5IY4A

Crystal structure of human pcna in complex with the pip box of dvc1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
255
structure length
250
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Proliferating cell nuclear antigen
publication title Crystal structure of human PCNA in complex with the PIP box of DVC1
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 250
sequence length 255
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5iy4A00
3P87A 5E0UA 2ZVWA 3A1JC 2IO4A 2AVTA 2NTIA 5DA7A 3G65A 3GGRC 3GPNA 3V62B 5CFKA 3FDSD 3LX2A 1W60A 3WGWA 1IZ5A 3AIZA 5B7OA 3LX1A 5H0TA 1RWZA 5IY4A 5E0VA 3TBLA 3A2FB 2IZOC 3G65C 1YYPA 1PLQA 1U76A 4D2GA 1ISQA 2HIKA 5IWDA 3P83A 3AIZC 2IZOB 2HIIA 3G65B 3F1WA 1U7BA 1AXCA 2ZVLA 1VYMA 2IX2A 4RJFA 1DMLA 1B77A 4L60A 5IXAA 5DAIA 3I2MX 2Z0LA 4L6PA 3HSLX 3U5ZF 2NTIC 2ZVVA 1UD9A 4CS5A 3U61F 3V60B 2HIKB 3IFVA 2IO4B 3HI8A 1VYJA 3U60F 2ZVMA 3A1JA 2NTIB 1SXJF 3AIXA 1RXZA 3FDSC 4ZTDA 3GGRA 5E0TA 2AWAA 1T6LA 2ZVKA 3V61B 5A6DA 1PLRA 5HACA 4HK1A 2HIKC 2IJXA 2HIIC 3P91A 3K4XA 1CZDA 2OD8A 3GPMA 4TR6A 1GE8A 1IZ4A 3A1JB 3AIXB 2HIIB 1RXMA 2IX2C 3VKXA 1UL1A 5AUJA 3GGRB 5JNED 1B8HA 2IX2B 4YHRA
chains in the Genus database with same CATH superfamily
3P87A 5E0UA 2ZVWA 3A1JC 2IO4A 2AVTA 2NTIA 5DA7A 3G65A 3GGRC 3GPNA 3V62B 5CFKA 3FDSD 3LX2A 1W60A 3WGWA 1IZ5A 3AIZA 5B7OA 3LX1A 5H0TA 1RWZA 5IY4A 5E0VA 3TBLA 3A2FB 2IZOC 3G65C 1YYPA 1PLQA 1U76A 4D2GA 1ISQA 2HIKA 5IWDA 3P83A 3AIZC 2IZOB 2HIIA 3G65B 3F1WA 1U7BA 1AXCA 2ZVLA 1VYMA 2IX2A 4RJFA 1DMLA 1B77A 4L60A 5IXAA 5DAIA 3I2MX 2Z0LA 4L6PA 3HSLX 3U5ZF 2NTIC 2ZVVA 1UD9A 4CS5A 3U61F 3V60B 2HIKB 3IFVA 2IO4B 3HI8A 1VYJA 3U60F 2ZVMA 3A1JA 2NTIB 1SXJF 3AIXA 1RXZA 3FDSC 4ZTDA 3GGRA 5E0TA 2AWAA 1T6LA 2ZVKA 3V61B 5A6DA 1PLRA 5HACA 4HK1A 2HIKC 2IJXA 2HIIC 3P91A 3K4XA 1CZDA 2OD8A 3GPMA 4TR6A 1GE8A 1IZ4A 3A1JB 3AIXB 2HIIB 1RXMA 2IX2C 3VKXA 1UL1A 5AUJA 3GGRB 5JNED 1B8HA 2IX2B 4YHRA
chains in the Genus database with same CATH topology
3P87A 5E0UA 2ZVWA 3A1JC 2IO4A 2AVTA 2NTIA 5DA7A 3G65A 3GGRC 3GPNA 3V62B 5CFKA 3FDSD 3LX2A 1W60A 3WGWA 1IZ5A 3AIZA 5B7OA 3LX1A 5H0TA 1RWZA 5IY4A 5E0VA 3TBLA 3A2FB 2IZOC 3G65C 1YYPA 1PLQA 1U76A 4D2GA 1ISQA 2HIKA 5IWDA 3P83A 3AIZC 2IZOB 2HIIA 3G65B 3F1WA 1U7BA 1AXCA 2ZVLA 1VYMA 2IX2A 4RJFA 1DMLA 1B77A 4L60A 5IXAA 5DAIA 3I2MX 2Z0LA 4L6PA 3HSLX 3U5ZF 2NTIC 2ZVVA 1UD9A 4CS5A 3U61F 3V60B 2HIKB 3IFVA 2IO4B 3HI8A 1VYJA 3U60F 2ZVMA 3A1JA 2NTIB 1SXJF 3AIXA 1RXZA 3FDSC 4ZTDA 3GGRA 5E0TA 2AWAA 1T6LA 2ZVKA 3V61B 5A6DA 1PLRA 5HACA 4HK1A 2HIKC 2IJXA 2HIIC 3P91A 3K4XA 1CZDA 2OD8A 3GPMA 4TR6A 1GE8A 1IZ4A 3A1JB 3AIXB 2HIIB 1RXMA 2IX2C 3VKXA 1UL1A 5AUJA 3GGRB 5JNED 1B8HA 2IX2B 4YHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P87 A;  5E0U A;  2ZVW A;  3A1J C;  2IO4 A;  2AVT A;  2NTI A;  5DA7 A;  3G65 A;  3GGR C;  3GPN A;  3V62 B;  5CFK A;  3FDS D;  3LX2 A;  1W60 A;  3WGW A;  1IZ5 A;  3AIZ A;  5B7O A;  3LX1 A;  5H0T A;  1RWZ A;  5IY4 A;  5E0V A;  3TBL A;  3A2F B;  2IZO C;  3G65 C;  1YYP A;  1PLQ A;  1U76 A;  4D2G A;  1ISQ A;  2HIK A;  5IWD A;  3P83 A;  3AIZ C;  2IZO B;  2HII A;  3G65 B;  3F1W A;  1U7B A;  1AXC A;  2ZVL A;  1VYM A;  2IX2 A;  4RJF A;  1DML A;  1B77 A;  4L60 A;  5IXA A;  5DAI A;  3I2M X;  2Z0L A;  4L6P A;  3HSL X;  3U5Z F;  2NTI C;  2ZVV A;  1UD9 A;  4CS5 A;  3U61 F;  3V60 B;  2HIK B;  3IFV A;  2IO4 B;  3HI8 A;  1VYJ A;  3U60 F;  2ZVM A;  3A1J A;  2NTI B;  1SXJ F;  3AIX A;  1RXZ A;  3FDS C;  4ZTD A;  3GGR A;  5E0T A;  2AWA A;  1T6L A;  2ZVK A;  3V61 B;  5A6D A;  1PLR A;  5HAC A;  4HK1 A;  2HIK C;  2IJX A;  2HII C;  3P91 A;  3K4X A;  1CZD A;  2OD8 A;  3GPM A;  4TR6 A;  1GE8 A;  1IZ4 A;  3A1J B;  3AIX B;  2HII B;  1RXM A;  2IX2 C;  3VKX A;  1UL1 A;  5AUJ A;  3GGR B;  5JNE D;  1B8H A;  2IX2 B;  4YHR A; 
#chains in the Genus database with same CATH topology
 3P87 A;  5E0U A;  2ZVW A;  3A1J C;  2IO4 A;  2AVT A;  2NTI A;  5DA7 A;  3G65 A;  3GGR C;  3GPN A;  3V62 B;  5CFK A;  3FDS D;  3LX2 A;  1W60 A;  3WGW A;  1IZ5 A;  3AIZ A;  5B7O A;  3LX1 A;  5H0T A;  1RWZ A;  5IY4 A;  5E0V A;  3TBL A;  3A2F B;  2IZO C;  3G65 C;  1YYP A;  1PLQ A;  1U76 A;  4D2G A;  1ISQ A;  2HIK A;  5IWD A;  3P83 A;  3AIZ C;  2IZO B;  2HII A;  3G65 B;  3F1W A;  1U7B A;  1AXC A;  2ZVL A;  1VYM A;  2IX2 A;  4RJF A;  1DML A;  1B77 A;  4L60 A;  5IXA A;  5DAI A;  3I2M X;  2Z0L A;  4L6P A;  3HSL X;  3U5Z F;  2NTI C;  2ZVV A;  1UD9 A;  4CS5 A;  3U61 F;  3V60 B;  2HIK B;  3IFV A;  2IO4 B;  3HI8 A;  1VYJ A;  3U60 F;  2ZVM A;  3A1J A;  2NTI B;  1SXJ F;  3AIX A;  1RXZ A;  3FDS C;  4ZTD A;  3GGR A;  5E0T A;  2AWA A;  1T6L A;  2ZVK A;  3V61 B;  5A6D A;  1PLR A;  5HAC A;  4HK1 A;  2HIK C;  2IJX A;  2HII C;  3P91 A;  3K4X A;  1CZD A;  2OD8 A;  3GPM A;  4TR6 A;  1GE8 A;  1IZ4 A;  3A1J B;  3AIX B;  2HII B;  1RXM A;  2IX2 C;  3VKX A;  1UL1 A;  5AUJ A;  3GGR B;  5JNE D;  1B8H A;  2IX2 B;  4YHR A; 
#chains in the Genus database with same CATH homology
 3P87 A;  5E0U A;  2ZVW A;  3A1J C;  2IO4 A;  2AVT A;  2NTI A;  5DA7 A;  3G65 A;  3GGR C;  3GPN A;  3V62 B;  5CFK A;  3FDS D;  3LX2 A;  1W60 A;  3WGW A;  1IZ5 A;  3AIZ A;  5B7O A;  3LX1 A;  5H0T A;  1RWZ A;  5IY4 A;  5E0V A;  3TBL A;  3A2F B;  2IZO C;  3G65 C;  1YYP A;  1PLQ A;  1U76 A;  4D2G A;  1ISQ A;  2HIK A;  5IWD A;  3P83 A;  3AIZ C;  2IZO B;  2HII A;  3G65 B;  3F1W A;  1U7B A;  1AXC A;  2ZVL A;  1VYM A;  2IX2 A;  4RJF A;  1DML A;  1B77 A;  4L60 A;  5IXA A;  5DAI A;  3I2M X;  2Z0L A;  4L6P A;  3HSL X;  3U5Z F;  2NTI C;  2ZVV A;  1UD9 A;  4CS5 A;  3U61 F;  3V60 B;  2HIK B;  3IFV A;  2IO4 B;  3HI8 A;  1VYJ A;  3U60 F;  2ZVM A;  3A1J A;  2NTI B;  1SXJ F;  3AIX A;  1RXZ A;  3FDS C;  4ZTD A;  3GGR A;  5E0T A;  2AWA A;  1T6L A;  2ZVK A;  3V61 B;  5A6D A;  1PLR A;  5HAC A;  4HK1 A;  2HIK C;  2IJX A;  2HII C;  3P91 A;  3K4X A;  1CZD A;  2OD8 A;  3GPM A;  4TR6 A;  1GE8 A;  1IZ4 A;  3A1J B;  3AIX B;  2HII B;  1RXM A;  2IX2 C;  3VKX A;  1UL1 A;  5AUJ A;  3GGR B;  5JNE D;  1B8H A;  2IX2 B;  4YHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...