5JNED

E2-sumo-siz1 e3-sumo-pcna complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
254
structure length
254
Chain Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSDILREGNNTDTLTLIADNTPDSIILLFEDTKKDDIAEYSLKLMDIDADFLGIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITCETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/signaling protein
molecule keywords E3 SUMO-protein ligase SIZ1,Ubiquitin-like protein SMT3
publication title Capturing a substrate in an activated RING E3/E2-SUMO complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 254
sequence length 254
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
D PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5jneD00
3VKXA 5IXAA 1GE8A 3F1WA 5HACA 5AUJA 3AIXA 3U60F 2ZVMA 2IZOC 2NTIA 2HIIA 3A1JB 3FDSC 1U7BA 3P91A 1B77A 2NTIC 2HIIC 2IO4B 3U61F 2IX2A 2IZOB 1ISQA 1W60A 2IX2C 3V62B 2IJXA 5CFKA 1VYJA 5DAIA 4ZTDA 5B7OA 3WGWA 2ZVVA 1PLRA 3GGRA 5E0VA 1PLQA 3G65A 1DMLA 2AWAA 1U76A 3GGRC 2OD8A 3AIZA 3G65C 5JNED 4RJFA 4D2GA 3V61B 1IZ4A 3K4XA 3AIXB 3AIZC 3FDSD 1VYMA 1T6LA 2NTIB 4L6PA 2HIIB 1RWZA 2HIKC 3LX2A 1UD9A 3GPMA 2IX2B 3GPNA 1RXZA 3A1JA 3V60B 3LX1A 4CS5A 1CZDA 2AVTA 3A1JC 5E0TA 2IO4A 5A6DA 4TR6A 1YYPA 3A2FB 1AXCA 3IFVA 5H0TA 2HIKA 4L60A 3P87A 5IY4A 1B8HA 5DA7A 4YHRA 3GGRB 3HI8A 2ZVLA 1UL1A 2ZVKA 2ZVWA 3G65B 1SXJF 5IWDA 5E0UA 3U5ZF 3HSLX 1RXMA 4HK1A 2Z0LA 1IZ5A 2HIKB 3I2MX 3TBLA 3P83A
chains in the Genus database with same CATH superfamily
3VKXA 5IXAA 1GE8A 3F1WA 5HACA 5AUJA 3AIXA 3U60F 2ZVMA 2IZOC 2NTIA 2HIIA 3A1JB 3FDSC 1U7BA 3P91A 1B77A 2NTIC 2HIIC 2IO4B 3U61F 2IX2A 2IZOB 1ISQA 1W60A 2IX2C 3V62B 2IJXA 5CFKA 1VYJA 5DAIA 4ZTDA 5B7OA 3WGWA 2ZVVA 1PLRA 3GGRA 5E0VA 1PLQA 3G65A 1DMLA 2AWAA 1U76A 3GGRC 2OD8A 3AIZA 3G65C 5JNED 4RJFA 4D2GA 3V61B 1IZ4A 3K4XA 3AIXB 3AIZC 3FDSD 1VYMA 1T6LA 2NTIB 4L6PA 2HIIB 1RWZA 2HIKC 3LX2A 1UD9A 3GPMA 2IX2B 3GPNA 1RXZA 3A1JA 3V60B 3LX1A 4CS5A 1CZDA 2AVTA 3A1JC 5E0TA 2IO4A 5A6DA 4TR6A 1YYPA 3A2FB 1AXCA 3IFVA 5H0TA 2HIKA 4L60A 3P87A 5IY4A 1B8HA 5DA7A 4YHRA 3GGRB 3HI8A 2ZVLA 1UL1A 2ZVKA 2ZVWA 3G65B 1SXJF 5IWDA 5E0UA 3U5ZF 3HSLX 1RXMA 4HK1A 2Z0LA 1IZ5A 2HIKB 3I2MX 3TBLA 3P83A
chains in the Genus database with same CATH topology
3VKXA 5IXAA 1GE8A 3F1WA 5HACA 5AUJA 3AIXA 3U60F 2ZVMA 2IZOC 2NTIA 2HIIA 3A1JB 3FDSC 1U7BA 3P91A 1B77A 2NTIC 2HIIC 2IO4B 3U61F 2IX2A 2IZOB 1ISQA 1W60A 2IX2C 3V62B 2IJXA 5CFKA 1VYJA 5DAIA 4ZTDA 5B7OA 3WGWA 2ZVVA 1PLRA 3GGRA 5E0VA 1PLQA 3G65A 1DMLA 2AWAA 1U76A 3GGRC 2OD8A 3AIZA 3G65C 5JNED 4RJFA 4D2GA 3V61B 1IZ4A 3K4XA 3AIXB 3AIZC 3FDSD 1VYMA 1T6LA 2NTIB 4L6PA 2HIIB 1RWZA 2HIKC 3LX2A 1UD9A 3GPMA 2IX2B 3GPNA 1RXZA 3A1JA 3V60B 3LX1A 4CS5A 1CZDA 2AVTA 3A1JC 5E0TA 2IO4A 5A6DA 4TR6A 1YYPA 3A2FB 1AXCA 3IFVA 5H0TA 2HIKA 4L60A 3P87A 5IY4A 1B8HA 5DA7A 4YHRA 3GGRB 3HI8A 2ZVLA 1UL1A 2ZVKA 2ZVWA 3G65B 1SXJF 5IWDA 5E0UA 3U5ZF 3HSLX 1RXMA 4HK1A 2Z0LA 1IZ5A 2HIKB 3I2MX 3TBLA 3P83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VKX A;  5IXA A;  1GE8 A;  3F1W A;  5HAC A;  5AUJ A;  3AIX A;  3U60 F;  2ZVM A;  2IZO C;  2NTI A;  2HII A;  3A1J B;  3FDS C;  1U7B A;  3P91 A;  1B77 A;  2NTI C;  2HII C;  2IO4 B;  3U61 F;  2IX2 A;  2IZO B;  1ISQ A;  1W60 A;  2IX2 C;  3V62 B;  2IJX A;  5CFK A;  1VYJ A;  5DAI A;  4ZTD A;  5B7O A;  3WGW A;  2ZVV A;  1PLR A;  3GGR A;  5E0V A;  1PLQ A;  3G65 A;  1DML A;  2AWA A;  1U76 A;  3GGR C;  2OD8 A;  3AIZ A;  3G65 C;  5JNE D;  4RJF A;  4D2G A;  3V61 B;  1IZ4 A;  3K4X A;  3AIX B;  3AIZ C;  3FDS D;  1VYM A;  1T6L A;  2NTI B;  4L6P A;  2HII B;  1RWZ A;  2HIK C;  3LX2 A;  1UD9 A;  3GPM A;  2IX2 B;  3GPN A;  1RXZ A;  3A1J A;  3V60 B;  3LX1 A;  4CS5 A;  1CZD A;  2AVT A;  3A1J C;  5E0T A;  2IO4 A;  5A6D A;  4TR6 A;  1YYP A;  3A2F B;  1AXC A;  3IFV A;  5H0T A;  2HIK A;  4L60 A;  3P87 A;  5IY4 A;  1B8H A;  5DA7 A;  4YHR A;  3GGR B;  3HI8 A;  2ZVL A;  1UL1 A;  2ZVK A;  2ZVW A;  3G65 B;  1SXJ F;  5IWD A;  5E0U A;  3U5Z F;  3HSL X;  1RXM A;  4HK1 A;  2Z0L A;  1IZ5 A;  2HIK B;  3I2M X;  3TBL A;  3P83 A; 
#chains in the Genus database with same CATH topology
 3VKX A;  5IXA A;  1GE8 A;  3F1W A;  5HAC A;  5AUJ A;  3AIX A;  3U60 F;  2ZVM A;  2IZO C;  2NTI A;  2HII A;  3A1J B;  3FDS C;  1U7B A;  3P91 A;  1B77 A;  2NTI C;  2HII C;  2IO4 B;  3U61 F;  2IX2 A;  2IZO B;  1ISQ A;  1W60 A;  2IX2 C;  3V62 B;  2IJX A;  5CFK A;  1VYJ A;  5DAI A;  4ZTD A;  5B7O A;  3WGW A;  2ZVV A;  1PLR A;  3GGR A;  5E0V A;  1PLQ A;  3G65 A;  1DML A;  2AWA A;  1U76 A;  3GGR C;  2OD8 A;  3AIZ A;  3G65 C;  5JNE D;  4RJF A;  4D2G A;  3V61 B;  1IZ4 A;  3K4X A;  3AIX B;  3AIZ C;  3FDS D;  1VYM A;  1T6L A;  2NTI B;  4L6P A;  2HII B;  1RWZ A;  2HIK C;  3LX2 A;  1UD9 A;  3GPM A;  2IX2 B;  3GPN A;  1RXZ A;  3A1J A;  3V60 B;  3LX1 A;  4CS5 A;  1CZD A;  2AVT A;  3A1J C;  5E0T A;  2IO4 A;  5A6D A;  4TR6 A;  1YYP A;  3A2F B;  1AXC A;  3IFV A;  5H0T A;  2HIK A;  4L60 A;  3P87 A;  5IY4 A;  1B8H A;  5DA7 A;  4YHR A;  3GGR B;  3HI8 A;  2ZVL A;  1UL1 A;  2ZVK A;  2ZVW A;  3G65 B;  1SXJ F;  5IWD A;  5E0U A;  3U5Z F;  3HSL X;  1RXM A;  4HK1 A;  2Z0L A;  1IZ5 A;  2HIK B;  3I2M X;  3TBL A;  3P83 A; 
#chains in the Genus database with same CATH homology
 3VKX A;  5IXA A;  1GE8 A;  3F1W A;  5HAC A;  5AUJ A;  3AIX A;  3U60 F;  2ZVM A;  2IZO C;  2NTI A;  2HII A;  3A1J B;  3FDS C;  1U7B A;  3P91 A;  1B77 A;  2NTI C;  2HII C;  2IO4 B;  3U61 F;  2IX2 A;  2IZO B;  1ISQ A;  1W60 A;  2IX2 C;  3V62 B;  2IJX A;  5CFK A;  1VYJ A;  5DAI A;  4ZTD A;  5B7O A;  3WGW A;  2ZVV A;  1PLR A;  3GGR A;  5E0V A;  1PLQ A;  3G65 A;  1DML A;  2AWA A;  1U76 A;  3GGR C;  2OD8 A;  3AIZ A;  3G65 C;  5JNE D;  4RJF A;  4D2G A;  3V61 B;  1IZ4 A;  3K4X A;  3AIX B;  3AIZ C;  3FDS D;  1VYM A;  1T6L A;  2NTI B;  4L6P A;  2HII B;  1RWZ A;  2HIK C;  3LX2 A;  1UD9 A;  3GPM A;  2IX2 B;  3GPN A;  1RXZ A;  3A1J A;  3V60 B;  3LX1 A;  4CS5 A;  1CZD A;  2AVT A;  3A1J C;  5E0T A;  2IO4 A;  5A6D A;  4TR6 A;  1YYP A;  3A2F B;  1AXC A;  3IFV A;  5H0T A;  2HIK A;  4L60 A;  3P87 A;  5IY4 A;  1B8H A;  5DA7 A;  4YHR A;  3GGR B;  3HI8 A;  2ZVL A;  1UL1 A;  2ZVK A;  2ZVW A;  3G65 B;  1SXJ F;  5IWD A;  5E0U A;  3U5Z F;  3HSL X;  1RXM A;  4HK1 A;  2Z0L A;  1IZ5 A;  2HIK B;  3I2M X;  3TBL A;  3P83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...