 5DA7A 3V62B 3LX2A 2NTIC 3VKXA 5E0VA 1RXZA 1UL1A 1UD9A 5E0TA 3K4XA 3HSLX 3TBLA 1DMLA 1GE8A 2IJXA 2IZOC 5DAIA 3IFVA 3AIXA 4D2GA 2ZVMA 5AUJA 2HIIB 3GGRC 2Z0LA 2OD8A 3AIZC 1RWZA 5JNED 1CZDA 1ISQA 3V60B 3LX1A 4ZTDA 3P91A 5A6DA 3G65B 1B8HA 1U7BA 4CS5A 1PLRA 1SXJF 5CFKA 1RXMA 3HI8A 3GPNA 2IX2C 3P83A 4TR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AIX B;  1VYJ A;  1VYM A;  2ZVL A;  3FDS C;  3U60 F;  2IO4 A;  3A2F B;  2HII C;  2AVT A;  3A1J A;  4L6P A;  3F1W A;  2IO4 B;  3P87 A;  3A1J B;  3GGR A;  1IZ5 A;  3G65 C;  5IXA A;  3AIZ A;  4YHR A;  5HAC A;  2ZVV A;  2HIK A;  2NTI A;  2ZVK A;  3FDS D;  1B77 A;  2HIK B;  3WGW A;  1YYP A;  2NTI B;  3I2M X;  3U61 F;  1U76 A;  5E0U A;  5IY4 A;  4RJF A;  5H0T A;  1IZ4 A;  2IX2 A;  2AWA A;  5IWD A;  2IZO B;  5B7O A;  3U5Z F;  2IX2 B;  2HII A;  3A1J C;  1PLQ A;  3GPM A;  4L60 A;  1W60 A;  3GGR B;  1AXC A;  4HK1 A;  2ZVW A;  3V61 B;  3G65 A;  1T6L A;  2HIK C;  5DA7 A;  3V62 B;  3LX2 A;  2NTI C;  3VKX A;  5E0V A;  1RXZ A;  1UL1 A;  1UD9 A;  5E0T A;  3K4X A;  3HSL X;  3TBL A;  1DML A;  1GE8 A;  2IJX A;  2IZO C;  5DAI A;  3IFV A;  3AIX A;  4D2G A;  2ZVM A;  5AUJ A;  2HII B;  3GGR C;  2Z0L A;  2OD8 A;  3AIZ C;  1RWZ A;  5JNE D;  1CZD A;  1ISQ A;  3V60 B;  3LX1 A;  4ZTD A;  3P91 A;  5A6D A;  3G65 B;  1B8H A;  1U7B A;  4CS5 A;  1PLR A;  1SXJ F;  5CFK A;  1RXM A;  3HI8 A;  3GPN A;  2IX2 C;  3P83 A;  4TR6 A; 
#chains in the Genus database with same CATH topology
 3AIX B;  1VYJ A;  1VYM A;  2ZVL A;  3FDS C;  3U60 F;  2IO4 A;  3A2F B;  2HII C;  2AVT A;  3A1J A;  4L6P A;  3F1W A;  2IO4 B;  3P87 A;  3A1J B;  3GGR A;  1IZ5 A;  3G65 C;  5IXA A;  3AIZ A;  4YHR A;  5HAC A;  2ZVV A;  2HIK A;  2NTI A;  2ZVK A;  3FDS D;  1B77 A;  2HIK B;  3WGW A;  1YYP A;  2NTI B;  3I2M X;  3U61 F;  1U76 A;  5E0U A;  5IY4 A;  4RJF A;  5H0T A;  1IZ4 A;  2IX2 A;  2AWA A;  5IWD A;  2IZO B;  5B7O A;  3U5Z F;  2IX2 B;  2HII A;  3A1J C;  1PLQ A;  3GPM A;  4L60 A;  1W60 A;  3GGR B;  1AXC A;  4HK1 A;  2ZVW A;  3V61 B;  3G65 A;  1T6L A;  2HIK C;  5DA7 A;  3V62 B;  3LX2 A;  2NTI C;  3VKX A;  5E0V A;  1RXZ A;  1UL1 A;  1UD9 A;  5E0T A;  3K4X A;  3HSL X;  3TBL A;  1DML A;  1GE8 A;  2IJX A;  2IZO C;  5DAI A;  3IFV A;  3AIX A;  4D2G A;  2ZVM A;  5AUJ A;  2HII B;  3GGR C;  2Z0L A;  2OD8 A;  3AIZ C;  1RWZ A;  5JNE D;  1CZD A;  1ISQ A;  3V60 B;  3LX1 A;  4ZTD A;  3P91 A;  5A6D A;  3G65 B;  1B8H A;  1U7B A;  4CS5 A;  1PLR A;  1SXJ F;  5CFK A;  1RXM A;  3HI8 A;  3GPN A;  2IX2 C;  3P83 A;  4TR6 A; 
#chains in the Genus database with same CATH homology
 3AIX B;  1VYJ A;  1VYM A;  2ZVL A;  3FDS C;  3U60 F;  2IO4 A;  3A2F B;  2HII C;  2AVT A;  3A1J A;  4L6P A;  3F1W A;  2IO4 B;  3P87 A;  3A1J B;  3GGR A;  1IZ5 A;  3G65 C;  5IXA A;  3AIZ A;  4YHR A;  5HAC A;  2ZVV A;  2HIK A;  2NTI A;  2ZVK A;  3FDS D;  1B77 A;  2HIK B;  3WGW A;  1YYP A;  2NTI B;  3I2M X;  3U61 F;  1U76 A;  5E0U A;  5IY4 A;  4RJF A;  5H0T A;  1IZ4 A;  2IX2 A;  2AWA A;  5IWD A;  2IZO B;  5B7O A;  3U5Z F;  2IX2 B;  2HII A;  3A1J C;  1PLQ A;  3GPM A;  4L60 A;  1W60 A;  3GGR B;  1AXC A;  4HK1 A;  2ZVW A;  3V61 B;  3G65 A;  1T6L A;  2HIK C;  5DA7 A;  3V62 B;  3LX2 A;  2NTI C;  3VKX A;  5E0V A;  1RXZ A;  1UL1 A;  1UD9 A;  5E0T A;  3K4X A;  3HSL X;  3TBL A;  1DML A;  1GE8 A;  2IJX A;  2IZO C;  5DAI A;  3IFV A;  3AIX A;  4D2G A;  2ZVM A;  5AUJ A;  2HII B;  3GGR C;  2Z0L A;  2OD8 A;  3AIZ C;  1RWZ A;  5JNE D;  1CZD A;  1ISQ A;  3V60 B;  3LX1 A;  4ZTD A;  3P91 A;  5A6D A;  3G65 B;  1B8H A;  1U7B A;  4CS5 A;  1PLR A;  1SXJ F;  5CFK A;  1RXM A;  3HI8 A;  3GPN A;  2IX2 C;  3P83 A;  4TR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...