5E0TA

Human pcna mutant - s228i
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
255
structure length
248
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title A Disease-Causing Variant in PCNA Disrupts a Promiscuous Protein Binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 248
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5e0tA00
1B77A 3IFVA 5IY4A 3P87A 1W60A 2HIIA 3FDSD 3GPNA 3A2FB 2HIIB 1U76A 1RWZA 3TBLA 1ISQA 3HI8A 4RJFA 3GGRC 5DA7A 2Z0LA 5E0VA 1RXMA 1VYMA 1RXZA 1U7BA 5CFKA 1PLRA 3A1JC 4TR6A 5A6DA 3V62B 2ZVMA 2HIKC 1CZDA 3FDSC 3U5ZF 3P91A 3U61F 3AIZA 2IZOC 5JNED 4L60A 1UL1A 3GGRB 1PLQA 2IJXA 1IZ5A 2IX2A 3V60B 3LX1A 3WGWA 5IXAA 1DMLA 2ZVWA 2IX2B 3A1JA 1AXCA 3A1JB 1YYPA 2HIKA 1B8HA 2AVTA 4CS5A 2HIKB 1IZ4A 3U60F 1SXJF 2HIIC 1UD9A 3P83A 3I2MX 5IWDA 3V61B 5HACA 3K4XA 3HSLX 3GGRA 2ZVLA 2AWAA 4YHRA 3AIXA 3LX2A 2NTIC 3AIXB 2IO4A 3G65C 5E0TA 2IO4B 4L6PA 3GPMA 1GE8A 4D2GA 5E0UA 5B7OA 4HK1A 4ZTDA 2ZVVA 3VKXA 2OD8A 3AIZC 5DAIA 2IZOB 1T6LA 2NTIA 5H0TA 2NTIB 3G65A 3G65B 2IX2C 1VYJA 3F1WA 2ZVKA 5AUJA
chains in the Genus database with same CATH superfamily
1B77A 3IFVA 5IY4A 3P87A 1W60A 2HIIA 3FDSD 3GPNA 3A2FB 2HIIB 1U76A 1RWZA 3TBLA 1ISQA 3HI8A 4RJFA 3GGRC 5DA7A 2Z0LA 5E0VA 1RXMA 1VYMA 1RXZA 1U7BA 5CFKA 1PLRA 3A1JC 4TR6A 5A6DA 3V62B 2ZVMA 2HIKC 1CZDA 3FDSC 3U5ZF 3P91A 3U61F 3AIZA 2IZOC 5JNED 4L60A 1UL1A 3GGRB 1PLQA 2IJXA 1IZ5A 2IX2A 3V60B 3LX1A 3WGWA 5IXAA 1DMLA 2ZVWA 2IX2B 3A1JA 1AXCA 3A1JB 1YYPA 2HIKA 1B8HA 2AVTA 4CS5A 2HIKB 1IZ4A 3U60F 1SXJF 2HIIC 1UD9A 3P83A 3I2MX 5IWDA 3V61B 5HACA 3K4XA 3HSLX 3GGRA 2ZVLA 2AWAA 4YHRA 3AIXA 3LX2A 2NTIC 3AIXB 2IO4A 3G65C 5E0TA 2IO4B 4L6PA 3GPMA 1GE8A 4D2GA 5E0UA 5B7OA 4HK1A 4ZTDA 2ZVVA 3VKXA 2OD8A 3AIZC 5DAIA 2IZOB 1T6LA 2NTIA 5H0TA 2NTIB 3G65A 3G65B 2IX2C 1VYJA 3F1WA 2ZVKA 5AUJA
chains in the Genus database with same CATH topology
1B77A 3IFVA 5IY4A 3P87A 1W60A 2HIIA 3FDSD 3GPNA 3A2FB 2HIIB 1U76A 1RWZA 3TBLA 1ISQA 3HI8A 4RJFA 3GGRC 5DA7A 2Z0LA 5E0VA 1RXMA 1VYMA 1RXZA 1U7BA 5CFKA 1PLRA 3A1JC 4TR6A 5A6DA 3V62B 2ZVMA 2HIKC 1CZDA 3FDSC 3U5ZF 3P91A 3U61F 3AIZA 2IZOC 5JNED 4L60A 1UL1A 3GGRB 1PLQA 2IJXA 1IZ5A 2IX2A 3V60B 3LX1A 3WGWA 5IXAA 1DMLA 2ZVWA 2IX2B 3A1JA 1AXCA 3A1JB 1YYPA 2HIKA 1B8HA 2AVTA 4CS5A 2HIKB 1IZ4A 3U60F 1SXJF 2HIIC 1UD9A 3P83A 3I2MX 5IWDA 3V61B 5HACA 3K4XA 3HSLX 3GGRA 2ZVLA 2AWAA 4YHRA 3AIXA 3LX2A 2NTIC 3AIXB 2IO4A 3G65C 5E0TA 2IO4B 4L6PA 3GPMA 1GE8A 4D2GA 5E0UA 5B7OA 4HK1A 4ZTDA 2ZVVA 3VKXA 2OD8A 3AIZC 5DAIA 2IZOB 1T6LA 2NTIA 5H0TA 2NTIB 3G65A 3G65B 2IX2C 1VYJA 3F1WA 2ZVKA 5AUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B77 A;  3IFV A;  5IY4 A;  3P87 A;  1W60 A;  2HII A;  3FDS D;  3GPN A;  3A2F B;  2HII B;  1U76 A;  1RWZ A;  3TBL A;  1ISQ A;  3HI8 A;  4RJF A;  3GGR C;  5DA7 A;  2Z0L A;  5E0V A;  1RXM A;  1VYM A;  1RXZ A;  1U7B A;  5CFK A;  1PLR A;  3A1J C;  4TR6 A;  5A6D A;  3V62 B;  2ZVM A;  2HIK C;  1CZD A;  3FDS C;  3U5Z F;  3P91 A;  3U61 F;  3AIZ A;  2IZO C;  5JNE D;  4L60 A;  1UL1 A;  3GGR B;  1PLQ A;  2IJX A;  1IZ5 A;  2IX2 A;  3V60 B;  3LX1 A;  3WGW A;  5IXA A;  1DML A;  2ZVW A;  2IX2 B;  3A1J A;  1AXC A;  3A1J B;  1YYP A;  2HIK A;  1B8H A;  2AVT A;  4CS5 A;  2HIK B;  1IZ4 A;  3U60 F;  1SXJ F;  2HII C;  1UD9 A;  3P83 A;  3I2M X;  5IWD A;  3V61 B;  5HAC A;  3K4X A;  3HSL X;  3GGR A;  2ZVL A;  2AWA A;  4YHR A;  3AIX A;  3LX2 A;  2NTI C;  3AIX B;  2IO4 A;  3G65 C;  5E0T A;  2IO4 B;  4L6P A;  3GPM A;  1GE8 A;  4D2G A;  5E0U A;  5B7O A;  4HK1 A;  4ZTD A;  2ZVV A;  3VKX A;  2OD8 A;  3AIZ C;  5DAI A;  2IZO B;  1T6L A;  2NTI A;  5H0T A;  2NTI B;  3G65 A;  3G65 B;  2IX2 C;  1VYJ A;  3F1W A;  2ZVK A;  5AUJ A; 
#chains in the Genus database with same CATH topology
 1B77 A;  3IFV A;  5IY4 A;  3P87 A;  1W60 A;  2HII A;  3FDS D;  3GPN A;  3A2F B;  2HII B;  1U76 A;  1RWZ A;  3TBL A;  1ISQ A;  3HI8 A;  4RJF A;  3GGR C;  5DA7 A;  2Z0L A;  5E0V A;  1RXM A;  1VYM A;  1RXZ A;  1U7B A;  5CFK A;  1PLR A;  3A1J C;  4TR6 A;  5A6D A;  3V62 B;  2ZVM A;  2HIK C;  1CZD A;  3FDS C;  3U5Z F;  3P91 A;  3U61 F;  3AIZ A;  2IZO C;  5JNE D;  4L60 A;  1UL1 A;  3GGR B;  1PLQ A;  2IJX A;  1IZ5 A;  2IX2 A;  3V60 B;  3LX1 A;  3WGW A;  5IXA A;  1DML A;  2ZVW A;  2IX2 B;  3A1J A;  1AXC A;  3A1J B;  1YYP A;  2HIK A;  1B8H A;  2AVT A;  4CS5 A;  2HIK B;  1IZ4 A;  3U60 F;  1SXJ F;  2HII C;  1UD9 A;  3P83 A;  3I2M X;  5IWD A;  3V61 B;  5HAC A;  3K4X A;  3HSL X;  3GGR A;  2ZVL A;  2AWA A;  4YHR A;  3AIX A;  3LX2 A;  2NTI C;  3AIX B;  2IO4 A;  3G65 C;  5E0T A;  2IO4 B;  4L6P A;  3GPM A;  1GE8 A;  4D2G A;  5E0U A;  5B7O A;  4HK1 A;  4ZTD A;  2ZVV A;  3VKX A;  2OD8 A;  3AIZ C;  5DAI A;  2IZO B;  1T6L A;  2NTI A;  5H0T A;  2NTI B;  3G65 A;  3G65 B;  2IX2 C;  1VYJ A;  3F1W A;  2ZVK A;  5AUJ A; 
#chains in the Genus database with same CATH homology
 1B77 A;  3IFV A;  5IY4 A;  3P87 A;  1W60 A;  2HII A;  3FDS D;  3GPN A;  3A2F B;  2HII B;  1U76 A;  1RWZ A;  3TBL A;  1ISQ A;  3HI8 A;  4RJF A;  3GGR C;  5DA7 A;  2Z0L A;  5E0V A;  1RXM A;  1VYM A;  1RXZ A;  1U7B A;  5CFK A;  1PLR A;  3A1J C;  4TR6 A;  5A6D A;  3V62 B;  2ZVM A;  2HIK C;  1CZD A;  3FDS C;  3U5Z F;  3P91 A;  3U61 F;  3AIZ A;  2IZO C;  5JNE D;  4L60 A;  1UL1 A;  3GGR B;  1PLQ A;  2IJX A;  1IZ5 A;  2IX2 A;  3V60 B;  3LX1 A;  3WGW A;  5IXA A;  1DML A;  2ZVW A;  2IX2 B;  3A1J A;  1AXC A;  3A1J B;  1YYP A;  2HIK A;  1B8H A;  2AVT A;  4CS5 A;  2HIK B;  1IZ4 A;  3U60 F;  1SXJ F;  2HII C;  1UD9 A;  3P83 A;  3I2M X;  5IWD A;  3V61 B;  5HAC A;  3K4X A;  3HSL X;  3GGR A;  2ZVL A;  2AWA A;  4YHR A;  3AIX A;  3LX2 A;  2NTI C;  3AIX B;  2IO4 A;  3G65 C;  5E0T A;  2IO4 B;  4L6P A;  3GPM A;  1GE8 A;  4D2G A;  5E0U A;  5B7O A;  4HK1 A;  4ZTD A;  2ZVV A;  3VKX A;  2OD8 A;  3AIZ C;  5DAI A;  2IZO B;  1T6L A;  2NTI A;  5H0T A;  2NTI B;  3G65 A;  3G65 B;  2IX2 C;  1VYJ A;  3F1W A;  2ZVK A;  5AUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...