5HACA

Crystal structure of proliferating cell nuclear antigen from leishmania donovani at 2.95 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
296
structure length
260
Chain Sequence
LVPRGSHMLEAQVQFASLWKRLVECINGLVNEANFDCNPGGLSVQAMDSSHVALVHMLLRDDCFVKYQCGRNSILGLNLASLSKVLKIVDSNDSLSLRHDDDSDVVTLTSENPEKTRKCEYQLKLLEIEAESMGIPEMDYRSTVTLNSAEFAKIVRDMQVFGDTVTIAISKEGVKFSSSGDVGQGYTFLQAAGVSDRGVEVTMEEPITLSFALRFMGIFAKGSTLSERVTLKFAKDSPCMVEYGIDNVGYLRYYLAPKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Crystal structure of Proliferating Cell Nuclear Antigen from Leishmania donovani at 2.95 A resolution
rcsb
source organism Leishmania donovani
total genus 50
structure length 260
sequence length 296
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5hacA00
1GE8A 2HIIB 1CZDA 2HIKA 2NTIB 4L60A 1T6LA 1U7BA 1RXZA 4D2GA 2IJXA 4ZTDA 3U61F 1SXJF 3LX2A 5DAIA 5IXAA 3GPMA 1VYJA 3AIZC 1RXMA 1IZ5A 2NTIA 5IWDA 2IO4B 2ZVLA 5AUJA 3HSLX 2IX2B 3GGRC 2AVTA 3G65C 1B77A 2Z0LA 2ZVMA 2IO4A 3GPNA 2IZOC 3I2MX 2IX2A 5DA7A 1PLQA 1U76A 2HIIA 4YHRA 2ZVVA 3U5ZF 1ISQA 2ZVWA 3GGRB 3G65B 3V60B 4HK1A 3AIZA 1PLRA 5B7OA 5A6DA 4L6PA 3AIXB 5E0TA 3FDSC 3A1JC 2IZOB 3F1WA 5E0UA 3GGRA 1DMLA 2OD8A 3IFVA 3G65A 5E0VA 3TBLA 3U60F 3V61B 4RJFA 5H0TA 1YYPA 3AIXA 5IY4A 1VYMA 3VKXA 2AWAA 3HI8A 3P87A 2HIKC 5JNED 1IZ4A 3P91A 5CFKA 1B8HA 1UL1A 3FDSD 3V62B 4CS5A 3A1JB 2HIIC 1W60A 2NTIC 1RWZA 3WGWA 4TR6A 3P83A 2ZVKA 1UD9A 3A1JA 1AXCA 2HIKB 3K4XA 3LX1A 5HACA 2IX2C 3A2FB
chains in the Genus database with same CATH superfamily
1GE8A 2HIIB 1CZDA 2HIKA 2NTIB 4L60A 1T6LA 1U7BA 1RXZA 4D2GA 2IJXA 4ZTDA 3U61F 1SXJF 3LX2A 5DAIA 5IXAA 3GPMA 1VYJA 3AIZC 1RXMA 1IZ5A 2NTIA 5IWDA 2IO4B 2ZVLA 5AUJA 3HSLX 2IX2B 3GGRC 2AVTA 3G65C 1B77A 2Z0LA 2ZVMA 2IO4A 3GPNA 2IZOC 3I2MX 2IX2A 5DA7A 1PLQA 1U76A 2HIIA 4YHRA 2ZVVA 3U5ZF 1ISQA 2ZVWA 3GGRB 3G65B 3V60B 4HK1A 3AIZA 1PLRA 5B7OA 5A6DA 4L6PA 3AIXB 5E0TA 3FDSC 3A1JC 2IZOB 3F1WA 5E0UA 3GGRA 1DMLA 2OD8A 3IFVA 3G65A 5E0VA 3TBLA 3U60F 3V61B 4RJFA 5H0TA 1YYPA 3AIXA 5IY4A 1VYMA 3VKXA 2AWAA 3HI8A 3P87A 2HIKC 5JNED 1IZ4A 3P91A 5CFKA 1B8HA 1UL1A 3FDSD 3V62B 4CS5A 3A1JB 2HIIC 1W60A 2NTIC 1RWZA 3WGWA 4TR6A 3P83A 2ZVKA 1UD9A 3A1JA 1AXCA 2HIKB 3K4XA 3LX1A 5HACA 2IX2C 3A2FB
chains in the Genus database with same CATH topology
1GE8A 2HIIB 1CZDA 2HIKA 2NTIB 4L60A 1T6LA 1U7BA 1RXZA 4D2GA 2IJXA 4ZTDA 3U61F 1SXJF 3LX2A 5DAIA 5IXAA 3GPMA 1VYJA 3AIZC 1RXMA 1IZ5A 2NTIA 5IWDA 2IO4B 2ZVLA 5AUJA 3HSLX 2IX2B 3GGRC 2AVTA 3G65C 1B77A 2Z0LA 2ZVMA 2IO4A 3GPNA 2IZOC 3I2MX 2IX2A 5DA7A 1PLQA 1U76A 2HIIA 4YHRA 2ZVVA 3U5ZF 1ISQA 2ZVWA 3GGRB 3G65B 3V60B 4HK1A 3AIZA 1PLRA 5B7OA 5A6DA 4L6PA 3AIXB 5E0TA 3FDSC 3A1JC 2IZOB 3F1WA 5E0UA 3GGRA 1DMLA 2OD8A 3IFVA 3G65A 5E0VA 3TBLA 3U60F 3V61B 4RJFA 5H0TA 1YYPA 3AIXA 5IY4A 1VYMA 3VKXA 2AWAA 3HI8A 3P87A 2HIKC 5JNED 1IZ4A 3P91A 5CFKA 1B8HA 1UL1A 3FDSD 3V62B 4CS5A 3A1JB 2HIIC 1W60A 2NTIC 1RWZA 3WGWA 4TR6A 3P83A 2ZVKA 1UD9A 3A1JA 1AXCA 2HIKB 3K4XA 3LX1A 5HACA 2IX2C 3A2FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GE8 A;  2HII B;  1CZD A;  2HIK A;  2NTI B;  4L60 A;  1T6L A;  1U7B A;  1RXZ A;  4D2G A;  2IJX A;  4ZTD A;  3U61 F;  1SXJ F;  3LX2 A;  5DAI A;  5IXA A;  3GPM A;  1VYJ A;  3AIZ C;  1RXM A;  1IZ5 A;  2NTI A;  5IWD A;  2IO4 B;  2ZVL A;  5AUJ A;  3HSL X;  2IX2 B;  3GGR C;  2AVT A;  3G65 C;  1B77 A;  2Z0L A;  2ZVM A;  2IO4 A;  3GPN A;  2IZO C;  3I2M X;  2IX2 A;  5DA7 A;  1PLQ A;  1U76 A;  2HII A;  4YHR A;  2ZVV A;  3U5Z F;  1ISQ A;  2ZVW A;  3GGR B;  3G65 B;  3V60 B;  4HK1 A;  3AIZ A;  1PLR A;  5B7O A;  5A6D A;  4L6P A;  3AIX B;  5E0T A;  3FDS C;  3A1J C;  2IZO B;  3F1W A;  5E0U A;  3GGR A;  1DML A;  2OD8 A;  3IFV A;  3G65 A;  5E0V A;  3TBL A;  3U60 F;  3V61 B;  4RJF A;  5H0T A;  1YYP A;  3AIX A;  5IY4 A;  1VYM A;  3VKX A;  2AWA A;  3HI8 A;  3P87 A;  2HIK C;  5JNE D;  1IZ4 A;  3P91 A;  5CFK A;  1B8H A;  1UL1 A;  3FDS D;  3V62 B;  4CS5 A;  3A1J B;  2HII C;  1W60 A;  2NTI C;  1RWZ A;  3WGW A;  4TR6 A;  3P83 A;  2ZVK A;  1UD9 A;  3A1J A;  1AXC A;  2HIK B;  3K4X A;  3LX1 A;  5HAC A;  2IX2 C;  3A2F B; 
#chains in the Genus database with same CATH topology
 1GE8 A;  2HII B;  1CZD A;  2HIK A;  2NTI B;  4L60 A;  1T6L A;  1U7B A;  1RXZ A;  4D2G A;  2IJX A;  4ZTD A;  3U61 F;  1SXJ F;  3LX2 A;  5DAI A;  5IXA A;  3GPM A;  1VYJ A;  3AIZ C;  1RXM A;  1IZ5 A;  2NTI A;  5IWD A;  2IO4 B;  2ZVL A;  5AUJ A;  3HSL X;  2IX2 B;  3GGR C;  2AVT A;  3G65 C;  1B77 A;  2Z0L A;  2ZVM A;  2IO4 A;  3GPN A;  2IZO C;  3I2M X;  2IX2 A;  5DA7 A;  1PLQ A;  1U76 A;  2HII A;  4YHR A;  2ZVV A;  3U5Z F;  1ISQ A;  2ZVW A;  3GGR B;  3G65 B;  3V60 B;  4HK1 A;  3AIZ A;  1PLR A;  5B7O A;  5A6D A;  4L6P A;  3AIX B;  5E0T A;  3FDS C;  3A1J C;  2IZO B;  3F1W A;  5E0U A;  3GGR A;  1DML A;  2OD8 A;  3IFV A;  3G65 A;  5E0V A;  3TBL A;  3U60 F;  3V61 B;  4RJF A;  5H0T A;  1YYP A;  3AIX A;  5IY4 A;  1VYM A;  3VKX A;  2AWA A;  3HI8 A;  3P87 A;  2HIK C;  5JNE D;  1IZ4 A;  3P91 A;  5CFK A;  1B8H A;  1UL1 A;  3FDS D;  3V62 B;  4CS5 A;  3A1J B;  2HII C;  1W60 A;  2NTI C;  1RWZ A;  3WGW A;  4TR6 A;  3P83 A;  2ZVK A;  1UD9 A;  3A1J A;  1AXC A;  2HIK B;  3K4X A;  3LX1 A;  5HAC A;  2IX2 C;  3A2F B; 
#chains in the Genus database with same CATH homology
 1GE8 A;  2HII B;  1CZD A;  2HIK A;  2NTI B;  4L60 A;  1T6L A;  1U7B A;  1RXZ A;  4D2G A;  2IJX A;  4ZTD A;  3U61 F;  1SXJ F;  3LX2 A;  5DAI A;  5IXA A;  3GPM A;  1VYJ A;  3AIZ C;  1RXM A;  1IZ5 A;  2NTI A;  5IWD A;  2IO4 B;  2ZVL A;  5AUJ A;  3HSL X;  2IX2 B;  3GGR C;  2AVT A;  3G65 C;  1B77 A;  2Z0L A;  2ZVM A;  2IO4 A;  3GPN A;  2IZO C;  3I2M X;  2IX2 A;  5DA7 A;  1PLQ A;  1U76 A;  2HII A;  4YHR A;  2ZVV A;  3U5Z F;  1ISQ A;  2ZVW A;  3GGR B;  3G65 B;  3V60 B;  4HK1 A;  3AIZ A;  1PLR A;  5B7O A;  5A6D A;  4L6P A;  3AIX B;  5E0T A;  3FDS C;  3A1J C;  2IZO B;  3F1W A;  5E0U A;  3GGR A;  1DML A;  2OD8 A;  3IFV A;  3G65 A;  5E0V A;  3TBL A;  3U60 F;  3V61 B;  4RJF A;  5H0T A;  1YYP A;  3AIX A;  5IY4 A;  1VYM A;  3VKX A;  2AWA A;  3HI8 A;  3P87 A;  2HIK C;  5JNE D;  1IZ4 A;  3P91 A;  5CFK A;  1B8H A;  1UL1 A;  3FDS D;  3V62 B;  4CS5 A;  3A1J B;  2HII C;  1W60 A;  2NTI C;  1RWZ A;  3WGW A;  4TR6 A;  3P83 A;  2ZVK A;  1UD9 A;  3A1J A;  1AXC A;  2HIK B;  3K4X A;  3LX1 A;  5HAC A;  2IX2 C;  3A2F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...