5DAIA

Proliferating cell nuclear antigen homolog 1 bound to fen-1 peptide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
PFEVVFDGAKEFADLIATASNLIDEAAFKFTEEGISMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDQFKKILKRGKAKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELELELPELPFTAKVVLLGEVLKEGIKDASLVSDAIKFIAKENEFTMKAEGETNEVEIRLTLEDEGLLDLEVEEETKSAYGIRYLSDMVKGIGKADEVILRFGNEMPLQMEYMIRDEGRLTFLLAPRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase sliding clamp 1
publication title A small protein inhibits proliferating cell nuclear antigen by breaking the DNA clamp.
pubmed doi rcsb
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
total genus 60
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5daiA00
2IZOC 2IX2B 3A1JB 1VYJA 3LX2A 5DA7A 2HIIC 1U7BA 4RJFA 3TBLA 5IWDA 3AIXA 3V60B 3I2MX 1IZ4A 1UL1A 5CFKA 1ISQA 1B8HA 1W60A 3IFVA 2ZVWA 3WGWA 1RWZA 3HI8A 3HSLX 5IXAA 3P87A 3GGRA 5E0TA 1RXZA 3G65B 1UD9A 3LX1A 1GE8A 3F1WA 3GGRB 5H0TA 3FDSC 2ZVVA 5AUJA 2HIKC 1YYPA 3AIZC 4ZTDA 2NTIC 5JNED 2AVTA 2IX2C 3A1JC 3AIXB 4TR6A 2ZVKA 4CS5A 2Z0LA 5DAIA 2IJXA 3P83A 3K4XA 3P91A 1U76A 3U5ZF 1B77A 2ZVMA 5IY4A 2IZOB 4YHRA 3U61F 2HIIA 1AXCA 5E0UA 5HACA 2HIKA 3GPMA 1DMLA 2HIIB 5A6DA 3U60F 1CZDA 2IX2A 3A1JA 2IO4A 3G65C 3FDSD 4HK1A 3GGRC 2IO4B 5E0VA 1PLQA 5B7OA 2ZVLA 3GPNA 3V62B 1PLRA 3V61B 1IZ5A 1RXMA 4L6PA 4L60A 2OD8A 1SXJF 3AIZA 3A2FB 1VYMA 2NTIA 3VKXA 1T6LA 3G65A 2HIKB 2AWAA 4D2GA 2NTIB
chains in the Genus database with same CATH superfamily
2IZOC 2IX2B 3A1JB 1VYJA 3LX2A 5DA7A 2HIIC 1U7BA 4RJFA 3TBLA 5IWDA 3AIXA 3V60B 3I2MX 1IZ4A 1UL1A 5CFKA 1ISQA 1B8HA 1W60A 3IFVA 2ZVWA 3WGWA 1RWZA 3HI8A 3HSLX 5IXAA 3P87A 3GGRA 5E0TA 1RXZA 3G65B 1UD9A 3LX1A 1GE8A 3F1WA 3GGRB 5H0TA 3FDSC 2ZVVA 5AUJA 2HIKC 1YYPA 3AIZC 4ZTDA 2NTIC 5JNED 2AVTA 2IX2C 3A1JC 3AIXB 4TR6A 2ZVKA 4CS5A 2Z0LA 5DAIA 2IJXA 3P83A 3K4XA 3P91A 1U76A 3U5ZF 1B77A 2ZVMA 5IY4A 2IZOB 4YHRA 3U61F 2HIIA 1AXCA 5E0UA 5HACA 2HIKA 3GPMA 1DMLA 2HIIB 5A6DA 3U60F 1CZDA 2IX2A 3A1JA 2IO4A 3G65C 3FDSD 4HK1A 3GGRC 2IO4B 5E0VA 1PLQA 5B7OA 2ZVLA 3GPNA 3V62B 1PLRA 3V61B 1IZ5A 1RXMA 4L6PA 4L60A 2OD8A 1SXJF 3AIZA 3A2FB 1VYMA 2NTIA 3VKXA 1T6LA 3G65A 2HIKB 2AWAA 4D2GA 2NTIB
chains in the Genus database with same CATH topology
2IZOC 2IX2B 3A1JB 1VYJA 3LX2A 5DA7A 2HIIC 1U7BA 4RJFA 3TBLA 5IWDA 3AIXA 3V60B 3I2MX 1IZ4A 1UL1A 5CFKA 1ISQA 1B8HA 1W60A 3IFVA 2ZVWA 3WGWA 1RWZA 3HI8A 3HSLX 5IXAA 3P87A 3GGRA 5E0TA 1RXZA 3G65B 1UD9A 3LX1A 1GE8A 3F1WA 3GGRB 5H0TA 3FDSC 2ZVVA 5AUJA 2HIKC 1YYPA 3AIZC 4ZTDA 2NTIC 5JNED 2AVTA 2IX2C 3A1JC 3AIXB 4TR6A 2ZVKA 4CS5A 2Z0LA 5DAIA 2IJXA 3P83A 3K4XA 3P91A 1U76A 3U5ZF 1B77A 2ZVMA 5IY4A 2IZOB 4YHRA 3U61F 2HIIA 1AXCA 5E0UA 5HACA 2HIKA 3GPMA 1DMLA 2HIIB 5A6DA 3U60F 1CZDA 2IX2A 3A1JA 2IO4A 3G65C 3FDSD 4HK1A 3GGRC 2IO4B 5E0VA 1PLQA 5B7OA 2ZVLA 3GPNA 3V62B 1PLRA 3V61B 1IZ5A 1RXMA 4L6PA 4L60A 2OD8A 1SXJF 3AIZA 3A2FB 1VYMA 2NTIA 3VKXA 1T6LA 3G65A 2HIKB 2AWAA 4D2GA 2NTIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZO C;  2IX2 B;  3A1J B;  1VYJ A;  3LX2 A;  5DA7 A;  2HII C;  1U7B A;  4RJF A;  3TBL A;  5IWD A;  3AIX A;  3V60 B;  3I2M X;  1IZ4 A;  1UL1 A;  5CFK A;  1ISQ A;  1B8H A;  1W60 A;  3IFV A;  2ZVW A;  3WGW A;  1RWZ A;  3HI8 A;  3HSL X;  5IXA A;  3P87 A;  3GGR A;  5E0T A;  1RXZ A;  3G65 B;  1UD9 A;  3LX1 A;  1GE8 A;  3F1W A;  3GGR B;  5H0T A;  3FDS C;  2ZVV A;  5AUJ A;  2HIK C;  1YYP A;  3AIZ C;  4ZTD A;  2NTI C;  5JNE D;  2AVT A;  2IX2 C;  3A1J C;  3AIX B;  4TR6 A;  2ZVK A;  4CS5 A;  2Z0L A;  5DAI A;  2IJX A;  3P83 A;  3K4X A;  3P91 A;  1U76 A;  3U5Z F;  1B77 A;  2ZVM A;  5IY4 A;  2IZO B;  4YHR A;  3U61 F;  2HII A;  1AXC A;  5E0U A;  5HAC A;  2HIK A;  3GPM A;  1DML A;  2HII B;  5A6D A;  3U60 F;  1CZD A;  2IX2 A;  3A1J A;  2IO4 A;  3G65 C;  3FDS D;  4HK1 A;  3GGR C;  2IO4 B;  5E0V A;  1PLQ A;  5B7O A;  2ZVL A;  3GPN A;  3V62 B;  1PLR A;  3V61 B;  1IZ5 A;  1RXM A;  4L6P A;  4L60 A;  2OD8 A;  1SXJ F;  3AIZ A;  3A2F B;  1VYM A;  2NTI A;  3VKX A;  1T6L A;  3G65 A;  2HIK B;  2AWA A;  4D2G A;  2NTI B; 
#chains in the Genus database with same CATH topology
 2IZO C;  2IX2 B;  3A1J B;  1VYJ A;  3LX2 A;  5DA7 A;  2HII C;  1U7B A;  4RJF A;  3TBL A;  5IWD A;  3AIX A;  3V60 B;  3I2M X;  1IZ4 A;  1UL1 A;  5CFK A;  1ISQ A;  1B8H A;  1W60 A;  3IFV A;  2ZVW A;  3WGW A;  1RWZ A;  3HI8 A;  3HSL X;  5IXA A;  3P87 A;  3GGR A;  5E0T A;  1RXZ A;  3G65 B;  1UD9 A;  3LX1 A;  1GE8 A;  3F1W A;  3GGR B;  5H0T A;  3FDS C;  2ZVV A;  5AUJ A;  2HIK C;  1YYP A;  3AIZ C;  4ZTD A;  2NTI C;  5JNE D;  2AVT A;  2IX2 C;  3A1J C;  3AIX B;  4TR6 A;  2ZVK A;  4CS5 A;  2Z0L A;  5DAI A;  2IJX A;  3P83 A;  3K4X A;  3P91 A;  1U76 A;  3U5Z F;  1B77 A;  2ZVM A;  5IY4 A;  2IZO B;  4YHR A;  3U61 F;  2HII A;  1AXC A;  5E0U A;  5HAC A;  2HIK A;  3GPM A;  1DML A;  2HII B;  5A6D A;  3U60 F;  1CZD A;  2IX2 A;  3A1J A;  2IO4 A;  3G65 C;  3FDS D;  4HK1 A;  3GGR C;  2IO4 B;  5E0V A;  1PLQ A;  5B7O A;  2ZVL A;  3GPN A;  3V62 B;  1PLR A;  3V61 B;  1IZ5 A;  1RXM A;  4L6P A;  4L60 A;  2OD8 A;  1SXJ F;  3AIZ A;  3A2F B;  1VYM A;  2NTI A;  3VKX A;  1T6L A;  3G65 A;  2HIK B;  2AWA A;  4D2G A;  2NTI B; 
#chains in the Genus database with same CATH homology
 2IZO C;  2IX2 B;  3A1J B;  1VYJ A;  3LX2 A;  5DA7 A;  2HII C;  1U7B A;  4RJF A;  3TBL A;  5IWD A;  3AIX A;  3V60 B;  3I2M X;  1IZ4 A;  1UL1 A;  5CFK A;  1ISQ A;  1B8H A;  1W60 A;  3IFV A;  2ZVW A;  3WGW A;  1RWZ A;  3HI8 A;  3HSL X;  5IXA A;  3P87 A;  3GGR A;  5E0T A;  1RXZ A;  3G65 B;  1UD9 A;  3LX1 A;  1GE8 A;  3F1W A;  3GGR B;  5H0T A;  3FDS C;  2ZVV A;  5AUJ A;  2HIK C;  1YYP A;  3AIZ C;  4ZTD A;  2NTI C;  5JNE D;  2AVT A;  2IX2 C;  3A1J C;  3AIX B;  4TR6 A;  2ZVK A;  4CS5 A;  2Z0L A;  5DAI A;  2IJX A;  3P83 A;  3K4X A;  3P91 A;  1U76 A;  3U5Z F;  1B77 A;  2ZVM A;  5IY4 A;  2IZO B;  4YHR A;  3U61 F;  2HII A;  1AXC A;  5E0U A;  5HAC A;  2HIK A;  3GPM A;  1DML A;  2HII B;  5A6D A;  3U60 F;  1CZD A;  2IX2 A;  3A1J A;  2IO4 A;  3G65 C;  3FDS D;  4HK1 A;  3GGR C;  2IO4 B;  5E0V A;  1PLQ A;  5B7O A;  2ZVL A;  3GPN A;  3V62 B;  1PLR A;  3V61 B;  1IZ5 A;  1RXM A;  4L6P A;  4L60 A;  2OD8 A;  1SXJ F;  3AIZ A;  3A2F B;  1VYM A;  2NTI A;  3VKX A;  1T6L A;  3G65 A;  2HIK B;  2AWA A;  4D2G A;  2NTI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...