5DA7A

Monomeric pcna bound to a small protein inhibitor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
PFEVVFDGAKEFADLIATASNLIDEAAFKFTEEGISMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDQFKKILKRGKAKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELELELPELPFTAKVVLLGEVLKEGIKDASLVSDAIKFIAKENEFTMKAEGETNEVEIRLTLEDEGLLDLEVEEETKSAYGIRYLSDMVKGIGKADEVILRFGNEMPLQMEYMIRDEGRLTFLLAPRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords DNA polymerase sliding clamp 1, Proliferating cell nuclear a
publication title A small protein inhibits proliferating cell nuclear antigen by breaking the DNA clamp.
pubmed doi rcsb
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
total genus 59
structure length 247
sequence length 247
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5da7A00
3A1JC 3U5ZF 1YYPA 3U60F 1T6LA 3GGRA 5IXAA 1PLRA 3K4XA 2OD8A 5AUJA 3A2FB 3G65C 1W60A 3HI8A 4CS5A 3V61B 1DMLA 3IFVA 3WGWA 2HIIC 2HIKC 2IX2C 3GPNA 5IY4A 2AVTA 2HIIB 2HIKB 5HACA 5E0VA 1AXCA 3AIXB 1UD9A 2IO4A 4ZTDA 5DAIA 3AIZC 3I2MX 3LX1A 2ZVVA 3A1JA 1B8HA 4TR6A 3GPMA 2ZVKA 5H0TA 5CFKA 3F1WA 3G65A 1UL1A 2AWAA 3VKXA 2IX2A 5E0UA 4D2GA 2NTIB 3LX2A 1RXZA 5E0TA 3GGRC 5B7OA 3GGRB 3AIZA 3P83A 4L60A 2ZVMA 3U61F 1U76A 4YHRA 3FDSC 1VYJA 5JNED 1U7BA 4RJFA 3V62B 2IO4B 2HIIA 2HIKA 2NTIC 2IZOB 3FDSD 3AIXA 1RXMA 1SXJF 3A1JB 5IWDA 4HK1A 4L6PA 2Z0LA 1ISQA 3V60B 1CZDA 1VYMA 1RWZA 1GE8A 2ZVLA 5DA7A 3G65B 3P91A 1IZ4A 1IZ5A 3HSLX 1B77A 1PLQA 2IX2B 2IZOC 3TBLA 5A6DA 2IJXA 3P87A 2ZVWA 2NTIA
chains in the Genus database with same CATH superfamily
3A1JC 3U5ZF 1YYPA 3U60F 1T6LA 3GGRA 5IXAA 1PLRA 3K4XA 2OD8A 5AUJA 3A2FB 3G65C 1W60A 3HI8A 4CS5A 3V61B 1DMLA 3IFVA 3WGWA 2HIIC 2HIKC 2IX2C 3GPNA 5IY4A 2AVTA 2HIIB 2HIKB 5HACA 5E0VA 1AXCA 3AIXB 1UD9A 2IO4A 4ZTDA 5DAIA 3AIZC 3I2MX 3LX1A 2ZVVA 3A1JA 1B8HA 4TR6A 3GPMA 2ZVKA 5H0TA 5CFKA 3F1WA 3G65A 1UL1A 2AWAA 3VKXA 2IX2A 5E0UA 4D2GA 2NTIB 3LX2A 1RXZA 5E0TA 3GGRC 5B7OA 3GGRB 3AIZA 3P83A 4L60A 2ZVMA 3U61F 1U76A 4YHRA 3FDSC 1VYJA 5JNED 1U7BA 4RJFA 3V62B 2IO4B 2HIIA 2HIKA 2NTIC 2IZOB 3FDSD 3AIXA 1RXMA 1SXJF 3A1JB 5IWDA 4HK1A 4L6PA 2Z0LA 1ISQA 3V60B 1CZDA 1VYMA 1RWZA 1GE8A 2ZVLA 5DA7A 3G65B 3P91A 1IZ4A 1IZ5A 3HSLX 1B77A 1PLQA 2IX2B 2IZOC 3TBLA 5A6DA 2IJXA 3P87A 2ZVWA 2NTIA
chains in the Genus database with same CATH topology
3A1JC 3U5ZF 1YYPA 3U60F 1T6LA 3GGRA 5IXAA 1PLRA 3K4XA 2OD8A 5AUJA 3A2FB 3G65C 1W60A 3HI8A 4CS5A 3V61B 1DMLA 3IFVA 3WGWA 2HIIC 2HIKC 2IX2C 3GPNA 5IY4A 2AVTA 2HIIB 2HIKB 5HACA 5E0VA 1AXCA 3AIXB 1UD9A 2IO4A 4ZTDA 5DAIA 3AIZC 3I2MX 3LX1A 2ZVVA 3A1JA 1B8HA 4TR6A 3GPMA 2ZVKA 5H0TA 5CFKA 3F1WA 3G65A 1UL1A 2AWAA 3VKXA 2IX2A 5E0UA 4D2GA 2NTIB 3LX2A 1RXZA 5E0TA 3GGRC 5B7OA 3GGRB 3AIZA 3P83A 4L60A 2ZVMA 3U61F 1U76A 4YHRA 3FDSC 1VYJA 5JNED 1U7BA 4RJFA 3V62B 2IO4B 2HIIA 2HIKA 2NTIC 2IZOB 3FDSD 3AIXA 1RXMA 1SXJF 3A1JB 5IWDA 4HK1A 4L6PA 2Z0LA 1ISQA 3V60B 1CZDA 1VYMA 1RWZA 1GE8A 2ZVLA 5DA7A 3G65B 3P91A 1IZ4A 1IZ5A 3HSLX 1B77A 1PLQA 2IX2B 2IZOC 3TBLA 5A6DA 2IJXA 3P87A 2ZVWA 2NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1J C;  3U5Z F;  1YYP A;  3U60 F;  1T6L A;  3GGR A;  5IXA A;  1PLR A;  3K4X A;  2OD8 A;  5AUJ A;  3A2F B;  3G65 C;  1W60 A;  3HI8 A;  4CS5 A;  3V61 B;  1DML A;  3IFV A;  3WGW A;  2HII C;  2HIK C;  2IX2 C;  3GPN A;  5IY4 A;  2AVT A;  2HII B;  2HIK B;  5HAC A;  5E0V A;  1AXC A;  3AIX B;  1UD9 A;  2IO4 A;  4ZTD A;  5DAI A;  3AIZ C;  3I2M X;  3LX1 A;  2ZVV A;  3A1J A;  1B8H A;  4TR6 A;  3GPM A;  2ZVK A;  5H0T A;  5CFK A;  3F1W A;  3G65 A;  1UL1 A;  2AWA A;  3VKX A;  2IX2 A;  5E0U A;  4D2G A;  2NTI B;  3LX2 A;  1RXZ A;  5E0T A;  3GGR C;  5B7O A;  3GGR B;  3AIZ A;  3P83 A;  4L60 A;  2ZVM A;  3U61 F;  1U76 A;  4YHR A;  3FDS C;  1VYJ A;  5JNE D;  1U7B A;  4RJF A;  3V62 B;  2IO4 B;  2HII A;  2HIK A;  2NTI C;  2IZO B;  3FDS D;  3AIX A;  1RXM A;  1SXJ F;  3A1J B;  5IWD A;  4HK1 A;  4L6P A;  2Z0L A;  1ISQ A;  3V60 B;  1CZD A;  1VYM A;  1RWZ A;  1GE8 A;  2ZVL A;  5DA7 A;  3G65 B;  3P91 A;  1IZ4 A;  1IZ5 A;  3HSL X;  1B77 A;  1PLQ A;  2IX2 B;  2IZO C;  3TBL A;  5A6D A;  2IJX A;  3P87 A;  2ZVW A;  2NTI A; 
#chains in the Genus database with same CATH topology
 3A1J C;  3U5Z F;  1YYP A;  3U60 F;  1T6L A;  3GGR A;  5IXA A;  1PLR A;  3K4X A;  2OD8 A;  5AUJ A;  3A2F B;  3G65 C;  1W60 A;  3HI8 A;  4CS5 A;  3V61 B;  1DML A;  3IFV A;  3WGW A;  2HII C;  2HIK C;  2IX2 C;  3GPN A;  5IY4 A;  2AVT A;  2HII B;  2HIK B;  5HAC A;  5E0V A;  1AXC A;  3AIX B;  1UD9 A;  2IO4 A;  4ZTD A;  5DAI A;  3AIZ C;  3I2M X;  3LX1 A;  2ZVV A;  3A1J A;  1B8H A;  4TR6 A;  3GPM A;  2ZVK A;  5H0T A;  5CFK A;  3F1W A;  3G65 A;  1UL1 A;  2AWA A;  3VKX A;  2IX2 A;  5E0U A;  4D2G A;  2NTI B;  3LX2 A;  1RXZ A;  5E0T A;  3GGR C;  5B7O A;  3GGR B;  3AIZ A;  3P83 A;  4L60 A;  2ZVM A;  3U61 F;  1U76 A;  4YHR A;  3FDS C;  1VYJ A;  5JNE D;  1U7B A;  4RJF A;  3V62 B;  2IO4 B;  2HII A;  2HIK A;  2NTI C;  2IZO B;  3FDS D;  3AIX A;  1RXM A;  1SXJ F;  3A1J B;  5IWD A;  4HK1 A;  4L6P A;  2Z0L A;  1ISQ A;  3V60 B;  1CZD A;  1VYM A;  1RWZ A;  1GE8 A;  2ZVL A;  5DA7 A;  3G65 B;  3P91 A;  1IZ4 A;  1IZ5 A;  3HSL X;  1B77 A;  1PLQ A;  2IX2 B;  2IZO C;  3TBL A;  5A6D A;  2IJX A;  3P87 A;  2ZVW A;  2NTI A; 
#chains in the Genus database with same CATH homology
 3A1J C;  3U5Z F;  1YYP A;  3U60 F;  1T6L A;  3GGR A;  5IXA A;  1PLR A;  3K4X A;  2OD8 A;  5AUJ A;  3A2F B;  3G65 C;  1W60 A;  3HI8 A;  4CS5 A;  3V61 B;  1DML A;  3IFV A;  3WGW A;  2HII C;  2HIK C;  2IX2 C;  3GPN A;  5IY4 A;  2AVT A;  2HII B;  2HIK B;  5HAC A;  5E0V A;  1AXC A;  3AIX B;  1UD9 A;  2IO4 A;  4ZTD A;  5DAI A;  3AIZ C;  3I2M X;  3LX1 A;  2ZVV A;  3A1J A;  1B8H A;  4TR6 A;  3GPM A;  2ZVK A;  5H0T A;  5CFK A;  3F1W A;  3G65 A;  1UL1 A;  2AWA A;  3VKX A;  2IX2 A;  5E0U A;  4D2G A;  2NTI B;  3LX2 A;  1RXZ A;  5E0T A;  3GGR C;  5B7O A;  3GGR B;  3AIZ A;  3P83 A;  4L60 A;  2ZVM A;  3U61 F;  1U76 A;  4YHR A;  3FDS C;  1VYJ A;  5JNE D;  1U7B A;  4RJF A;  3V62 B;  2IO4 B;  2HII A;  2HIK A;  2NTI C;  2IZO B;  3FDS D;  3AIX A;  1RXM A;  1SXJ F;  3A1J B;  5IWD A;  4HK1 A;  4L6P A;  2Z0L A;  1ISQ A;  3V60 B;  1CZD A;  1VYM A;  1RWZ A;  1GE8 A;  2ZVL A;  5DA7 A;  3G65 B;  3P91 A;  1IZ4 A;  1IZ5 A;  3HSL X;  1B77 A;  1PLQ A;  2IX2 B;  2IZO C;  3TBL A;  5A6D A;  2IJX A;  3P87 A;  2ZVW A;  2NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...