5CFKA

Crystal structure of proliferating cell nuclear antigen from leishmania donovani at 3.2 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
256
structure length
253
Chain Sequence
MLEAQVQFASLWKRLVECINGLVNEANFDCNPGGLSVQAMDSSHVALVHMLLRDDCFVKYQCGRNSILGLNLASLSKVLKIVDSNDSLSLRHDDDSDVVTLTSENPEKTRKCEYQLKLLEIEAESMGIPEMDYRSTVTLNSAEFAKIVRDMQVFGDTVTIAISKEGVKFSSSGDVGQGYTFLQAAGVSDRGVEVTMEEPITLSFALRFMGIFAKGSTLSERVTLKFAKDSPCMVEYGIDNVGYLRYYLAPKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen,Proliferating cell nuclea
publication title Crystal structure of Proliferating Cell Nuclear Antigen from Leishmania donovani at 3.2 A resolution
rcsb
source organism Leishmania donovani
total genus 49
structure length 253
sequence length 256
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5cfkA00
5JNED 5CFKA 2HIIB 3GGRA 3HSLX 3U5ZF 3GPMA 3LX2A 1GE8A 1ISQA 2HIKA 4YHRA 3V61B 1B8HA 1RWZA 3G65C 5IY4A 2IJXA 3F1WA 1CZDA 1T6LA 3V62B 2HIKB 2OD8A 4D2GA 3K4XA 1U7BA 5IXAA 4ZTDA 3WGWA 3AIXB 1VYMA 1VYJA 5E0VA 1PLRA 1B77A 2NTIC 3P91A 5DAIA 3HI8A 1U76A 2IX2C 5A6DA 3FDSC 5E0TA 3AIXA 5B7OA 5DA7A 3U60F 3FDSD 1RXMA 3I2MX 2HIIC 1UL1A 3A1JC 3AIZC 5IWDA 2Z0LA 4RJFA 3IFVA 2AWAA 4CS5A 3G65B 5H0TA 3VKXA 2IZOC 1AXCA 2ZVMA 3GGRC 2IO4B 5HACA 1IZ4A 2NTIA 1UD9A 2HIKC 1YYPA 1W60A 2IX2A 2ZVLA 1RXZA 3A1JB 5E0UA 1SXJF 3G65A 4L60A 2ZVWA 2IO4A 1DMLA 2NTIB 1IZ5A 3P83A 3TBLA 2AVTA 4TR6A 2IZOB 3V60B 2IX2B 4L6PA 3GGRB 3GPNA 3LX1A 2ZVKA 1PLQA 2HIIA 3A2FB 3A1JA 3P87A 3AIZA 2ZVVA 5AUJA 4HK1A 3U61F
chains in the Genus database with same CATH superfamily
5JNED 5CFKA 2HIIB 3GGRA 3HSLX 3U5ZF 3GPMA 3LX2A 1GE8A 1ISQA 2HIKA 4YHRA 3V61B 1B8HA 1RWZA 3G65C 5IY4A 2IJXA 3F1WA 1CZDA 1T6LA 3V62B 2HIKB 2OD8A 4D2GA 3K4XA 1U7BA 5IXAA 4ZTDA 3WGWA 3AIXB 1VYMA 1VYJA 5E0VA 1PLRA 1B77A 2NTIC 3P91A 5DAIA 3HI8A 1U76A 2IX2C 5A6DA 3FDSC 5E0TA 3AIXA 5B7OA 5DA7A 3U60F 3FDSD 1RXMA 3I2MX 2HIIC 1UL1A 3A1JC 3AIZC 5IWDA 2Z0LA 4RJFA 3IFVA 2AWAA 4CS5A 3G65B 5H0TA 3VKXA 2IZOC 1AXCA 2ZVMA 3GGRC 2IO4B 5HACA 1IZ4A 2NTIA 1UD9A 2HIKC 1YYPA 1W60A 2IX2A 2ZVLA 1RXZA 3A1JB 5E0UA 1SXJF 3G65A 4L60A 2ZVWA 2IO4A 1DMLA 2NTIB 1IZ5A 3P83A 3TBLA 2AVTA 4TR6A 2IZOB 3V60B 2IX2B 4L6PA 3GGRB 3GPNA 3LX1A 2ZVKA 1PLQA 2HIIA 3A2FB 3A1JA 3P87A 3AIZA 2ZVVA 5AUJA 4HK1A 3U61F
chains in the Genus database with same CATH topology
5JNED 5CFKA 2HIIB 3GGRA 3HSLX 3U5ZF 3GPMA 3LX2A 1GE8A 1ISQA 2HIKA 4YHRA 3V61B 1B8HA 1RWZA 3G65C 5IY4A 2IJXA 3F1WA 1CZDA 1T6LA 3V62B 2HIKB 2OD8A 4D2GA 3K4XA 1U7BA 5IXAA 4ZTDA 3WGWA 3AIXB 1VYMA 1VYJA 5E0VA 1PLRA 1B77A 2NTIC 3P91A 5DAIA 3HI8A 1U76A 2IX2C 5A6DA 3FDSC 5E0TA 3AIXA 5B7OA 5DA7A 3U60F 3FDSD 1RXMA 3I2MX 2HIIC 1UL1A 3A1JC 3AIZC 5IWDA 2Z0LA 4RJFA 3IFVA 2AWAA 4CS5A 3G65B 5H0TA 3VKXA 2IZOC 1AXCA 2ZVMA 3GGRC 2IO4B 5HACA 1IZ4A 2NTIA 1UD9A 2HIKC 1YYPA 1W60A 2IX2A 2ZVLA 1RXZA 3A1JB 5E0UA 1SXJF 3G65A 4L60A 2ZVWA 2IO4A 1DMLA 2NTIB 1IZ5A 3P83A 3TBLA 2AVTA 4TR6A 2IZOB 3V60B 2IX2B 4L6PA 3GGRB 3GPNA 3LX1A 2ZVKA 1PLQA 2HIIA 3A2FB 3A1JA 3P87A 3AIZA 2ZVVA 5AUJA 4HK1A 3U61F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JNE D;  5CFK A;  2HII B;  3GGR A;  3HSL X;  3U5Z F;  3GPM A;  3LX2 A;  1GE8 A;  1ISQ A;  2HIK A;  4YHR A;  3V61 B;  1B8H A;  1RWZ A;  3G65 C;  5IY4 A;  2IJX A;  3F1W A;  1CZD A;  1T6L A;  3V62 B;  2HIK B;  2OD8 A;  4D2G A;  3K4X A;  1U7B A;  5IXA A;  4ZTD A;  3WGW A;  3AIX B;  1VYM A;  1VYJ A;  5E0V A;  1PLR A;  1B77 A;  2NTI C;  3P91 A;  5DAI A;  3HI8 A;  1U76 A;  2IX2 C;  5A6D A;  3FDS C;  5E0T A;  3AIX A;  5B7O A;  5DA7 A;  3U60 F;  3FDS D;  1RXM A;  3I2M X;  2HII C;  1UL1 A;  3A1J C;  3AIZ C;  5IWD A;  2Z0L A;  4RJF A;  3IFV A;  2AWA A;  4CS5 A;  3G65 B;  5H0T A;  3VKX A;  2IZO C;  1AXC A;  2ZVM A;  3GGR C;  2IO4 B;  5HAC A;  1IZ4 A;  2NTI A;  1UD9 A;  2HIK C;  1YYP A;  1W60 A;  2IX2 A;  2ZVL A;  1RXZ A;  3A1J B;  5E0U A;  1SXJ F;  3G65 A;  4L60 A;  2ZVW A;  2IO4 A;  1DML A;  2NTI B;  1IZ5 A;  3P83 A;  3TBL A;  2AVT A;  4TR6 A;  2IZO B;  3V60 B;  2IX2 B;  4L6P A;  3GGR B;  3GPN A;  3LX1 A;  2ZVK A;  1PLQ A;  2HII A;  3A2F B;  3A1J A;  3P87 A;  3AIZ A;  2ZVV A;  5AUJ A;  4HK1 A;  3U61 F; 
#chains in the Genus database with same CATH topology
 5JNE D;  5CFK A;  2HII B;  3GGR A;  3HSL X;  3U5Z F;  3GPM A;  3LX2 A;  1GE8 A;  1ISQ A;  2HIK A;  4YHR A;  3V61 B;  1B8H A;  1RWZ A;  3G65 C;  5IY4 A;  2IJX A;  3F1W A;  1CZD A;  1T6L A;  3V62 B;  2HIK B;  2OD8 A;  4D2G A;  3K4X A;  1U7B A;  5IXA A;  4ZTD A;  3WGW A;  3AIX B;  1VYM A;  1VYJ A;  5E0V A;  1PLR A;  1B77 A;  2NTI C;  3P91 A;  5DAI A;  3HI8 A;  1U76 A;  2IX2 C;  5A6D A;  3FDS C;  5E0T A;  3AIX A;  5B7O A;  5DA7 A;  3U60 F;  3FDS D;  1RXM A;  3I2M X;  2HII C;  1UL1 A;  3A1J C;  3AIZ C;  5IWD A;  2Z0L A;  4RJF A;  3IFV A;  2AWA A;  4CS5 A;  3G65 B;  5H0T A;  3VKX A;  2IZO C;  1AXC A;  2ZVM A;  3GGR C;  2IO4 B;  5HAC A;  1IZ4 A;  2NTI A;  1UD9 A;  2HIK C;  1YYP A;  1W60 A;  2IX2 A;  2ZVL A;  1RXZ A;  3A1J B;  5E0U A;  1SXJ F;  3G65 A;  4L60 A;  2ZVW A;  2IO4 A;  1DML A;  2NTI B;  1IZ5 A;  3P83 A;  3TBL A;  2AVT A;  4TR6 A;  2IZO B;  3V60 B;  2IX2 B;  4L6P A;  3GGR B;  3GPN A;  3LX1 A;  2ZVK A;  1PLQ A;  2HII A;  3A2F B;  3A1J A;  3P87 A;  3AIZ A;  2ZVV A;  5AUJ A;  4HK1 A;  3U61 F; 
#chains in the Genus database with same CATH homology
 5JNE D;  5CFK A;  2HII B;  3GGR A;  3HSL X;  3U5Z F;  3GPM A;  3LX2 A;  1GE8 A;  1ISQ A;  2HIK A;  4YHR A;  3V61 B;  1B8H A;  1RWZ A;  3G65 C;  5IY4 A;  2IJX A;  3F1W A;  1CZD A;  1T6L A;  3V62 B;  2HIK B;  2OD8 A;  4D2G A;  3K4X A;  1U7B A;  5IXA A;  4ZTD A;  3WGW A;  3AIX B;  1VYM A;  1VYJ A;  5E0V A;  1PLR A;  1B77 A;  2NTI C;  3P91 A;  5DAI A;  3HI8 A;  1U76 A;  2IX2 C;  5A6D A;  3FDS C;  5E0T A;  3AIX A;  5B7O A;  5DA7 A;  3U60 F;  3FDS D;  1RXM A;  3I2M X;  2HII C;  1UL1 A;  3A1J C;  3AIZ C;  5IWD A;  2Z0L A;  4RJF A;  3IFV A;  2AWA A;  4CS5 A;  3G65 B;  5H0T A;  3VKX A;  2IZO C;  1AXC A;  2ZVM A;  3GGR C;  2IO4 B;  5HAC A;  1IZ4 A;  2NTI A;  1UD9 A;  2HIK C;  1YYP A;  1W60 A;  2IX2 A;  2ZVL A;  1RXZ A;  3A1J B;  5E0U A;  1SXJ F;  3G65 A;  4L60 A;  2ZVW A;  2IO4 A;  1DML A;  2NTI B;  1IZ5 A;  3P83 A;  3TBL A;  2AVT A;  4TR6 A;  2IZO B;  3V60 B;  2IX2 B;  4L6P A;  3GGR B;  3GPN A;  3LX1 A;  2ZVK A;  1PLQ A;  2HII A;  3A2F B;  3A1J A;  3P87 A;  3AIZ A;  2ZVV A;  5AUJ A;  4HK1 A;  3U61 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...