5H0TA

Crystal structure of proliferating cell nuclear antigen from leishmania donovani at 2.73 angstrom resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
289
structure length
248
Chain Sequence
MLEAQVQFASLWKRLVECINGLVNEANFDCNPGGLSVQAMDSSHVALVHMLLRDDCFVKYQCGRNSILGLNLASLSKVLKIVDSNDSLSLRHDDDSDVVTLTSENPEKTRKCEYQLKLLEIEAESMGIPEMDYRSTVTLNSAEFAKIVRDMQVFGDTVTIAISKEGVKFSSSGDVGQGYTFLQAAGVEVTMEEPITLSFALRFMGIFAKGSTLSERVTLKFAKDSPCMVEYGIDNVGYLRYYLAPKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Structure and binding studies of proliferating cell nuclear antigen from Leishmania donovani.
pubmed doi rcsb
source organism Leishmania donovani
total genus 56
structure length 248
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5h0tA00
3V60B 1RXMA 5B7OA 1IZ5A 1VYMA 2HIKC 3HSLX 3G65C 4CS5A 4YHRA 4TR6A 3P87A 1CZDA 2IZOC 5IXAA 1AXCA 3LX1A 3AIZC 3V61B 2IX2B 2AWAA 2IX2A 2NTIC 3GGRC 2Z0LA 4L6PA 5CFKA 3P83A 3A1JA 3LX2A 3U61F 2HIIC 3I2MX 1U76A 3P91A 3K4XA 2ZVLA 2HIKA 1RWZA 3U60F 1DMLA 3A2FB 1UL1A 1U7BA 5IWDA 3WGWA 1B77A 1PLRA 5E0TA 3V62B 2NTIA 1ISQA 3GGRA 5A6DA 3A1JB 5JNED 3U5ZF 4ZTDA 2HIIA 2HIKB 3G65B 4HK1A 3VKXA 2ZVVA 1RXZA 3G65A 1T6LA 2IX2C 5DAIA 5DA7A 3IFVA 2IZOB 1GE8A 3HI8A 3F1WA 3AIXB 2IO4A 3AIZA 3AIXA 3A1JC 2NTIB 5AUJA 4L60A 3GGRB 2AVTA 5H0TA 1B8HA 2IJXA 1SXJF 3GPNA 1UD9A 2HIIB 5E0UA 1YYPA 2ZVWA 1VYJA 1IZ4A 2OD8A 1PLQA 2ZVMA 5HACA 1W60A 4D2GA 3GPMA 3FDSC 3FDSD 4RJFA 2IO4B 3TBLA 5IY4A 2ZVKA 5E0VA
chains in the Genus database with same CATH superfamily
3V60B 1RXMA 5B7OA 1IZ5A 1VYMA 2HIKC 3HSLX 3G65C 4CS5A 4YHRA 4TR6A 3P87A 1CZDA 2IZOC 5IXAA 1AXCA 3LX1A 3AIZC 3V61B 2IX2B 2AWAA 2IX2A 2NTIC 3GGRC 2Z0LA 4L6PA 5CFKA 3P83A 3A1JA 3LX2A 3U61F 2HIIC 3I2MX 1U76A 3P91A 3K4XA 2ZVLA 2HIKA 1RWZA 3U60F 1DMLA 3A2FB 1UL1A 1U7BA 5IWDA 3WGWA 1B77A 1PLRA 5E0TA 3V62B 2NTIA 1ISQA 3GGRA 5A6DA 3A1JB 5JNED 3U5ZF 4ZTDA 2HIIA 2HIKB 3G65B 4HK1A 3VKXA 2ZVVA 1RXZA 3G65A 1T6LA 2IX2C 5DAIA 5DA7A 3IFVA 2IZOB 1GE8A 3HI8A 3F1WA 3AIXB 2IO4A 3AIZA 3AIXA 3A1JC 2NTIB 5AUJA 4L60A 3GGRB 2AVTA 5H0TA 1B8HA 2IJXA 1SXJF 3GPNA 1UD9A 2HIIB 5E0UA 1YYPA 2ZVWA 1VYJA 1IZ4A 2OD8A 1PLQA 2ZVMA 5HACA 1W60A 4D2GA 3GPMA 3FDSC 3FDSD 4RJFA 2IO4B 3TBLA 5IY4A 2ZVKA 5E0VA
chains in the Genus database with same CATH topology
3V60B 1RXMA 5B7OA 1IZ5A 1VYMA 2HIKC 3HSLX 3G65C 4CS5A 4YHRA 4TR6A 3P87A 1CZDA 2IZOC 5IXAA 1AXCA 3LX1A 3AIZC 3V61B 2IX2B 2AWAA 2IX2A 2NTIC 3GGRC 2Z0LA 4L6PA 5CFKA 3P83A 3A1JA 3LX2A 3U61F 2HIIC 3I2MX 1U76A 3P91A 3K4XA 2ZVLA 2HIKA 1RWZA 3U60F 1DMLA 3A2FB 1UL1A 1U7BA 5IWDA 3WGWA 1B77A 1PLRA 5E0TA 3V62B 2NTIA 1ISQA 3GGRA 5A6DA 3A1JB 5JNED 3U5ZF 4ZTDA 2HIIA 2HIKB 3G65B 4HK1A 3VKXA 2ZVVA 1RXZA 3G65A 1T6LA 2IX2C 5DAIA 5DA7A 3IFVA 2IZOB 1GE8A 3HI8A 3F1WA 3AIXB 2IO4A 3AIZA 3AIXA 3A1JC 2NTIB 5AUJA 4L60A 3GGRB 2AVTA 5H0TA 1B8HA 2IJXA 1SXJF 3GPNA 1UD9A 2HIIB 5E0UA 1YYPA 2ZVWA 1VYJA 1IZ4A 2OD8A 1PLQA 2ZVMA 5HACA 1W60A 4D2GA 3GPMA 3FDSC 3FDSD 4RJFA 2IO4B 3TBLA 5IY4A 2ZVKA 5E0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V60 B;  1RXM A;  5B7O A;  1IZ5 A;  1VYM A;  2HIK C;  3HSL X;  3G65 C;  4CS5 A;  4YHR A;  4TR6 A;  3P87 A;  1CZD A;  2IZO C;  5IXA A;  1AXC A;  3LX1 A;  3AIZ C;  3V61 B;  2IX2 B;  2AWA A;  2IX2 A;  2NTI C;  3GGR C;  2Z0L A;  4L6P A;  5CFK A;  3P83 A;  3A1J A;  3LX2 A;  3U61 F;  2HII C;  3I2M X;  1U76 A;  3P91 A;  3K4X A;  2ZVL A;  2HIK A;  1RWZ A;  3U60 F;  1DML A;  3A2F B;  1UL1 A;  1U7B A;  5IWD A;  3WGW A;  1B77 A;  1PLR A;  5E0T A;  3V62 B;  2NTI A;  1ISQ A;  3GGR A;  5A6D A;  3A1J B;  5JNE D;  3U5Z F;  4ZTD A;  2HII A;  2HIK B;  3G65 B;  4HK1 A;  3VKX A;  2ZVV A;  1RXZ A;  3G65 A;  1T6L A;  2IX2 C;  5DAI A;  5DA7 A;  3IFV A;  2IZO B;  1GE8 A;  3HI8 A;  3F1W A;  3AIX B;  2IO4 A;  3AIZ A;  3AIX A;  3A1J C;  2NTI B;  5AUJ A;  4L60 A;  3GGR B;  2AVT A;  5H0T A;  1B8H A;  2IJX A;  1SXJ F;  3GPN A;  1UD9 A;  2HII B;  5E0U A;  1YYP A;  2ZVW A;  1VYJ A;  1IZ4 A;  2OD8 A;  1PLQ A;  2ZVM A;  5HAC A;  1W60 A;  4D2G A;  3GPM A;  3FDS C;  3FDS D;  4RJF A;  2IO4 B;  3TBL A;  5IY4 A;  2ZVK A;  5E0V A; 
#chains in the Genus database with same CATH topology
 3V60 B;  1RXM A;  5B7O A;  1IZ5 A;  1VYM A;  2HIK C;  3HSL X;  3G65 C;  4CS5 A;  4YHR A;  4TR6 A;  3P87 A;  1CZD A;  2IZO C;  5IXA A;  1AXC A;  3LX1 A;  3AIZ C;  3V61 B;  2IX2 B;  2AWA A;  2IX2 A;  2NTI C;  3GGR C;  2Z0L A;  4L6P A;  5CFK A;  3P83 A;  3A1J A;  3LX2 A;  3U61 F;  2HII C;  3I2M X;  1U76 A;  3P91 A;  3K4X A;  2ZVL A;  2HIK A;  1RWZ A;  3U60 F;  1DML A;  3A2F B;  1UL1 A;  1U7B A;  5IWD A;  3WGW A;  1B77 A;  1PLR A;  5E0T A;  3V62 B;  2NTI A;  1ISQ A;  3GGR A;  5A6D A;  3A1J B;  5JNE D;  3U5Z F;  4ZTD A;  2HII A;  2HIK B;  3G65 B;  4HK1 A;  3VKX A;  2ZVV A;  1RXZ A;  3G65 A;  1T6L A;  2IX2 C;  5DAI A;  5DA7 A;  3IFV A;  2IZO B;  1GE8 A;  3HI8 A;  3F1W A;  3AIX B;  2IO4 A;  3AIZ A;  3AIX A;  3A1J C;  2NTI B;  5AUJ A;  4L60 A;  3GGR B;  2AVT A;  5H0T A;  1B8H A;  2IJX A;  1SXJ F;  3GPN A;  1UD9 A;  2HII B;  5E0U A;  1YYP A;  2ZVW A;  1VYJ A;  1IZ4 A;  2OD8 A;  1PLQ A;  2ZVM A;  5HAC A;  1W60 A;  4D2G A;  3GPM A;  3FDS C;  3FDS D;  4RJF A;  2IO4 B;  3TBL A;  5IY4 A;  2ZVK A;  5E0V A; 
#chains in the Genus database with same CATH homology
 3V60 B;  1RXM A;  5B7O A;  1IZ5 A;  1VYM A;  2HIK C;  3HSL X;  3G65 C;  4CS5 A;  4YHR A;  4TR6 A;  3P87 A;  1CZD A;  2IZO C;  5IXA A;  1AXC A;  3LX1 A;  3AIZ C;  3V61 B;  2IX2 B;  2AWA A;  2IX2 A;  2NTI C;  3GGR C;  2Z0L A;  4L6P A;  5CFK A;  3P83 A;  3A1J A;  3LX2 A;  3U61 F;  2HII C;  3I2M X;  1U76 A;  3P91 A;  3K4X A;  2ZVL A;  2HIK A;  1RWZ A;  3U60 F;  1DML A;  3A2F B;  1UL1 A;  1U7B A;  5IWD A;  3WGW A;  1B77 A;  1PLR A;  5E0T A;  3V62 B;  2NTI A;  1ISQ A;  3GGR A;  5A6D A;  3A1J B;  5JNE D;  3U5Z F;  4ZTD A;  2HII A;  2HIK B;  3G65 B;  4HK1 A;  3VKX A;  2ZVV A;  1RXZ A;  3G65 A;  1T6L A;  2IX2 C;  5DAI A;  5DA7 A;  3IFV A;  2IZO B;  1GE8 A;  3HI8 A;  3F1W A;  3AIX B;  2IO4 A;  3AIZ A;  3AIX A;  3A1J C;  2NTI B;  5AUJ A;  4L60 A;  3GGR B;  2AVT A;  5H0T A;  1B8H A;  2IJX A;  1SXJ F;  3GPN A;  1UD9 A;  2HII B;  5E0U A;  1YYP A;  2ZVW A;  1VYJ A;  1IZ4 A;  2OD8 A;  1PLQ A;  2ZVM A;  5HAC A;  1W60 A;  4D2G A;  3GPM A;  3FDS C;  3FDS D;  4RJF A;  2IO4 B;  3TBL A;  5IY4 A;  2ZVK A;  5E0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...