5E0VA

Human pcna variant (s228i) complexed with fen1 at 2.1 angstroms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
249
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title A Disease-Causing Variant in PCNA Disrupts a Promiscuous Protein Binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 249
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5e0vA00
2HIKA 2NTIA 2HIIA 2IZOB 5B7OA 3WGWA 3GGRC 1W60A 2ZVWA 1GE8A 3GPMA 3P91A 2Z0LA 5AUJA 5HACA 3A1JC 3U60F 1UL1A 2AWAA 4ZTDA 5A6DA 2IX2B 1PLQA 3LX2A 1U76A 5H0TA 3F1WA 1ISQA 1RXZA 2IO4B 2IX2A 5E0TA 1UD9A 1PLRA 2AVTA 3G65B 3TBLA 3U61F 5E0UA 5CFKA 3AIZA 3GGRB 4YHRA 2IO4A 3K4XA 1IZ4A 3FDSC 1DMLA 2ZVKA 4D2GA 3HSLX 2IJXA 1VYMA 4HK1A 2NTIC 2HIKC 3G65A 2HIIC 2OD8A 3A1JB 4L60A 4L6PA 3GGRA 3VKXA 2NTIB 3A1JA 1T6LA 4RJFA 3HI8A 1AXCA 1SXJF 5DA7A 2ZVLA 1VYJA 3I2MX 3LX1A 3V60B 1B8HA 5DAIA 3AIXB 3P83A 1CZDA 5IY4A 5E0VA 1RWZA 3GPNA 2IX2C 1YYPA 3V62B 5JNED 1IZ5A 4CS5A 2HIKB 3U5ZF 2HIIB 4TR6A 1B77A 5IWDA 2ZVMA 2IZOC 3AIZC 2ZVVA 3AIXA 3IFVA 3V61B 5IXAA 3A2FB 1U7BA 3FDSD 3G65C 3P87A 1RXMA
chains in the Genus database with same CATH superfamily
2HIKA 2NTIA 2HIIA 2IZOB 5B7OA 3WGWA 3GGRC 1W60A 2ZVWA 1GE8A 3GPMA 3P91A 2Z0LA 5AUJA 5HACA 3A1JC 3U60F 1UL1A 2AWAA 4ZTDA 5A6DA 2IX2B 1PLQA 3LX2A 1U76A 5H0TA 3F1WA 1ISQA 1RXZA 2IO4B 2IX2A 5E0TA 1UD9A 1PLRA 2AVTA 3G65B 3TBLA 3U61F 5E0UA 5CFKA 3AIZA 3GGRB 4YHRA 2IO4A 3K4XA 1IZ4A 3FDSC 1DMLA 2ZVKA 4D2GA 3HSLX 2IJXA 1VYMA 4HK1A 2NTIC 2HIKC 3G65A 2HIIC 2OD8A 3A1JB 4L60A 4L6PA 3GGRA 3VKXA 2NTIB 3A1JA 1T6LA 4RJFA 3HI8A 1AXCA 1SXJF 5DA7A 2ZVLA 1VYJA 3I2MX 3LX1A 3V60B 1B8HA 5DAIA 3AIXB 3P83A 1CZDA 5IY4A 5E0VA 1RWZA 3GPNA 2IX2C 1YYPA 3V62B 5JNED 1IZ5A 4CS5A 2HIKB 3U5ZF 2HIIB 4TR6A 1B77A 5IWDA 2ZVMA 2IZOC 3AIZC 2ZVVA 3AIXA 3IFVA 3V61B 5IXAA 3A2FB 1U7BA 3FDSD 3G65C 3P87A 1RXMA
chains in the Genus database with same CATH topology
2HIKA 2NTIA 2HIIA 2IZOB 5B7OA 3WGWA 3GGRC 1W60A 2ZVWA 1GE8A 3GPMA 3P91A 2Z0LA 5AUJA 5HACA 3A1JC 3U60F 1UL1A 2AWAA 4ZTDA 5A6DA 2IX2B 1PLQA 3LX2A 1U76A 5H0TA 3F1WA 1ISQA 1RXZA 2IO4B 2IX2A 5E0TA 1UD9A 1PLRA 2AVTA 3G65B 3TBLA 3U61F 5E0UA 5CFKA 3AIZA 3GGRB 4YHRA 2IO4A 3K4XA 1IZ4A 3FDSC 1DMLA 2ZVKA 4D2GA 3HSLX 2IJXA 1VYMA 4HK1A 2NTIC 2HIKC 3G65A 2HIIC 2OD8A 3A1JB 4L60A 4L6PA 3GGRA 3VKXA 2NTIB 3A1JA 1T6LA 4RJFA 3HI8A 1AXCA 1SXJF 5DA7A 2ZVLA 1VYJA 3I2MX 3LX1A 3V60B 1B8HA 5DAIA 3AIXB 3P83A 1CZDA 5IY4A 5E0VA 1RWZA 3GPNA 2IX2C 1YYPA 3V62B 5JNED 1IZ5A 4CS5A 2HIKB 3U5ZF 2HIIB 4TR6A 1B77A 5IWDA 2ZVMA 2IZOC 3AIZC 2ZVVA 3AIXA 3IFVA 3V61B 5IXAA 3A2FB 1U7BA 3FDSD 3G65C 3P87A 1RXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIK A;  2NTI A;  2HII A;  2IZO B;  5B7O A;  3WGW A;  3GGR C;  1W60 A;  2ZVW A;  1GE8 A;  3GPM A;  3P91 A;  2Z0L A;  5AUJ A;  5HAC A;  3A1J C;  3U60 F;  1UL1 A;  2AWA A;  4ZTD A;  5A6D A;  2IX2 B;  1PLQ A;  3LX2 A;  1U76 A;  5H0T A;  3F1W A;  1ISQ A;  1RXZ A;  2IO4 B;  2IX2 A;  5E0T A;  1UD9 A;  1PLR A;  2AVT A;  3G65 B;  3TBL A;  3U61 F;  5E0U A;  5CFK A;  3AIZ A;  3GGR B;  4YHR A;  2IO4 A;  3K4X A;  1IZ4 A;  3FDS C;  1DML A;  2ZVK A;  4D2G A;  3HSL X;  2IJX A;  1VYM A;  4HK1 A;  2NTI C;  2HIK C;  3G65 A;  2HII C;  2OD8 A;  3A1J B;  4L60 A;  4L6P A;  3GGR A;  3VKX A;  2NTI B;  3A1J A;  1T6L A;  4RJF A;  3HI8 A;  1AXC A;  1SXJ F;  5DA7 A;  2ZVL A;  1VYJ A;  3I2M X;  3LX1 A;  3V60 B;  1B8H A;  5DAI A;  3AIX B;  3P83 A;  1CZD A;  5IY4 A;  5E0V A;  1RWZ A;  3GPN A;  2IX2 C;  1YYP A;  3V62 B;  5JNE D;  1IZ5 A;  4CS5 A;  2HIK B;  3U5Z F;  2HII B;  4TR6 A;  1B77 A;  5IWD A;  2ZVM A;  2IZO C;  3AIZ C;  2ZVV A;  3AIX A;  3IFV A;  3V61 B;  5IXA A;  3A2F B;  1U7B A;  3FDS D;  3G65 C;  3P87 A;  1RXM A; 
#chains in the Genus database with same CATH topology
 2HIK A;  2NTI A;  2HII A;  2IZO B;  5B7O A;  3WGW A;  3GGR C;  1W60 A;  2ZVW A;  1GE8 A;  3GPM A;  3P91 A;  2Z0L A;  5AUJ A;  5HAC A;  3A1J C;  3U60 F;  1UL1 A;  2AWA A;  4ZTD A;  5A6D A;  2IX2 B;  1PLQ A;  3LX2 A;  1U76 A;  5H0T A;  3F1W A;  1ISQ A;  1RXZ A;  2IO4 B;  2IX2 A;  5E0T A;  1UD9 A;  1PLR A;  2AVT A;  3G65 B;  3TBL A;  3U61 F;  5E0U A;  5CFK A;  3AIZ A;  3GGR B;  4YHR A;  2IO4 A;  3K4X A;  1IZ4 A;  3FDS C;  1DML A;  2ZVK A;  4D2G A;  3HSL X;  2IJX A;  1VYM A;  4HK1 A;  2NTI C;  2HIK C;  3G65 A;  2HII C;  2OD8 A;  3A1J B;  4L60 A;  4L6P A;  3GGR A;  3VKX A;  2NTI B;  3A1J A;  1T6L A;  4RJF A;  3HI8 A;  1AXC A;  1SXJ F;  5DA7 A;  2ZVL A;  1VYJ A;  3I2M X;  3LX1 A;  3V60 B;  1B8H A;  5DAI A;  3AIX B;  3P83 A;  1CZD A;  5IY4 A;  5E0V A;  1RWZ A;  3GPN A;  2IX2 C;  1YYP A;  3V62 B;  5JNE D;  1IZ5 A;  4CS5 A;  2HIK B;  3U5Z F;  2HII B;  4TR6 A;  1B77 A;  5IWD A;  2ZVM A;  2IZO C;  3AIZ C;  2ZVV A;  3AIX A;  3IFV A;  3V61 B;  5IXA A;  3A2F B;  1U7B A;  3FDS D;  3G65 C;  3P87 A;  1RXM A; 
#chains in the Genus database with same CATH homology
 2HIK A;  2NTI A;  2HII A;  2IZO B;  5B7O A;  3WGW A;  3GGR C;  1W60 A;  2ZVW A;  1GE8 A;  3GPM A;  3P91 A;  2Z0L A;  5AUJ A;  5HAC A;  3A1J C;  3U60 F;  1UL1 A;  2AWA A;  4ZTD A;  5A6D A;  2IX2 B;  1PLQ A;  3LX2 A;  1U76 A;  5H0T A;  3F1W A;  1ISQ A;  1RXZ A;  2IO4 B;  2IX2 A;  5E0T A;  1UD9 A;  1PLR A;  2AVT A;  3G65 B;  3TBL A;  3U61 F;  5E0U A;  5CFK A;  3AIZ A;  3GGR B;  4YHR A;  2IO4 A;  3K4X A;  1IZ4 A;  3FDS C;  1DML A;  2ZVK A;  4D2G A;  3HSL X;  2IJX A;  1VYM A;  4HK1 A;  2NTI C;  2HIK C;  3G65 A;  2HII C;  2OD8 A;  3A1J B;  4L60 A;  4L6P A;  3GGR A;  3VKX A;  2NTI B;  3A1J A;  1T6L A;  4RJF A;  3HI8 A;  1AXC A;  1SXJ F;  5DA7 A;  2ZVL A;  1VYJ A;  3I2M X;  3LX1 A;  3V60 B;  1B8H A;  5DAI A;  3AIX B;  3P83 A;  1CZD A;  5IY4 A;  5E0V A;  1RWZ A;  3GPN A;  2IX2 C;  1YYP A;  3V62 B;  5JNE D;  1IZ5 A;  4CS5 A;  2HIK B;  3U5Z F;  2HII B;  4TR6 A;  1B77 A;  5IWD A;  2ZVM A;  2IZO C;  3AIZ C;  2ZVV A;  3AIX A;  3IFV A;  3V61 B;  5IXA A;  3A2F B;  1U7B A;  3FDS D;  3G65 C;  3P87 A;  1RXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...