2FZ4A

Crystal structure of the n-terminal half of archaeoglobus fulgidus xpb
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
206
structure length
206
Chain Sequence
IAEIYYERGTIVVKGDAHVPHAKFDSRSGTYRALAFRYRDIIEYFESNGIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD25
publication title Conserved XPB Core Structure and Motifs for DNA Unwinding: Implications for Pathway Selection of Transcription or Excision Repair.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 63
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF18458 XPB_DRD Xeroderma pigmentosum group B helicase damage recognition domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fz4A02
3.40.1170.30 Alpha Beta 3-Layer(aba) Sandwich MutS, DNA mismatch repair protein, domain I MutS, DNA mismatch repair protein, domain I 2fz4A01
2OXRA 4QHYA 3FMOB 3FOZA 5FL7D 1QBKC 3RS4A 4HZUA 2Y8EA 1Z08A 3IO3A 2EQBA 4DIDA 1ONBA 1G8GA 4EDHA 2OCAA 4LYJA 4HLCA 4EPYA 1T3HA 1SXJA 4LSGA 2DPXA 2FSGA 5JI3E 1E2LA 3W5IA 5TB5A 3FPAA 3VMFA 1G3UA 5H70A 1DAKA 1XDBA 1E2GA 2QP3A 4IW3B 4IFBA 1K5DA 2A5GA 2FEOA 3LV8A 1VG1A 4N1AA 3QF4B 4CEHA 5IF9A 2D3WA 1M1YE 4L8GA 121PA 4M9SA 5SZKB 1NVXQ 4P4SB 1IM2A 2ZI6A 2W58A 4Q19A 2Q3FA 4PC6A 1W36C 4LJ6A 3IIJA 1JJ7A 4TMVA 2OILA 4NCHA 2DWPA 4TMTA 1OB2A 2XX3A 3TMKA 2XOKD 4Z8YA 5L3RA 3AF2A 3LA6A 3B7GA 4DT1A 1F6BA 2DHRA 1KI6A 2QP4A 4O3MA 1UM8A 5ELXA 4JT2A 4B44A 1CJKC 1TEVA 4B71A 4RKEA 3WMEA 2QMOA 3SOPA 1NLYA 1XXHA 4X8MA 3ZIAA 3P27A 1W0KA 4B6FA 1JPNA 5DHAA 3DM5A 3EZ9A 2AWOA 2BBTA 2ZRJA 2FSFA 3IIMA 3IEVA 1M6NA 4Q4AB 1G7CA 4AYXA 1FOEB 5EXTA 2D4HA 3ND9A 5E95A 2ZJYA 1E4YA 2ZRFA 2JLQA 3A4NA 4EUNA 1VYTA 4ZIRB 3QXXA 4Y0AA 2H1LA 4OQXA 1L8QA 2CJWB 1CR1A 2PCJA 2CL7X 2GAAA 2WHXA 3REFA 4BZXA 3BJIC 5GVSA 4AD8A 1IY1A 3Q7QA 3JZAA 3RNLA 1Q57A 1AKYA 4JSTA 4XTRA 4G5QA 5FPYA 3T15A 2OLJA 3LAWA 4Z1MD 1RKBA 2PLFA 5LBIA 2QI9C 2V1XA 3ZS8A 3THXA 3UG7A 1FQJA 3EPLA 2QTHA 2HYDA 1KDPA 4K8OA 3QEJA 2CHQA 2FJUA 2C78A 2GEVA 5FI0B 2D74A 4IRUB 2O52A 3A8TA 2AHOA 2RMKA 3W5JA 2UVQA 1HTWA 3AP2A 3AH8A 4PHGA 1YR9A 4P3YA 3A1SA 3T12A 1E2JA 4GSYA 1Z47A 4WIAA 2FH5B 1KO4A 3VAAA 2BJWA 1T6NA 4G5GA 4E07A 1VYVA 3EASA 1TX4B 3KX2A 1BOFA 4C2UA 1KJWA 2GK7A 3DDCA 1VG8A 4K46A 4LHWA 2CHVA 2GRJA 2PH1A 1KO5A 3Q5EA 2KI5A 3B1YA 3K9LA 3K9HA 4JZKA 4NYIR 3I5YA 2W0SA 4U00A 4MDEA 4MUAA 2ZE6A 5G40A 1BKDR 3AM1A 2H8KA 3BAFA 1UAAA 4LK2A 3QVUA 4Q9IA 3U3KA 5IK2D 1B0UA 1YKSA 4CYMA 5KSYA 4A15A 1NVVQ 1WB9A 1XD2A 3KKPA 4DLXA 4JLNA 4Q21A 2YWEA 2V4ZA 4NBSA 2BEJA 4BZQA 4NMMA 1PV4A 2J0VA 2ZR9A 1SGWA 1G3QA 4W5WA 5C4MA 4BRWA 3EA5A 3MWYW 4PC1A 1ZVQA 3DMNA 2Q3MA 2IWRA 5KSPA 3WY9A 3ZIAD 4QJ3A 721PA 3ECCA 1JAIA 4KU4A 5F98A 2WIBA 4C0LA 2F43B 1NF3A 2G83A 1KO1A 1J7KA 4NP6A 1S2MA 3ADDA 4JSYA 1XPUA 4BFUA 4B73A 3RHFA 4TWZA 4ZDJA 1AS2A 1L4UA 3Q8XB 3H0KA 3AF0A 4AG5A 2Z4SA 2QAGC 5E7JA 1N5LA 4NYJR 2MSDB 3CPHA 2ZRHA 3TW8B 3ZZUA 2Z83A 1DAGA 3LW8A 1ZNZA 3L8ZA 4RD0A 4Q4HB 2FOLA 5FTKA 4V03A 3RC3A 3KQLA 4KSCA 4JBXA 2F9MA 2IXEA 2O8EB 1N2CE 1Z22A 2A5FA 4NCIA 3ZDQA 4D0NA 1NI3A 1GL6A 2NGRA 2O8CB 3IO5A 2IF0A 3QVVA 4MGYR 4ACAA 1NY6A 1ZJ6A 1KMQA 2F1IA 3I61A 1K5GA 2J41A 4ZIRA 2GEUA 2YINC 2VLIA 3R7WB 5FPHA 2GJ9A 1JR3D 2WOOA 5DSZA 3U7EB 1Y63A 3W6OA 4D6PA 4A6XA 2PL3A 2ZI4A 1H8EA 4TMWA 5CJPA 3BB3A 5JWHA 1WQ1R 1MO4A 1SVMA 3TSOA 4ZDIA 1H8HA 3KXKA 2Z6VA 4EQ6B 3LD9A 1GFIA 4IVQA 4IOKA 5JZVA 2JLXA 3VFDA 2OCYC 2RB4A 4K81B 3OF5A 2AK3A 4PXAA 4RKFA 1UPTA 1OH8A 1GVNB 1N6IA 2ZQ5A 5CLQA 4B74A 1OF1A 5DH9A 3SU8A 2BMJA 2Q9AA 2IXGA 3HR7A 3KJGA 2ZJAA 1E4VA 3ADKA 3A1TA 1S3GA 3REGA 2B6HA 2AK2A 3ADCA 4OI0A 1ZIPA 3M6AA 1E6CA 3HDTA 4JT4A 2QSYA 3B1XA 1Q0UA 3C5HA 5L3VA 1COWA 3BFVA 2JLZA 1SHZA 1E3MA 4AK9A 2R9VA 3X1WA 2OCBA 1KK0A 5B64A 2REBA 3R9XA 3VTKA 1T5IA 2DFKB 4PTLA 2GCNA 1GNQA 4B43A 4V0OA 4OQLA 4WVFA 5AJVB 3H84A 1SKYB 1OYYA 2A30A 2QBYA 4LWZA 1S1CA 2GXUA 4KLZA 4MQBA 1TQ4A 5BWMA 3VR4A 1NJGA 2N42A 3FDIA 1GKIA 3KFXA 5CYOA 4ZV4A 4RCYA 3CKLA 1DG1G 3PIRA 1AK2A 1D2NA 1E2PA 2IS6A 1QHIA 4DLSA 1WMSA 4RD6A 3FHTA 3K0CC 4LBWA 1P2SA 1E69A 4HATA 1CJMA 3B78A 2GZAA 1CKEA 1JQJC 3AUYA 2OLKA 3PJRA 2CCGA 3WYAA 3TAHA 3FE2A 2RKOA 2WJVA 1WXQA 3HU3A 2ORVA 1N3BA 4CEIB 4L15A 4PO9A 4R2HA 2R65A 4FMBB 4Q47A 4OJQA 2DFLA 3CRW1 5JS8A 2ZJZA 4UQOA 4DCNA 1O3YA 5L8VA 2F43A 1OH7A 1GL7A 2BDTA 3OESA 2NIPA 5FTJA 4LY6A 2PMDA 1S96A 2KWIA 4DDTA 1UF9A 4LX0A 5DO9A 4IDOA 4TTRA 3A1WA 2WZQA 4RD3A 1E94E 4Q4LA 1A2KC 1OXSC 3UKDA 4A4DA 4LBZA 2AKYA 1GNPA 2VSOA 3C4JA 4QBHA 2GNOA 3KFVA 1LNZA 3LH5A 1G7RA 1T0HB 5P21A 4C0AC 3EC2A 4DB2A 4GP7A 1GWNA 1U99A 1HH4A 2GA8A 1ZU4A 4XD7A 3F5FA 2P0EA 4O2LA 3SHWA 4C0SA 4QFMA 1TAGA 4QC2A 5L3QB 2FFBA 3KKQA 2WKRA 3EPKA 3ZVLA 2C03A 2RGDA 3CNLA 4A9AA 3IIKA 2QGNA 2XB2A 4ERNA 3R7WA 5CK5A 4DLRA 1CF4A 3EX7C 3NHBA 2RHDA 3EPHA 2QM7A 4LC0A 3VHLB 2HF8A 2AXPA 4S35A 1COWD 3UANA 5JMTA 4JL6A 3GPLA 1OSNA 1I4TD 4A8JC 3WYGA 2VBCA 1AKEA 4EQ6A 4CIDA 1P3JA 4HYYA 5JCZA 1CLUA 3O8RA 3ZZTA 2BKEA 3KJEA 1NL3A 3EIQA 1XCMA 3A1VA 3GJ8A 2CNWA 2EFEB 3BH6A 1ZD8A 2CLDX 2VIIA 1EFRA 2WSSA 4M8NE 4P31A 2ANBA 1F2TB 5GJVC 4D4JA 1U0LA 2REXB 2IYTA 3PR1A 5SZIA 4B3GA 4B3FX 3D7MA 3SI7A 4TL6A 3FGNA 3PQCA 3TNFA 1EXMA 1Z5ZA 5EZ5A 3RANA 2R6DA 3OIVA 1XJQA 3FTQA 2NZJA 3QE0A 4LV8B 2FG5A 4HAYA 4A2PA 1NNEA 4MKIA 4PZZA 3IPXA 3J81k 2NO7A 4LV6A 3SR0A 2YZ2A 5UKDA 2D62A 3MJRA 4TQ9A 2FN4A 4IFEA 4P4TA 1G7TA 4EJSC 4CF7A 1J70A 2YOFA 1N25A 3JZMA 1J99A 1G64A 3QSYA 4JLJA 5FOWA 3ZD7A 5IDVA 1R6BX 1P2UA 2A2ZA 4EKDA 3CWQA 3H1TA 1Z07A 1PUJA 2EFCB 4L9WA 4BFVA 1NLFA 1CRQA 2V8OA 4IOLA 2WICA 2C99A 2QPAA 3QUSA 4DKXA 1XTJA 2GF0A 3DO6A 3ND8A 3N5CA 3NC0C 4HB3A 1OH5A 2JLRA 5AR1A 3EC1A 3WBKA 3E1SA 4BWYA 4R2IA 1KOFA 3NH9A 4CEIA 5D3MB 2ONJA 5L3SB 2VEDA 4MYHA 4WOPA 1D2EA 4ZDKA 2ZETA 5AJYA 2W6IA 4GOXA 1E2NA 4PPNA 3NIBA 1KHTA 1TL7C 1M34E 1G3MA 2RGEA 2D7CA 3QKRB 1RYHA 1W44A 3BH0A 3NHAA 4IEIA 4TZ0A 1FTNA 4QRHA 3AGPA 1ZC4A 1UBFA 2ASEA 2UKDA 5FOVA 1XMSA 4HUQB 2YNMA 1JI0A 1VYUA 1F2UB 4GDFA 3OEHA 2GXQA 1W2HA 221PA 3D6TB 3K0FB 3SQXA 4YLGA 4EPWA 4G5OA 2NZ8A 3LLUA 1DG3A 2V9PA 2VSFA 3EAQA 1MRSA 3UMFA 1G8HA 5DISB 3T1QA 1J8MF 5LPNA 2FFHA 2DFNA 3RAPR 2HV8A 4Q01A 2CBZA 4GRAA 1EFTA 2OEPA 1TADA 5L3QA 2WPDA 4KODA 3A6PC 1E0AA 3U7FB 3DM9B 2CNWD 5BXQC 3B1VA 3EZ7A 3R9IA 1E1RA 3VR5A 1EFRD 5LD2C 3FHOA 2WSSD 1XEXB 4IDHA 3TKLA 2WJYA 4H9GA 2HCJB 2ZYTX 4U7DA 1E2MA 1SZPA 3NBZC 1GTVA 3C7KA 2FA9A 4KJZA 2X1VA 2ZVQX 1IXZA 1FX0B 1XP8A 1W0JD 4HDCA 3T1OA 2J45A 3CLVA 1A4RA 1OFIA 3AKCA 4OJKA 4ARZA 5HTKA 2ONKA 1KO8A 1Z83A 3O8DA 4M1SA 4LYAA 3U6KA 3KTAB 3AF3A 3MLEA 4KVGA 3TUZC 1X8KA 4IVRA 2QMHA 1OHHA 4LJYA 5TMPA 1E1QA 1W49A 4IOMA 3UWKA 3QXHA 4Q7LA 1OT3A 3CZQA 2AXNA 1XMVA 4WZBE 2IA5A 4QGAA 4URZR 5HZHA 3HU1A 3ICEA 1M8PA 2YC2C 3AKYA 1RJ9A 4W5JA 1KI9A 2GETA 3AKDA 2OESA 4KXFB 5GJWC 3WMGA 3BXZA 3MWKA 4LRWA 4MRRA 1GIAA 2HLDA 2DWOA 2XJ9A 5E4FA 2J9RA 1SXJB 4Q9KA 3O8BA 1U0JA 5JLJA 1EFCA 2AL7A 4M1WA 3MSXA 2QMEA 4LJ5A 5HCIA 4U5XA 2FEMA 3TH5A 4V0LA 2W6ID 3CIOA 4HAWA 3SBDA 2B8TA 4PPQA 4F7WA 2BBOA 2ZAMA 2O0JA 1BIFA 4RZ3A 3T35A 4PR0A 1OIWA 2H17A 3LBHA 1N5JA 3GLGE 2IC5A 2HF9A 1XZPA 1IXRC 1AZTA 2HXSA 2KBFA 5C2JB 3PEVA 4YQFA 4DT1B 4GMDA 3BBPA 5D3MA 1KI6B 1NBME 2CK3A 5AUQA 1QHSA 3LX5A 5HR5A 5L3SA 5BQ5A 3QKTA 1XD8A 3HP1A 5EE5B 4LDJA 1KKMA 1XXHB 2EVWX 4B3BA 3Q72A 3GLFE 5FTNA 3EPJA 2IW3A 3LBNA 4DZZA 3I32A 2WPDD 4KYIB 3EW9A 4A2QA 1WBDA 3MD0A 4P4UA 3W6PA 3NC1C 3C16C 4RZUA 5B2ZA 5DNYB 2IT1A 4RVCA 5AUPB 2WWWA 3UMRA 4E22A 4HUQA 2ORWA 3VR3A 3A58B 4V0ME 3WP1B 2J46A 4DVGA 3GJ3A 3CM0A 2PBRA 2FU5C 4FCWA 1AN0A 1FMLA 4B3DA 1T8UA 4Q9LA 4RFSB 4URYR 2ZRKA 2OCPA 2QENA 2FGJA 3PCRB 3VNUA 4FCVA 4TSFA 1WDTA 3W90A 2ZRCA 2CLCX 1S0UA 4GMXA 4OI2A 1YVDA 3LXXA 4C0BA 4X8OA 1XEXA 1OHHD 1H65A 2YWGA 3AVOA 4MYCA 2FGKA 3U61B 1YJ5A 3GEIA 4R98A 1E1QD 1JXMA 2C9OA 2HXYA 2W00A 2CE2X 4PANA 5JJIA 3DZDA 4JLPA 2XB4A 2ZTSA 4D82A 3GJXC 4YONB 2RH5A 1P4SA 2OBNA 1HYQA 3NVAA 4DEYA 3NDBB 1KGDA 1N6RA 1XX6A 2HLDD 3LBIA 1Q3HA 2C5LA 2OSBA 1Z63A 4XIGS 2C9CA 3I8SA 3KTAA 5K8LA 5H8WA 2ZAOA 1DBSA 4LI0A 2IYYA 3G82C 2ZUDA 1M2OB 4GNKA 5CJ2A 2BC9A 3EXAA 3G5UA 2JDID 2QA5A 3DKVA 4B6EA 4DLWA 1KTVA 1C9KA 1TQDA 3F8TA 4BZPA 4BECA 4I99A 4WZAE 5KDLA 2GWHA 2RGAA 2CCJA 4NCNA 2REOA 3MAAC 2AD1A 3K9NA 1BMFA 1YZNA 1U94A 1G5PA 2NO6A 1JALA 3MWJA 4JJKA 4R9UC 2GBLC 4PC7A 1JB1A 3WYFA 2MSEB 2J7PA 1XD2B 2YOGA 1YE8A 4GPTA 1OPXA 2CK3D 2V7QA 4ZKDA 3GJ6A 5EUQB 2YV5A 4YMUA 1R8QA 1Q20A 3GFTA 1DO2A 4WA7A 3WHKA 4V0NA 2O8DA 1W7AA 3T34A 5HPYB 5FI1B 1VIAA 1NN1A 3L0SA 1NVUQ 2F1RA 3RWMB 4XSGA 2UZIR 4P0TA 5FOXA 4CT5A 4DXAA 5KSZA 3X2SA 4D25A 4IDQA 3RRZA 3K0AA 4PSAA 4TYYA 1TUEA 1XRJA 3TJZA 5EP2A 3CR8A 1N6OA 1W4AA 3GD7A 4URWR 4TLAA 1KJYA 4JL8A 1AQUA 4EFMA 1CJUC 1L4YA 4C0KA 3WNBA 2GTPA 2WMNB 1RRGA 3C14C 4DLUA 4JYBA 1KSJA 3Q7PA 4PHFA 4F92B 2EU8A 2IYUA 2QGZA 3D31A 1HE1C 4HAVA 5EJEA 1TMKA 4NYMQ 1AZSC 4AKEA 1OXVA 3CRVA 4HZIA 4D80A 2J0SA 2IUTA 2RGCA 1T8TA 4NL4H 2R6GA 4R7ZA 3AVTA 1ESNA 2XAUA 1OW3B 4AI6A 1QZXA 2OUKA 1W2GA 3AV0B 3WRYC 4C0QC 2CL0X 1Z2AA 2H5EA 2W2XA 5FUXA 2JAQA 1JEDA 3AVUA 1R0ZA 4RFSA 3TRFA 1P73A 5KU1A 1F48A 3MGCA 3ZZ0A 2X8AA 1CR2A 1ZUIA 5FFMA 1AQYA 2FPLA 2WKPA 4M22A 2JLVA 2QTVB 5E3HA 1GL9B 4TZ6A 2J0QA 4B75A 1MO3A 1KY2A 3NXSA 2VSXA 2FZLA 1Z2CA 2IYZA 3OEED 4TLEA 4PAMA 1TF7A 3HYRA 1N0UA 1UFQA 2IUSA 3EZ6A 2CL6X 1QVAA 4PPFA 3NWJA 1FNMA 1BH2A 1YQTA 2QMUA 3GJ5A 1CU1A 1G17A 1W4CA 1BMFD 3PEWA 1SXJD 2B21A 4DRZA 3P32A 4Q1CA 4TLDA 3P4YA 3H86A 3L8YA 1IAQA 4GOKA 2V7QD 3U3OA 2QBYB 1EESA 1SQ5A 4CEJA 1TTTA 1RRCA 1CP2A 1GITA 1KSGA 5DI3B 3GQBA 2QPTA 4US2R 3SYLA 4D4KA 1N5KA 2ZANA 3QXJA 3AKEA 5KNBA 2NPIA 4H1UA 4XOIA 1CTQA 3DZ8A 4IXNA 4UJ5A 4BFSA 5F2EA 4FINA 2ZE7A 3QIAA 2IYVA 4MGKR 1G21E 4KV9A 5JHHB 3WNDA 2BWJA 5J5CA 2G0TA 3AVYA 1TU4A 1P6XA 1A82A 3CF6R 2V6IA 2HT1A 4LHVA 2NMVA 2ZVPX 1S1MA 5CYPA 1W0KD 1Q3TA 4Q48A 2QE7A 2AKAB 2WWXA 3OIUA 2CVHA 4DDUA 1U8YA 3IHLA 3TVTA 1ZUNB 4CGZA 3X1DA 2JJ1A 2Z4RA 5G41A 4M1YA 2GK6A 521PA 4MKGA 5TVKA 2OAP1 2PZFA 2GCOB 4DJTA 3T1VA 4TYWA 1NMZA 1RZ3A 4JL5A 1I2DA 1XTIA 5FBVB 5FPTA 3LNCA 4HLQB 4OHXA 4BPBA 4Q9HA 3X1ZA 1Z3IX 1M74A 4UNQA 5FOTA 1SVOA 1Z0AA 2ZSEA 1P2VA 4GT1A 4TQUS 1ZAKA 3NKVA 3WMFA 3RS5A 3OE7A 1GZSA 5G3ZA 4B35A 1R5OA 4QG7A 2EYQA 4I4LA 3MMPA 5EP1A 2ZITA 4DLYA 4EPVA 4HLUA 1E99A 1I4LD 3IBYA 5FTMA 4LOAA 2WSMA 3UATA 2ECKA 5HE8A 4ZI2A 1LY1A 2E1RA 3GLGB 1DADA 2WMOB 1G6OA 1K8RA 3PG5A 2GILA 1IN4A 3P26A 4I1SA 2YC4C 2VP2A 1ZNXA 4Q1AA 3RS2A 4ZO4A 3CUEF 3CH5A 2GHIA 3ONWA 4HLDA 1MR3F 5BN4A 2G9NA 2WJJA 2ZI7A 1UKEA 4BGDA 1EG7A 4PQRA 1ZM2A 1JQLB 2E87A 3JVUA 5DN6A 3OFNA 1T3SA 2XXAA 2WJHA 2A5JA 2GKSA 3HR8A 1NSFA 4N3NA 4XSHA 1OFTA 3CX8A 3ZJYA 2OAQ1 1IN5A 1YR8A 1VCNA 2QQ0A 3CNOA 3W8RA 2RGNC 3UIEA 4R71A 2Q3HA 2V6JA 1VCOA 2QN6A 3VNVA 4IXMA 2C96A 2G77B 2VP4A 5J4KA 4OHVA 1ZNYA 1FMJA 2FWRA 2QNRA 3BB4A 2ZR7A 3F3YA 3IQWA 1E79A 2VHCA 1T5LA 3CF2A 3RS7A 2MSCB 4DIEA 1TF5A 2WWGA 3CPEA 4M9XA 3U3JA 3X1XA 4D81A 2NG1A 4DSOA 2WV9A 3CRQA 5CB8A 1DEKA 2Q0HA 621PA 5JWRA 1FP7A 1XMIA 5FTLA 1HE8B 3QQ5A 1JEEA 1NY5A 1KI3A 5KOYA 5KHOC 2W2TA 4OBEA 4OK6A 2O0HA 4Z54A 3OAAA 5DI3A 3TQFA 1E9DA 5C46F 1A5TA 1N6HA 1U81A 3AVQA 4RSGA 3QY0A 5AUNB 3LWNA 1WRBA 4Q03A 2FSHA 3U7HB 5J4LA 2CXXA 3P20A 2QT1A 4B33A 4N0EA 1OXXK 4F38A 2BMEA 3BK7A 2IHBA 2V1UA 1GKUB 5DYGA 2PZEA 3BIFA 3L0PA 3AGQA 4HAZA 2KE5A 5BN5A 5JJKA 1JAHA 2P65A 1G8PA 5M04A 3NBFA 2VPPA 1X8JA 1SVWA 3NEYA 1M7GA 3RVBA 5KPJA 4Q1EA 4DLTA 1XZQA 1TQ2A 4KFSA 3A1UA 1T4GA 4FD2A 1KY3A 3O47A 3K70B 1QHNA 4LJ8A 1KSHA 4NYIQ 3QNUA 2OFWA 1KDOA 2CHGA 2OO7A 5BYJA 1KK3A 4ASUA 2GCOA 2VHUA 2J5XA 4F4IA 2ZYWX 4W5HA 2CMKA 2DFTA 2JGNA 2KJQA 1ZINA 2FZ4A 4A36A 2QM8A 1WCV1 2Z0MA 4CVNA 2TMKA 3RRNA 1H8ED 3U7GA 1JJVA 4WW0A 1VG0B 2ZU0C 3I8XA 1H8HD 4Q18A 4MKHA 3FMIA 3GFOA 5TV2A 2G6BA 4TL7A 4JKIA 4A82A 4M1TA 1T3LA 2F1JA 2VA8A 1LF0A 3FB4A 2XZOA 2NO0A 3TBKA 4A2WA 4LCBA 3GLGA 1EX6A 2BMDA 2FFAA 4TYQA 2IS4A 2WJIA 2N46A 4MDFA 2W83A 2IYSA 3K09C 1JR3E 2OV2A 2IL1A 4QHTA 5FUWA 3SQWA 2CLSA 2ATXA 3N2IA 5FOSA 1QVRA 1XB2A 3GCGA 1R10A 1E79D 1QHXA 4LHZA 1ZYUA 3UK6A 1KI8A 4B34A 5CB6A 4IVPA 4NYJQ 1ZCAA 1T0JB 1Z0DA 3SHFA 1XU4A 4MYUA 4QBGB 2ZE8A 4OI1A 3CZPA 4KLNA 1CRPA 1MABB 4M1MA 4EPTA 4ARZB 4BE7B 3GLHE 5AJWA 4EFNA 1BS1A 3T5GA 3TUIC 1CR4A 4PC3A 2X19A 1R8SA 2WWHA 2ZRLA 2R6CA 3W9YA 4UJ3A 2ZPTX 4V0MA 2HT6A 4LBYA 4QOSA 3OAAD 1XEWY 5C18A 2XSZA 3KKMA 3LLMA 2D2EA 2J7KA 5KUTA 3TSZA 4DBLC 3CR7A 1KDRA 2ZRMA 1OIXA 5CDFE 3DKPA 1U9IC 4JJZA 1RJ9B 3OHMA 2NOAA 1P61B 2EYUA 2YKGA 1RPZA 3PFIA 5F9HA 5JEDA 2P5SA 2OG2A 1I4DD 2CCKA 4G01B 1TF2A 2PLRA 3E5HA 1KNQA 2VP0A 2VP5A 1EFUA 4FMCF 4JVNA 3BH7A 3UMSA 1QG4A 1N5IA 3QXCA 3R8CA 2AX4A 2R44A 1NMYA 3IPYA 4A1FA 4I1OA 1RVDA 2QL6A 3I72A 4DCUA 4Q02A 1E2QA 4DHEA 5AK0A 2QAGA 2QROA 2ODWA 4IDPA 2WIAA 3U44B 2ZYVX 1YZQA 1D9ZA 1AA9A 4UNPA 1D2MA 1FUKA 1KI2A 2ZROA 3RYTC 1A7JA 5BW8A 2GDJA 5A5GA 3PUZA 5FR2A 5DI9A 1HQYE 4QKQA 4BLRA 2JEOA 4B3CA 2XZLA 1B23P 3DMDA 1NKTA 3B5JA 2OE2A 2QPOA 4AWXA 2VQSA 1G4UR 1US8A 3TQCA 1JECA 2XTZA 3TGPA 2ZS8A 2B7CA 1DAMA 3C8UA 1MRNA 2Q9CA 2WWIA 3QJYA 3V00A 4M2LA 3JVVA 4XD7D 3THYB 1SKQA 1NIJA 1OIVA 2WOJA 3GMTA 1IBRA 1HQCA 4C30A 4RZXA 2G88A 2EW1A 3GEEA 2EWVA 5CK4A 1WE2A 4BLOA 4P32A 1Z0JA 2NTYC 1Z29A 1S9DA 3AEZA 3B82A 1MH1A 4MUBA 1M7BA 2BMFA 4A92A 5GJBA 3FMPB 2VHJA 4D0LB 1ZM7A 1GAJA 2XTNA 1P2TA 1RRFA 2FF7A 2VTKA 2BIFA 2ZSBA 2GEDA 2JIZA 3I4LA 1OJLA 1SXJC 3GFPA 1ZIOA 2PJZA 2JLSA 3KL4A 3D3QA 3UWOA 1KSFX 4XWOA 2QAJA 4JLKA 4D4LA 1E9CA 1NN0A 1OXTA 2IYQA 5KSOA 3PEYA 1KK1A 5GVRA 2XITA 4EPXA 4GZLA 1ZC3A 5JBQA 1R5BA 5K8IA 4KBGA 3I73A 1NLZA 2DBYA 4B3XA 2OT3B 3PUVA 3RLFA 2I3BA 1AJEA 1E2EA 4HEJA 3PVSA 1OYWA 2FSIA 4Q66C 1CJVC 3MUFA 4UXJA 2X2FA 4BLPA 2D7DA 1IXSB 2P3SA 1CR0A 1FUUA 1YRBA 3AQ4A 5IRCD 1MABA 4KFUA 3I3SR 4II7A 4ESHA 4NTZA 4BRUA 4XTCS 4KO8A 1E9EA 4D0GA 2GESA 1PLJA 1Z28A 1F60A 2PMKA 3L82B 3N70A 1X6VA 3K0CA 5HKKA 1GRNA 3M1IA 4M1KA 3ZYCA 3Q3JB 1VCIA 4PSVA 1XF9A 3SJAA 4DC9A 3LQRA 5EUMA 1A1VA 4JIMA 4M9ZA 2QG6A 2AFIE 2AR7A 3MJHA 4QL3A 1IJFA 2JA1A 2W0MA 3KKOA 1E0KA 1Q1BA 2C04A 5A0FA 1PVOA 1VPLA 4JS0A 4HSEA 4C0JA 1BO6A 1CEEA 4AKHA 1R4AA 2EFGA 4ZCIA 1TNDA 2YYZA 3EZFA 3LDAA 4JLBA 4BEJA 3DHWC 5FR1A 2WJGA 1IONA 2YJTD 3EIEA 1G8YA 1SVSA 1EGAA 1U2RA 3QEOA 4MGZR 1XD9A 2OBMA 3K53A 5TY0A 3GJ0A 3IUYA 2VO1A 5KDDA 2GCPA 4US0R 1M7HA 4DSUA 4F4CA 2QU8A 2BJVA 5JWOA 5B30A 4DUGA 1HEIA 2QY9A 2HJVA 2O8DB 1P7CA 2UZ3A 2ZS9A 4M9QA 5JJLA 4A0RA 2O8BA 4DLZA 1AS3A 3K70D 4EPRA 3U44A 3AF4A 2JLWA 3A37A 1YZUA 3K0AB 2LKDA 4TMKA 4OHZA 3LQQA 2JJ2A 1S9HA 2OHFA 3RRYA 2XNDA 1QHGA 2QRNA 3OEHD 3QOFA 3HYTA 4A0FA 3MWLA 1U0HC 1RW4A 4HI0E 1OXUA 4BFWA 5E7MA 1E32A 1E98A 3EWAA 2C77A 1UBEA 1E96A 5FL7A 3BERA 1G5RA 1ZMXA 3L0OA 3ZGXA 4TTQA 4YC7A 3THYA 1GP2A 1UEJA 2P5TB 4FMDF 3AF1A 2Q6TA 3AVWA 2QZ4A 2BCGY 1NJFA 4YMWA 3UPUA 1MO6A 4IKEA 1FW6A 3MRSA 3MG9A 3PITA 1E1RD 1FFHA 1LW7A 1E2KA 1HY3A 3GP8A 1OFUX 2Q9BA 3EZ2A 1JNYA 4M21A 3KUDA 5C1BA 1Y3AA 2YWHA 3GLIE 1LTQA 1OE0A 1UDXA 3T5DA 4E5UA 4UXIA 2WWYA 1DTSA 4TMZA 3RS0A 4ON9A 1XEWX 1RIFA 1DE0A 5D3QA 5JCPA 1Z6TA 4G1UC 3IKJA 4YDHB 2ZJBA 5FPKA 2R8RA 3ZLJA 2ZJOA 2G0NA 2XTMA 1GKYA 1XJ0A 3CX7A 3EA0A 1AS0A 4XVRA 1QHHB 4JVSB 5HKKD 1Z6YA 3VKHA 4WXRA 3IDQA 2Q21A 2XOKA 4Q9JA 4B48A 4PO1A 4DSNA 1R0YA 4TLCA 4OI4A 4D4MA 5J4VA 4QM7A 2EFDB 2ZYUX 1ELOA 2O8FA 2HCBA 4A0GA 4EJSA 2W6JA 4PPGA 2OM2A 1U8AA 1K6MA 4D26A 2R62A 4M0LA 2BCJQ 5FH9A 3QPWA 2ZREA 1DAIA 2F7SA 3LO5A 4G5SA 2A5YB 1NG1A 4Y0VA 1LFDB 1SKYE 1ZD1A 1YR7A 2GAOA 3CNNA 4ZPXA 1G5TA 3FYHA 3U4QA 3KQHA 4LC1A 2DWQA 4CT4B 5EE3A 3W6NA 1PZNA 2IYWA 2X2EA 4F4JA 3PV0A 3L0IB 4CEJB 3LRPA 4RD1A 4UNSA 3QPVA 1AM4D 4JLVA 1ZM3A 4B47A 4O2RA 4M53A 4CRWB 4X8HA 1IN6A 5KNCA 2H92A 4US1R 4GZMA 1NRJB 1NVVR 1Q22A 2F9LA 4M1OA 3RDPA 4WAUA 3S1AB 4AY2A 4A0HA 2JJ2D 2ZEJA 3CO5A 4PZLA 3GLHB 4DEXA 4RD4A 3AUXA 2K5UA 2NO1A 3K8YA 4GFDA 2G1JA 4N0DA 2CDNA 4IJMA 4PAOA 4ZI3A 1WF3A 4QBIA 3P1JA 4DB4A 2C9YA 3IILA 3LVRE 5J40A 3B1ZA 3T61A 4M4SA 5B57C 1P9WA 3NH6A 4KSBA 5KYKA 3U3MA 1G16A 5CM8B 2RGBA 3TUJC 1PLLA 1XNJA 1T91A 2WTUA 2FX3A 2QT0A 2ZRIA 3OZXA 4NU0A 1XFAA 4DCSA 1DAEA 5JRJA 3I62A 4PQYA 5AJZA 1G8FA 3T1TA 1W5SA 1KAOA 3A4LA 2WKQA 1BYUA 1YZKA 3C41J 1FZQA 2WAXA 2ZRDA 4DDVA 4TMXA 2ODBA 1Z06A 4JBYA 1NVWQ 4LGMA 4WXPA 4BFXA 2PT5A 1KK2A 3G0HA 4FWIB 4EFLA 1GRQA 1DS6A 3LX8A 1QG2A 4TSFD 3I92A 3NBXX 3SJZA 1E2IA 1G6HA 4QJ5A 2JASA 3BRWD 1KYIA 1W5TA 4QNMA 1A2BA 2GJKA 3CH4B 1F5NA 2QUZA 5IK2A 2PJRA 3HWSA 1DO0A 1Q1EA 3V9PA 1WBBA 2QTFA 1JBKA 3KB1A 5EE0A 1IY0A 3EG5A 5F9FA 4TN1A 4X8LA 1OFHA 2W6JD 4JYCA 4IEEA 1Z6XA 4PX9A 2OFOA 2JLUA 1P9NA 5FBRB 4MH0R 2WBLC 2BKUA 2IK8A 3ZD6A 4A6PA 2NQ2C 3KQNA 5EXSA 1V43A 4TTPA 4BFZA 1ZUHA 4IOJA 1FQKA 2GJSA 2XXAB 2C2HA 3W8NA 1IHUA 4LYHA 3BFKA 4AYTA 3TIFA 2ZUCA 4C9BA 3SE0A 3THOA 1N6KA 1QHHA 3SYNA 2BOVA 4URVR 5KDOA 5DE3A 4JLMA 821PA 1OLOA 4BUJA 1N6LA 3QKSB 2EFHB 1FTSA 1J2JA 1TQ6A 3ZVNA 1II0A 4RCZA 3AB3A 1KIMA 1R5NA 2ZSFA 3TW4A 1Z6AA 2VHTA 2QRZA 1VHTA 1W1WA 4POAA 3U5ZB 1NMXA 2P2LA 4TLBA 1MOZA 2HUPA 4PO8A 3W3AA 421PA 4ESVA 1N6PA 2F6RA 2IEZA 4IDNA 3T06B 2V54A 3A4MA 4MYTA 1NP6A 1R0WA 2J7PD 4MITA 4KFRA 1HURA 2F1HA 2C8VA 4FN5A 3U2QA 4BQSA 1JR3A 4Q4JB 3RSOA 1W36B 1YHNA 4YXWA 4B2PA 3VKGA 2ATVA 1LV7A 4XVQA 1KO7A 5A4JA 2RCNA 1CS4C 1TU3A 2IXFA 4BFYA 4BEBA 4TYNA 1NIPA 5AUOB 4ZDWA 5SZHB 2AWNA 3FMFA 5FUVA 1XPOA 1O87A 2JJ8A 1X1SA 1ZM9A 1RFLA 4W9MC 2AD5A 5J4HA 2DR3A 3S1AA 2R2AA 2P6NA 3BB1A 3GLHA 1D6JA 3QG5A 4AYWA 2KSQA 5DHFA 4HAUA 5ANRB 3VR2A 1EFHA 1WP9A 3AVXA 4TT3A 2CE7A 3E70C 5LB2A 1UKVY 5HZKA 3QF7A 3CB4A 3QENA 4LHXA 1OV4A 4FCTA 1II9A 3K1JA 2QP9X 1DAHA 2OXCA 2R6AA 1ZP6A 3KJIA 3NBYC 2YWFA 2IYXA 3ASYA 3KB2A 5CDFA 1NSTA 4TL8A 1RRPA 2PT7A 5CM9C 1L2TA 2IUUA 1XBTA 4C3ZA 1IN7A 5EXPA 2QEQA 1ZD9A 1E9AA 3B60A 2A78A 4QXAA 4LJ4A 1GDDA 2BV3A 5CIWA 5SZJA 2FPMA 4QGHA 2P6RA 3AVVA 3MCAA 2JCSA 1NKSA 3QF4A 5J47A 2L0XA 4ZKEA 3BS4A 2A5DA 1MO5A 3DVLA 2FPKA 2MMGA 4P4SA 4I81A 3QI2A 4LJAA 2ZXUA 1PUIA 2CEAA 2BVNA 3SS8A 1CJTC 2D2FA 1LVGA 3FHCB 5C4GB 2ORIA 1KI7A 2OZEA 1RC8A 5FBQB 3HPRA 5BN3A 1SVLA 4QJ4A 1KKLA 1E9SA 2YVUA 2DB3A 2BHRA 2ERYA 4EIWA 1P60A 4C0HA 5DGXA 2ZSDA 5KPDA 1XJCA 1Q21A 3GLFB 1Z8FA 1E2FA 3W3ZB 3SJCA 2ZR0A 5F3WB 4Q4AA 1GM5A 3ZVRA 3VQTA 4RY2A 3BORA 1TUIA 2ZUBA 2BEKA 2AN9A 2FE4A 5TXGA 1OKKA 1YZGA 2RGGA 1ANKA 2EWWA 2VF8A 4HDOB 3M4YA 4KBFA 4LZZA 1G18A 1G41A 1SVKA 2CJWA 4YXWD 3GLIB 2ZI9A 3QKSA 2WM9B 3K70C 5JRZA 3LFUA 2GBLA 3DOEA 1ETUA 1I2MA 1N0VC 1ZRHA 4PHHA 5TARA 4C7OB 2SHKA 1HT2E 3BWDD 4LHYA 4LV5B 2I1QA 3KXLA 1ODFA 2WAYA 5KTYA 1QRAA 1KMHB 1UADA 2PCLA 5JS7A 1SXJE 4HUTA 4QBFA 4PC2A 1GILA 1GUAA 2J87A 3WRXC 5H1YA 4TT3D 4ZCLA 2VYFA 3VU9B 2R6FA 1VTKA 4NE2A 4AG6A 1II8B 1S3SA 4Q4JA 2GZHA 3M0EA 2QE7D 1UEIA 3KZ1E 3TSWA 3CX6A 4Q1BA 4TQAA 3VHXA 2QAGB 1R7RA 4B76A 5FOUA 5JECA 3THWB 2FDCA 3IEUA 2JJ1D 2WWFA 4KITB 4Z51A 4Q7JB 2BM1A 2KBEA 3SZRA 2KB0A 3SBEA 3TLXA 1XPRA 2XNSA 3H4MA 4JMPA 3DL0A 5EP3A 4NCKA 1XTKA 2PZGA 1DOAA 1N0WA 4LPSA 4RJLA 4DDWA 4XWKA 2ZU6A 1YU9A 1VKJA 1Z0FA 4ABYA 1US8B 1XXHE 4NKRA 1UKZA 2ZI5A 3SFVA 3OE7D 5J4YA 4IHQA 4GOJA 1D8TA 1KZ7B 1W47A 2ZRBA 4ACBA 3SEAA 2X77A 3GEHA 4PAQA 2ZRAA 1AGPA 1DELA 2IBMA 4O0MA 1KZGB 1XTQA 1VCMA 1VMAA 4NONA 2ZRPA 3ZH9B 3X1YA 3RWOA 2B7BA 1E9FA 3RS3A 2OFXA 1G19A 2RHMA 1G7SA 4OHWA 1OB5A 3VR6A 1SVIA 2FFQA 3HJNA 2IS2A 1LB1B 2OBLA 4NDZA 4Z8XA 5EE9A 3KUCA 1E9BA 4QGFA 4CW7A 5K8TA 4L5BA 4AC9A 2VL7A 2XJ4A 1L7VC 5CITA 5DYIA 3CBQA 1ZM4A 3OFND 5DN6D 2FV8A 3DOFA 2J59A 5EQTA 3FVQA 4FWTA 3TR5A 2H16A 2BM0A 1VG9B 3QBTA 3WBJA 2HYIC 3VR1A 5IT5A 2DYKA 1OKKD 3CWZA 3LVQE 4NZYA 1P9RA 4FMCB 3U3RA 2CVFA 4GL2A 1XTRA 3CF0A 1FNNA 1HT1E 1NBMA 1Q1QA 2GZDA 4Q4HA 4RD2A 1CULC 5TDHA 1W4BA 1ZNWA 2Z43A 3FWYA 3R9WA 4BLSA 2N1BA 4C4PA 1OH6A 4XH9B 5EXXA 4JVLA 3AP1A 4KVAA 1EWQA 3GLFA 2YOHA 2QORA 2O8EA 3BFXA 4GP6A 2LWIA 4V02A 1EX7A 3Q5DA 2O8CA 3ADBA 4MRNA 3F0TA 4TL9A 4JLOA 4Q00A 1P75A 3HPQA 4KI0A 3TK1A 5JI2E 3UXMA 3VX4A 1T9HA 1JXOA 3TR0A 1JPJA 1Z0IA 4D2IA 4TYPA 4FIDA 1W36D 2ODEA 1XEFA 3SYKA 3GLIA 2IWHA 4CDGA 4MKFA 4C7OA 5E7IA 3L43A 2XEXA 1SULA 2B8WA 1W48A 2GJAA 1LS1A 2D06A 3KJHA 4JBWA 1KMHA 3W34A 3CRMA 2P6UA 3I5XA 2JLYA 4Q5IA 4CZ2A 4Q7MB 3ASZA 2VF7A 1UBGA 4FXPA 3BD9A 2GF9A 4DSTA 2H57A 1J90A 4HDQB 3VU9A 4PHTA 4XVUA 4EAQA 1E0SA 4KAXA 3IQXA 3IHWA 3K0EA 3SFZA 2I1VB 1II8A 3MFYA 3DPUA 1TPZA 1CXZA 2F3TA 3B8HA 4ZCMA 4Q1DA 1W0JA 1NN3A 2GJ8A 4RZ2A 3BC1A 2ZE5A 4W7SA 3SDZA 3THWA 1N6NA 1QHYA 3IGFA 4O25A 4YMSA 2O8BB 2VHQA 4F93B 3V4FA 3ZQJA 4G5RA 4MRSA 2YHSA 4ASUD 2HDNB 1XWIA 1KJZA 1HUQA 4DWJA 4Q1FA 1YZLA 4FW9A 4B32A 5JHGB 3PUWA 1DPFA 1NG9A 3K9GA 2GXSA 3OIWA 3VKWA 3TE6A 1P62B 1IN8A 4V0KA 1UBCA 3PENA 3GJ4A 1KNXA 1G291 1PLKA 1ESMA 3QKUA 4B2LA 1CBUA 4KHZA 4LYFA 3U60B 4BASA 1BYIA 2F55A 3B9QA 3QPUA 5JSZB 4QGGA 3KXIA 1GOTA 4P33A 5HCNA 4A8JB 5GJCA 1E9RA 1W46A 1NBMD 3PXGA 1XMJA 3N2EA 4OQMA 3SNHA 4S2EA 1S4QA 1UJ2A 3AVPA 3WNCA 2FNAA 3KQUA 2RGNA 3SJBA 3U6BA 6Q21A 3QG1A 3B1WA 2E9SA 2C95A 2V3CC 2ODNA 4KCGA 4AKGA 2J0UB 3FFAA 5DIFA 3Q9LA 2ZI3A 3RABA 1ZCBA 4I1UA 4YDSA 4GI7A 1YR6A 2Z5FA 1PJRA 3B13B 4LUCA 4E03A 3R8FA 3B2EA 2G3YA 1F3OA 3BGWA 5JEEA 4DCTA 4RFVA 4WBSA 1G3RA 5K8UA 1ZBDA 2NO9A 1D5CA 4NCJA 4BLQA 5AJXA 2XSZD 3BE4A 2C98A 2HEIA 2W2VA 1E0JA 1EK0A 8OHMA 2O8FB 1Z6GA 2WVJA 4EJSB 3UG6A 2QQEA 4KFTA 1YZTA 4OYHA 1IJEA 4L4UA 1SHKA 2V55B 3SN6A 2RGXA 2IS1A 3QBVA 4H1VA 3I1FA 3DEFA 1FP6A 1R0XA 2JATA 3U4QB 1U90A 2HJGA 2ZJ2A 1TEXA 2IEYA 3QXSA 3L2OB 1GNRA 2H7VA 2IYLD 4NHOA 3CPJB 4FI3C 3O8CA 2A3RA 2AFHE 3B6EA 4MRVA 4WZ6A 2O5VA 1G4AE 2J1LA 1Z0KA 4ITRC 3BOSA 4ILEA 4MRPA 4QHSA 5CLLA 1KI1A 4HB0A 4OKSA 2NPFA 3SC3A 4E09A 2BBSA 1EWRA 3ZQ6A 3ICQB 3FFBA 1U98A 3WHLA 4FMDB 4JVMA 5FPSA 1KAGA 4XWAA 4L9SA 3KKNA 5IHPA 2IHYA 1LF5A 1IOZA 2P67A 1HA3A 2LCFA 3FKQA 5H68A 2DCUA 1KI4A 1F2TA 4OQNA 2PX0A 2RAPA 4AURA 4OHYA 2GVDC 5G53C 2G1KA 3TAUA 3VX3A 2VH5R 5LDDC 4LJ9A 4U02A 2ANCA 1UDWA 2O0KA 4Q7KA 5KNDA 1W4RA 1G9XA 3IBGA 2J3EA 4UXHA 4L16A 4HZUB 4C2TA 3EWSA 1QDEA 2A9KA 2ZIAA 4JKYA 3RC8A 1GG2A 4F91B 4HAXA 4UKDA 2GVZC 1KDTA 2ERXA 2PEYA 3PEUA 1X1RA 4OL0A 2VP9A 4G3XA 1DAFA 1XTSA 3TVDA 3FKSA 4KYUA 1GSIA 1G1MA 3PUXA 4URUR 4BFTA 3D8BA 3KDSE 4HB2A 1LS6A 5LB4A 4GBMA 1C1YA 4B2IA 3K0SA 4NYMR 1AIPA 4YMTA 1YRAA 1GRRA 2JIZD 1Q1ZA 5LD2B 2JDIA 4LBVA 3A36A 1RYFA 4PSKA 3RRMA 3V4RA 4CEHB 1X8LA 3K09A 1ZU5A 4OK3A 2ZM5A 1R2QA 2B92A 5JSZA 1Q44A 3ETLA 2XZPA 4MA4A 1VHLA 4NH0A 4DCVA 4A8JA 1C4OA 3ZS9A 1ZW6A 4LJ7A 5AWFC 4UNNA 2H18A 1X3SA 4MGIR 2VP6A 4PFSA 3OIYA 2ZJ5A 4AIIA 1XCPA 3WXMA 3EIHA 3B85A 4XJXA 4OQFA 1G20E 1WA5A 3QKRA 5G3YA 3KQKA 4AKIA 4YMVA 2J0UA 5B58C 1Q12A 4JLDA 3NDPA 2ZS7A 3NG1A 2PEZA 1FL9A 3E2IA 3H2YA 4UNRA 1HV8A 3CW2A 2IF2A 3AP3A 3CONA 2A7QA 1IQPA 1F2UA 1U9IA 3B9PA 2LKCA 3EARA 1VIYA 1DVRA 3K0FA 1VECA 5CIQA 1IY2A 2BBWA 5GADl 3C15C 5KO2A 1P5ZB 1D9XA 1XCGB 2ZSAA 2PX3A 4G0NA 3LW7A 5FBWB 1V5WA 5HE9A 1FPMA 1VDZA 5EZ6B 4DLVA 4I1VA 4OK5A 4LPKA 3Q85A 1CIPA 2ZJ8A 1E2HA 5BYKA 2XGJA 5DLQC 2ZRNA 2F3RA 2I4IA 2FMXA 3GJ7A 3WP0A 1G3IA 3C5CA 3THXB 4J0QA 1X86B 4QNRA 3PUYA 4JLAA 3RSLA 1S8FA 1MV5A 4DUGD 4HLUC 1E2DA 1FX0A 4HB4A 2MMCA 3CRRA 5EE1A 1NN5A 1UKYA 5EP4A 5FBLB 3NTUA 1MT0A 4NPHA 1AGRA 2QSZA 5JFGA 3P4XA 2GXAA 1DARA 5FL3A 1U8ZA 3FKSD 4PQFA 2DY1A 3NEJA 3R20A 3LXRA 1RE0A 2XNDD 1JR6A 3LY5A 4PZYA 4Z1MA 2VRWA 4QM6A 1P72A 1J8YF 1QF9A 3HU2A 5FUYA 1MKYA 2ZRGA 4URXR 2IX3A 3ZVMA 3OEEA 4BLTA 2IYRA
chains in the Genus database with same CATH superfamily
1Y7TA 2OXRA 2XCQA 3FMOB 2VDQB 5FL7D 5IKEA 4QYTA 1QBKC 1YDEA 4HH4A 1RTTA 2QX4A 2Y8EA 5AI5A 2VJDA 5AOVA 1U0OC 2PLWA 2EGUA 1YMQA 4YCLA 2V59A 2H06A 4QWMA 4BFCA 1N2XA 1U2GA 1AZWA 3RRJA 4EDHA 2HSGA 4Y6OA 4ZTUB 1LI7A 4HLCA 4FT4A 5DPMA 2KW5A 2WTNA 4GGPA 3MGBA 2FSGA 2W6ZA 2XWJI 1E2LA 4U9IS 3W2EA 3W5IA 2J3DA 5TB5A 3FPAA 4MS1A 1LRLA 3IIEA 5H70A 1H4SA 1AD2A 1E2GA 2QP3A 4IW3B 3NNDA 1LU9A 4IFBA 4ZAXA 4B5LA 2A5GA 2VTEA 3I6BA 2LRHA 3LV8A 4RF3A 1XZMA 3R6LA 5CH5A 3I76A 1M1YE 1O58A 1UBNA 1U3VA 3Q87B 5B12A 3PICA 3HSKA 5SZKB 2HJ9A 5ERGB 1SCNE 4P4SB 3V4VB 4P53A 1X1TA 2Z08A 1V7CA 4LJ6A 2OO5C 5F7XA 4FM9A 5EJGA 4B83A 3TQRA 5DTQA 3SDSA 2YZMA 3V4PB 1MENA 4I14A 3AV3A 3B7GA 4PRYA 7MDHA 2DHRA 3A3PA 5JVDB 4E0BA 5BVHB 3DLHA 1UM8A 2IY9A 2OCGA 5KOHA 1TEVA 2JFVA 2IHNA 1YT5A 1ML4A 2JNWA 3C3JA 4M98A 3H17A 5EA2A 5KC9A 3RVJA 1L6IA 3PRJA 1UEXC 1XXHA 1Y81A 1EZ4A 3QMWA 2HA4A 3UB2A 3ZIAA 2XLCA 3K9QO 1PDWA 4R2KA 1SK9A 3IRUA 4B6FA 1JPNA 3K8OE 4UE2A 5I7VA 1Q16A 4MZXA 4PW0A 4XGIA 2QR3A 3W8EA 1GO2A 2FSFA 5KB3A 4BE9A 1UXKA 4Q4AB 1IEVA 1DG9A 1ZN7A 5EXTA 3V46A 1ZL0A 4EARA 5J2TB 1RXWA 2ZJYA 4FFMA 4ODIA 3GW8A 4ZIRB 2ENUA 2CXOA 4F3CA 4AJIA 4X6UA 3A4TA 4Y0AA 2PSEA 2Y3IA 3AFHA 1J0BA 2YCBA 3DE3X 3HLTA 1Z5WA 4UREA 4C21A 5K3BA 2L42A 1FSFA 2H1OA 2XUIA 2CJXA 2PCJA 4D7AA 4IRMA 2NPOA 3U0BA 3EMDA 3REFA 4EHJA 4HT3B 3M4JA 5DT9A 1KYTA 2G8LA 4R9SA 1L8OA 4L2IB 1I9CA 1KBZA 2EGGA 4J2TA 5LKRA 3Q4GA 2DFVA 1Q57A 2BLNA 3UJ8A 3T15A 2GN8A 2OLJA 1VL8A 4Q3OA 2GSWA 4ECEA 5CBPA 3ZDCA 2FQYA 2JAOA 3E3LA 2V1XA 1T8PA 4E2XA 1XIVA 2JB9A 5FT9A 1TVCA 3HI6A 2WYWA 1DDIA 4CHTA 2FOIA 1NVBA 4X41A 1JHOA 1FQJA 1M6WA 2QTHA 2QZZA 1N2ZA 3GROA 3HGTA 1M2WA 4HQNA 3TXYA 4EUEA 7YASA 1T9DA 2JFBA 3ZW8A 1M1UA 3ZU5A 3D7KA 4HADA 2JK1A 2XPCA 3GDFA 4QXOA 5F2NA 4IRUB 3HL4A 3Q3GE 4U3JB 1LKZA 3W5JA 4EM6A 3OZTA 3OPNA 1HTWA 4IWYA 5DK6A 3VHXB 3AP2A 2OB1A 3LYUA 1SU7A 1JS1X 2QLJA 4MLPA 5EC8A 1RPTA 5E4JA 4RVUA 3RK0A 3THSA 1PK9A 3WL7A 4N3AA 3R9XB 4D9HA 2NU6A 4RTOA 3I2HA 2BHNA 3M3HA 4HXEB 2BJWA 2A33A 4FKMA 4UBLA 3PC4A 1VYVA 3EASA 3NI2A 4R9RA 4E07A 4NG5A 2OCLA 1MVLA 2PT6A 2XKBA 3TZBA 4U5QA 1KYXA 4HY3A 4UTRA 3PC7A 3MCZA 3NV9A 3GT3A 5KBYA 1IRXA 2AQKA 1GQRA 4MW9A 2J9FA 4AMBA 2KI5A 4E5SA 3QWFA 4KN5A 1PT7A 2W4MA 4O4HF 4H6PA 2Q2NA 3EGXB 4NYIR 4YJ3B 3T7KA 3I5YA 2W0SA 1Q84A 4BNZA 5JANA 4I2NA 2C5AA 2EKLA 3AM1A 5JAZA 2FW8A 3BL5A 4ZQIA 4Y2YA 3QRWA 1UAAA 3BD6A 4INPA 5U9CA 4M36A 5I4KA 2V8BA 5IK2D 3I5AA 1YKSA 1A8QA 2C2MA 1DU4A 7AT1A 1NVVQ 5EPOA 2A58A 1VMIA 1XD2A 1DXQA 4JLNA 4UHDA 4WY8A 4ND4A 4RACA 4NBSA 1PK8A 4BZQA 3R8XA 2I9KA 1Z4JA 1SGWA 3ETJA 3S2YA 1JYEA 3WY9A 4QJ3A 3V32A 3CKMA 1IEQA 1JAIA 1YBMA 1VLVA 3W3AH 5ETJA 3SR3A 2G83A 3PDUA 5E6UB 1QGOA 4R81A 1GGFA 4WJLA 1J7KA 5AJUA 3DDSA 2MSNA 2ZAIA 4F2DA 1SCDA 2P9CA 2ZSKA 4A2CA 2CHEA 2QW0X 2YJ3A 2LCQA 2DETA 1CUYA 1YB4A 1OBOA 1ZI8A 4I46A 2Z4SA 2C2YA 2XZTA 3PUJA 4AZVA 5BVHA 1N5LA 4NYJR 5A5DA 1N2EA 2MSDB 5JVDA 3HK2A 3PZBA 4HD8A 4EABA 1Z4PX 1ULTA 4RD0A 5TQ2B 1DRWA 3MRTA 4Q4HB 2H1VA 5KMGA 5CTAA 1IHPA 1KE2A 2FFRA 2MTBA 4BMNA 3PJEA 4KSCA 5BV0A 5K0CA 3GLUA 2O8EB 4EP1A 1T1IA 3HVRA 1A9XA 5AXBA 1N2CE 4D0NA 5JT1A 3F46A 3IO5A 2F8LA 2IF0A 3J7AC 1IUKA 4QSMA 4ACAA 4IM7A 3UMVA 1B73A 1ZJ6A 1KMQA 13PKA 1VC2A 4RJKA 5I7FA 1K5GA 4BV8A 5J2TA 1F6DA 2GPJA 4Z0TA 4QOHA 4ZIRA 2R8BA 5FPHA 4YUVA 1JKJA 3FUWA 3M70A 2O5CA 1NRWA 3U7EB 3D7NA 4M0MA 2OYSA 1Y63A 2BFBB 4W9NA 2C3MA 4ZARA 3TTWA 5GINE 3B1FA 1CX9B 1F51E 3BB3A 5ICEA 1G1AA 1MAHA 1A3CA 3TSOA 1K27A 3H0EA 3RUFA 4IOKA 4IVQA 4L2IA 4LECA 3L8GA 1IU9A 1H2WA 3VFDA 2EZ4A 1GSHA 3QE9Y 3JW8A 2AK3A 1KIAA 1ZGCA 2SKCA 4QBTA 1UPTA 3A3NA 1GCIA 1OH8A 4YGYA 3IA2A 3WGLA 2P0AA 4NR0A 2BMJA 4I4TF 2IXGA 1UMDB 2VYND 4ZYXA 4DMLA 1EJBA 2NUTB 3A1TA 1S3GA 4P84A 3REGA 4HP8A 3W0LB 4TYMA 1Y5MA 2B6HA 4EH1A 1M33A 5BWOA 1O97D 1AXRA 1U2DC 4ZVKA 4J3NA 3ADCA 2HRBA 3M6AA 4ZRNA 4G1BA 3IBCA 2HHJA 3CNBA 5JH7F 2PRIA 1KMNA 4I1RA 2GZMA 1N5RA 5CURA 5CMLA 2R9VA 2WUEA 3X1WA 4XW2A 1GGVA 1GG8A 1X1BA 2FEWB 2RHGB 3NTQA 3AHCA 4B9EA 2F3SA 4BB9A 4DR2B 3R9XA 1RAIA 4D9KA 4F72A 3NWPA 3X1KA 1NATA 1QG6A 2HMYB 4B43A 4O63O 4OQLA 3F5QA 4CCWA 5AJVB 3H84A 1L7DA 2C4NA 4YRCA 4QVKA 4YK7A 4B17A 2A30A 5CA1F 5CFNA 4S1NA 4G9BA 4Z99A 1S1CA 2V98A 2JAXA 1UKCA 4MQBA 4UASA 4D3YA 2W2NA 2QNBA 5BWMA 1MH9A 1NJGA 3FDIA 5JZ9A 2EWMA 2JH9A 4D9JA 1VKOA 1NBIA 2R8PA 1UMCB 3CKLA 2IIPA 4FBGA 3UWSA 2ASVA 3CVYA 3EGXA 4F71A 1D3AA 2MDTA 3KDAA 4EGJA 2EDAA 1UINA 4WASA 4M9RA 3UHAA 5JR3A 1CJMA 3S2IA 4AXXA 2F67A 2C59A 2F1KA 2OLKA 3PJRA 3DOUA 1SCJA 2C7VA 3NIGB 5C5DA 1RLJA 4DJDC 1ZISA 3FE2A 1B8NA 3DBLA 3BXHA 5HYVA 4JJIA 1SZCA 1N3BA 3Q9SA 4CEIB 4GOND 2J4DA 1MA0A 4L15A 5EHZA 1NG9A 2JAWA 1YOBA 2XD9A 4Q0MA 5DNDA 2DFLA 2A59A 5KEIA 4EKNB 2QD1A 2ZJZA 4UQOA 4DCNA 2OCDA 3WTCA 1OH7A 2W37A 3PPYA 1WMEA 4B79A 2NIPA 2PMDA 1VKHA 2KWIA 1LX6A 4DDTA 3PR2B 3F73A 2ZIZA 1UF9A 2CFRA 1E1DA 2G5GX 2W6OA 3DNPA 1D6MA 1ZMTA 1USVA 2QU7A 4RD3A 3MS2A 4C4YA 3V8MA 3ZKAA 4ENSA 1X14A 1A0OA 2AKYA 1JT9A 4QBHA 4JI6B 1V6CA 2GNOA 3HSYA 3R0QA 5EZSA 3TOXA 1L8XA 2BR3A 3QYAA 5P21A 2O1WA 3DYVA 1JZSA 5FULA 5EERA 3T9DA 1MG0A 1H0RA 2TSYB 5KVQA 4C0AC 4B7CA 4TYYA 1RQRA 1WHSB 3ODPA 2P0EA 4Y7DA 1QE0A 3SHWA 4E51A 1GFWA 1GZDA 1FFGA 4QC2A 3ICOA 5HZGA 3G9QA 3UGKA 2B25A 3Q41A 5JQGB 4DLNA 4WK6A 4ND6A 3CNLA 5C52B 2XB2A 1LPNA 1OLUB 2LZ0A 1GXSA 3OFKA 3V42A 3UW3A 1CF4A 3EX7C 1TQHA 3SX0A 1SIBE 2BFBA 4TTTS 5LIRA 4MAFA 2XQJA 4LC0A 3BEDA 2RHOA 4O4LA 2I6QA 1COWD 4BC1A 2K2QB 3L7IA 4XX0B 2NTEA 3L07A 5AIAA 1KMCA 4XIIA 3UV6A 1I4TD 3ZKWA 4A8JC 1AKEA 4E14A 1IZYA 1P5JA 2PSJA 5H83A 4MVJG 4QDXA 4L76A 1SUIA 1YRHA 4HYYA 1T4CA 1CLUA 2BKEA 1QGUA 3GARA 3FTNA 4BX8A 1I6KA 2CNWA 5ALRA 1EFRA 5D00A 2NUTA 3VR6H 3K9CA 4E1BA 4F3YA 3LCRA 3PL5A 5GJVC 3VR4D 4QDOA 5SZIA 4B3GA 2IYTA 2BKAA 3AEKA 3RKUA 4IBOA 4QD3A 4TL6A 4Z4QA 5ALLA 1MB4A 1V2GA 1EXMA 1FXSA 5EZ5A 1NP7A 3TNFA 3OIVA 4ESOA 1XJQA 3FTQA 3WR5A 1HLFA 3UKJA 5D3ZA 2DQZA 4PZZA 2XYHA 3E15A 4D0RA 3HKCA 2Y0CA 2DVMA 1GZUA 3TL2A 4QVGA 1TO2E 1JIIA 2XE4A 3CISA 5DULA 2Z2XA 2FTKE 2D62A 5UKDA 4KIFA 5IPFA 3BWEA 1O6BA 3OG9A 4KXVA 2YOFA 1N25A 3N2LA 2VJKA 4HNRA 3GRZA 5LYYA 1G64A 3ZD7A 4RK6A 5FOWA 5TLSA 1UMCA 5IDVA 1SMKA 2QBYA 2OYRA 3DCIA 1EBBA 2IHTA 1CUEA 3F97A 3BVPA 2V4MA 4HRAA 4F56A 3DVQX 2B2NA 1QORA 2FVXA 3G9TA 4FT2A 1PUJA 4ETIA 1SCUA 4L9WA 1OQAA 3AWDA 2V8OA 1GDHA 3D3KA 1ML3A 3PF9A 4HFMA 3G8BA 3VA7A 5AHOA 3AY6A 2JJYA 4EEXA 3ND8A 3HBNA 1GA4A 2JLRA 4CKXA 2A94A 4GPAA 1HDRA 3C3CA 3VOSA 4BWYA 1ZR2A 1KOFA 5AESA 1QH1B 4Z9BA 4N76A 3I5MA 4L74A 4CEIA 2I6XA 4MYHA 2DZDA 2YICA 3GGCA 1YUNA 3G0BA 4ZDKA 1RI2A 5HF8A 2NYVA 4B4KA 2NV2B 3DZKA 2VDOB 4JOCA 1E60A 1KHTA 1TL7C 1M34E 5J2UA 2G8NA 2D1SA 3ZW9A 3QLEA 2FCAA 1PKXA 4LMRA 3NHAA 4FE7A 4C20A 2MR5A 3FTFA 3MWDB 1OX4A 3KE8A 4I9GA 4QRHA 4MVXA 4RSRA 3ZBTA 3ZGYA 2ASEA 5K6TA 4MI1A 2WI8A 2I2CA 4ZEVA 4AZ3B 4HUQB 1MN6A 3FGPA 1JI0A 1F2UB 3ZYZA 1E3SA 3GRUA 1L7AA 1CP3A 221PA 3RVRA 4EPWA 4GRDA 3LLUA 4UBJA 3IA7A 5F9MA 4C4ZA 5JQWA 4I3GA 3AT1A 4F4UA 5CG2A 3LTNC 3T1QA 1U28C 2QWXA 1AUOA 2G7MC 4FFBB 3RAPR 1O5TA 4EVIA 1WHSA 4YUXA 1M1YA 2CBZA 4HQ0A 3PSAA 1X74A 2F62A 3EXHB 2IBTA 3BYZA 1QYCA 5CT8A 3GFBA 2XKAA 5JE8A 3VH4A 4H31A 3MINB 4RBNA 3MOGA 3W7VA 3MTIA 5JQGA 5FNVF 4PZ0A 1RJGA 1FMTA 3P9RA 1VM6A 3FHOA 2YW9A 1XEXB 1BEUB 5JOQA 3KZCA 2QV7A 1EUCB 3RAJA 2Z56A 1WP4A 3NRCA 4OREX 3ZIUA 2IHKA 2ZYTX 1WOYA 1SZPA 4OVKA 2O1XA 1L5WA 3SC2B 3B3GA 2AFRA 4RK4A 1XP8A 1GYRA 4C7BA 2JEYA 3PIIA 3T9AA 3WGMA 3LZCA 4MVWA 4X5OA 1BQ3A 4BO9A 1I36A 4GX0A 4AJPA 2NZVG 4J1NA 5GP1A 2R0QC 4MQ5A 3AKCA 1KP2A 3WO0A 4G8BA 4WVLA 4JI8B 4L73A 5CDSA 3PI6A 1B8OA 2ZVJA 3O8DA 1LSJA 3HBJA 1TJYA 3V34A 1SC4A 4B4WA 3BCRA 3ELYA 2PZBA 3VBCA 2HKIA 3CSSA 3VYTB 1PHPA 3T38A 1GNLA 2ET6A 1G0OA 2WHQA 4BMPB 4BN4A 3F5DA 2FW0A 1Q0RA 4IOMA 4MWTA 1Z4QA 3F1LA 2AXNA 2NUPA 4OM7A 4BGVA 2Q4TA 3CBGA 1DCFA 1JPUA 3EVZA 5J3JA 3QLUA 4TT8A 2BP7B 2QD3A 4DDMA 1YJ8A 2YC2C 2VKTA 3AKYA 4P86A 4W5JA 3A1EA 1NVEA 3FNBA 3HFJA 2BTEA 3JAKB 1T26A 4J0EA 2YUIA 3HN2A 1DQNA 2CXHA 2GR9A 2HLDA 1YS9A 2IEAA 2PRZA 5E4FA 2OA0A 4CV3A 5IJZA 1CY8A 1AUVA 2J9RA 1SXJB 3I8OA 4DV0B 1U0JA 3O2QB 1EFCA 2PYZA 4M1WA 4UUOA 5TGDA 4TX1A 3BF8A 4AP6A 1OFVA 3EFEA 3N74A 3JYLA 2EZTA 1ZICA 3D4NA 3SBDA 1QM5A 1RPJA 3HWRA 2B8TA 3KR1A 3LC2O 4PPQA 1I9GA 2QLFA 4G0WA 3MZ0A 3OMLA 4WNIA 3T35A 2Q5HA 4QPPA 4PR0A 4E5NA 1JQAA 4F4HA 4F04A 3ENVA 3GLGE 2P9FA 3SSNA 1TGVA 1Q92A 1WG8A 2NW6A 3F6EX 2PMCA 1IYZA 1XA0A 4DA0A 3WK8A 1XZFA 2L18A 1VA4A 3EF1A 3ETHA 3LQ1A 3QPBA 4GI1A 1ZQ9A 1QH1A 4QATA 1KI6B 1NBME 2CK3A 3O8NA 1QHSA 4V38A 5HILA 3U62A 1L5OA 3W78A 4BIMA 3H2GA 5BQ5A 1XD8A 2V7GA 1LDBA 1TM4E 2QTWB 3GR6A 3TO5A 4F6RB 3RYHB 4LDJA 2PUBA 3KOWA 1U1CA 2C4MA 1CNEA 3Q72A 2HBYA 4GL4A 1Z4MA 4BN5A 5L40A 3LBNA 2P69A 1R1DA 1RLTA 3EW9A 3ESRA 1K8YB 4RZUA 2XUPA 2FMFA 3EN0A 3PKZA 4BJHB 5DNYB 3UK7A 2IT1A 1UJCA 3PNVA 4FOPA 5K45A 4DNXA 4E22A 1N0IA 4HUQA 4DC0A 4GOLD 3C5WP 3TEJA 3IP3A 4QOEA 4AY4A 3H5IA 4DVGA 4V0ME 1ID1A 1XAHA 2HX1A 4LSWA 2PBRA 5KNDH 1AV6A 1EDOA 2FG6C 1QR2A 1UOEA 2FU5C 3F90A 2F4NA 5K0TA 1FZTA 2O2JA 4URYR 1VQ1A 3AI2A 3R40A 2FGJA 4FFBA 4KQ1A 1H5QA 2I7TA 4KGXA 1WDTA 3EZXA 4N54A 2ZBUA 3CUWA 3EXHA 3M3PA 3ZDXB 2CLCX 1UBUS 4PN7A 4GMXA 1YDGA 3UJAA 1OLXA 3D5QA 2LXNA 2JIOA 3MINA 5KQSA 4WCVA 3K1ZA 3FLEA 1OY1A 1P7VA 3QMVA 4H60A 1WX1A 1XEXA 2PQ0A 1UC8A 2YWGA 4MYCA 3IT1A 1KEZA 1EUCA 2AI1A 3TDNA 1IVSA 5AM0A 5F1PA 1JXMA 2CE2X 3HHPA 4PANA 1DJLA 1AQJA 4FNGA 2XTJA 5JJIA 3DZDA 1KAQA 4JLPA 2XB4A 1NJ1A 2VPWA 2ZTSA 1K6IA 3GOQA 4L75A 4BU1A 1XFDA 2HSDA 2QLTA 2XA9A 4FI3F 4YONB 3U56A 2QTLA 4LF9B 5FPQA 1FBTA 1P4SA 3CH7A 3VDXA 5KTTA 3B7PA 3A6ZA 2Z6AA 4ETMA 1N1GA 3NDBB 3GJQA 1XX6A 1UBRS 3G2PA 3R5JA 4J0DA 1N2CA 3RYCB 1ZVKA 2FW9A 3L1UA 2YRWA 3ROGA 3EZNA 2ZZMA 1SRRA 2GOYA 4RETA 4RTMA 3B2NA 3F6YA 3ASUA 5A1TA 1COZA 2I34A 5HOEA 2IYYA 3PI7A 5HIKA 1SJ9A 3CF4A 4BB5A 2PZMA 2ZUDA 3IKVA 1EPUA 4XWTA 5CJ2A 4UMDA 4EG0A 2BC9A 1E62A 3K71B 3G5UA 2JDID 1RADA 1MAUA 1G5IA 2QA5A 2C5GA 3DKVA 1KDVA 5G1NA 4LC9A 1QLWA 1OTHA 2REQA 3GQBB 3I6QA 3G79A 2BP7A 1LVUA 1DT3A 4FE3A 3F8TA 4BZPA 5KDLA 3IAEA 3U4AA 1W4LA 3CNQS 2GWHA 4MVJD 4U2GA 1AB6A 2DT8A 2XQIA 4BB6A 2C4VA 3MAAC 4F2HA 1GGNA 4JJKA 2CHUA 4R9UC 2PJDA 3KZXA 3A70A 5EIBC 3SLGA 4PC7A 5TQJA 2C8KA 2MSEB 1WB5A 4S04A 3U16A 1RWOA 4JITA 1OPXA 4U7WA 5BV2P 1KJJA 2J6CA 3KB6A 3GJ6A 5HNKA 1PNQA 4II2A 3HJCA 4YMUA 1DO2A 2ZWPA 3C5VA 1E1LA 2C1ZA 4WA7A 5SY6A 4HWRA 2O8DA 1LJ8A 2B1QA 2VN8A 3A1CA 3N05A 1E7QA 4KZKA 3L7JA 3KBOA 4OXYA 3SLRA 3UH0A 1SUFA 1NVUQ 1UQTA 3H2KA 3NCTA 3S8EA 1XZLA 2O23A 4HX5A 2JH8A 3UH1A 2BONA 4TTSA 2QW1A 1ABBA 4LF8B 1D1TA 1HZJA 4PSAA 1ZVVA 3TJZA 1N6OA 5E9JA 4YCAA 4IQFA 2QYSA 3ESYA 1X2BA 2V7BA 3FPEA 3N7TA 4H7KA 4C5AA 2I9PA 2GTPA 2WF6A 3UAGA 1RRGA 4P98A 4TV9B 3RJMA 1AMNA 4Y2JA 5H4GA 1RPAA 4F6RA 4HAVA 5JSUA 2ZZKA 4NYMQ 5B7GA 4D80A 1TM2A 3CRVA 4HZIA 1DOZA 1NUTA 1X80B 3GN1A 4Y2QA 4I7EA 4LZPA 2G82A 4C29A 1IXKA 1KU6A 3ABZA 5DEIA 2XAUA 1C8LA 1OW3B 2R6HA 4AI6A 3DE4X 4J0IA 5L6LB 3GO4A 1UWKA 1W2GA 3BQ9A 1T10A 3AV0B 3LQKA 5K6RA 3INTA 3P2YA 2C57A 4RS3A 5IVHA 5TC4A 4CR6A 2GUWA 4D4GA 2CDCA 2AJBA 2H5EA 1K0FA 1I14A 2WSLA 2DULA 3BZBA 5FUXA 4DNPA 3ONFA 1EGVB 2CFOA 1JEDA 2I6GA 2DSTA 3VAZA 1R0ZA 3K0HA 3TRFA 5KU1A 1DINA 2ONYA 4LXIA 4FKZA 3ZZ0A 3BGDA 1CY1A 1D2AA 2HMWA 4ZYVA 4LDNA 3SSOA 1R3DA 1M34B 3ORYA 3VC2A 3HJHA 4YCNA 3GCWA 1Z6PA 1ATZA 2EP5A 1V16B 4L1KA 4NZNA 4XUEA 4O2BB 4KZPA 4RF5A 3HVKA 1Z4IA 2NSDA 2FPSA 3P9QA 3ZNNA 4TWAA 5E3HA 2VDKB 4D74A 4PYJA 2J0QA 4B75A 5I7EA 1MO3A 1KY2A 3NXSA 4M60A 4P93A 4ZJPA 2FZLA 4ZT7A 3OEED 1Z7WA 4TLEA 2G7ZA 4YREA 4JGBA 1BG6A 2AF4C 4ISBA 4KR0A 1M0TA 1L3IA 4PPFA 2HA3A 2OC9A 4UVDA 2OHOA 1PVVA 4E7OA 1N9KA 2Q4BA 1IH8A 2J0EA 1BH2A 5EAIA 2QMUA 4CTJA 4FQ8A 3EMBA 5DBFA 2O3JA 1BA2A 5JRDS 3FUVA 3LKZA 4J90A 4I4NA 1JGTA 4QGSA 3CVUA 3EG9B 3N8HA 5TIIA 5G0VA 4Q1CA 3K1YA 4TLDA 2XAAA 4JBLA 3CXRA 3L8YA 2E49A 4ANFA 3CZ4A 4IMJB 5E3IA 3TAXA 1SC3A 4HS9A 1HXHA 3DV0A 2HHCA 2P9TA 1QC5A 2QBYB 1J5EB 3N0VA 2HF2A 2K87A 1Z0ZA 1ZXXA 1SXPA 2CZQA 4DG8A 4CEJA 3GNTA 3EJ6A 2JCXA 5JALA 1GITA 4XKJA 4PRLA 1D6SA 2QVZX 1JAZA 3GQBA 1M73E 2ZB7A 4K26A 4G2NA 1QIDA 1HBJA 1P74A 1Y34E 2JGKA 3DR5A 3O4FA 1V7QA 3ZCPA 4DEVA 4X20B 1Z62A 4Q7QA 4YPVA 1J00A 1Z45A 4G63A 4H1UA 4I50A 4XOIA 1CTQA 4J0CA 1L5RA 4CIWA 1IK6A 4FINA 2ZE7A 3QIAA 3KL2A 2DBVO 4PGGA 5ALTA 3G6WA 3EEQA 4Y9TA 2M6LA 3MWGA 1G21E 1FVHA 1OZAA 3DOJA 5JHHB 2WHPB 4N6NA 5TJ9A 3LCJA 2C20A 3UT5A 1P0CA 5J1SB 1OZHA 2B34A 3DQZA 3E9CA 3PA8A 1XZKA 3SYMA 3VSEA 5F1KA 3GRAA 4D92A 2JFXA 3CF6R 5EKTA 1X3LA 2PXXA 1TLLA 1UBJS 1WCWA 2X9VA 4DE5A 4EY4A 3D4OA 1OBCA 3DEHA 2NMVA 3FTCA 1BGWA 2ZVPX 1S1MA 4MULA 2G9ZA 3I2GA 4H6WA 4Q48A 4UBNA 3H4TA 2WG0A 3RGGA 4BGUA 2PX2A 4TV8F 1ACMA 1T35A 4RHTA 3VU3A 3K6RA 5LIPA 3TVTA 10MHA 4CGZA 1OWOA 3NZEA 3BE6A 5D8DA 2JJ1A 4JFAA 1E5QA 3UAZA 5BMVF 4JJAA 3ZQUA 5LZ4A 3VPCA 3KQMA 2WUGA 1XKQA 3OJXA 2PXHA 521PA 4UTNA 2GCOB 1T9BA 4I1IA 3M1LA 2QVGA 2VNJA 4TYWA 1N32B 5T67A 2A1UB 3MXTA 4JL5A 1V2HE 1VI2A 4WFQA 1XTIA 5FBVB 5FPTA 4TV9A 5BUQA 1ULAA 4NHEA 2GVNA 2WE7A 4JODA 3RSFA 3T7JA 3W2TA 3RK4A 3ZHZA 3ZCQA 3X1ZA 2Y92A 3GUUA 3HUEA 1Z3IX 4UNQA 1QNLA 3EXEB 1Z0AA 5BNTA 4GT1A 2QRGA 3M6UA 4RMNA 2Q6KA 3RS5A 3ZE0B 3K2QA 3PXUA 4DJEC 1R5OA 4QG7A 4UQLA 5DLDA 4V1CI 2EYQA 2HSJA 3WA7A 2JGEA 5EP1A 2YL2A 4ZGWA 2GYVA 3Q2OA 2YZGA 3UTCA 1I4LD 2W22A 2ZIGA 1POWA 2WSMA 3UATA 1GZ4A 4K9SA 4N5NA 2GN9A 2P0YA 3TLJA 3T3IA 4YRBA 3GLGB 4FLMA 4IIYA 5FEMA 1XA3A 1IDN1 2NVOA 2WVAA 1PR3A 2YC4C 2VP2A 3P26A 3D0OA 4QDJA 4ZO4A 3RASA 2G67A 3CUEF 2H59A 2GHIA 1XTTA 2WIGA 2E6UX 2YZKA 3ONWA 3KYIB 3KLBA 4Q3NA 2FUCA 2H51A 2GZ3A 4EGQA 5BN4A 2JKVA 5EL0A 3OPVA 5JAMA 1CT9A 2B0JA 2XUQA 1UKEA 4TZKA 1EG7A 3SQOA 1SFRA 6REQB 4BGIA 4RXUA 4LJKA 3IQZA 1M34A 2AC7A 4HRXA 3WGVA 1J06A 5DN6A 3OFNA 4FEGA 2CBGA 4O2BA 2XXAA 1I1HA 3HR8A 2A5JA 2GKSA 3SQXA 2KS6A 5A6VA 1RAGA 4LMAA 5FWXB 2XQVA 3CX8A 3I42A 2YXBA 2QQ0A 1O7JA 4KQXA 2BGLA 2XRYA 1HSZA 5A4AA 2QI9F 2QN6A 3FLBA 3VNVA 3EIUA 5T8KA 1YZFA 4JD5A 3RYIB 4FZ2A 2VP4A 3I1YA 4KP7A 5J4KA 1BVRA 2BFEB 2FWRA 5JY6A 3BB4A 1E79A 2X6TA 1W6UA 2B82A 3AB8A 2MSCB 3CF2A 1QTQA 3OEWA 5FA5A 3F9IA 4DIEA 4R8RA 4X3PA 4AMGA 1BQ4A 2F3PA 3CRQA 1N1MA 1I24A 3II6X 3EG9A 4GLJA 1K66A 1N4AA 3RJZA 2R4TA 4LVCA 2PMWB 2O6HA 4RQAA 3DHEA 3V4OA 1ZONA 1NVGA 3UOWA 2HWXA 1GKLA 2FPPA 1KI3A 3T3GA 1ATIA 2WTAA 5ALOA 4Z4IA 2B4RO 1M10A 4OBEA 4OK6A 3JWPA 4UHCA 3IS3A 2HFJA 1D8AA 3OAAA 1EMDA 1GNVA 5JTTA 3AG5A 1KHHA 1A5TA 3PU6A 1EU1A 2NVWA 4RSGA 4HAOA 5AXCA 4X20A 4YV2A 1SO8A 1LQUA 3TMAA 3QEBZ 2MSKA 4Q03A 1PFKA 4A5OA 2OD9A 3HDYA 4IKPA 2WWVD 1RDFA 3K05A 4FJ0A 4N0EA 4B33A 4PZAA 3KSDO 4R5HA 5JCJA 2WJ3A 4DJJA 2UU9B 3BIFA 3L0PA 1P1FA 4D97A 3VPSA 3JSXA 4QELA 1C4KA 1JNXX 1JAHA 2P65A 3NBFA 2VH1A 1RI3A 1CE8A 3KOZA 3WL6A 4KOAA 3K30A 4LDQA 3SS7X 5KKCA 3NEYA 1V71A 2AQIA 1DJQA 2W70A 4ZYTA 5KPJA 1I01A 2YFHA 3HJAA 2EJUA 1ZOSA 2HRQA 3PNBA 4FXOA 1RKQA 1T4GA 3LP5A 2Y68A 4FD2A 4KFSA 4C7JA 3O47A 1K3FA 4PYNA 4I19A 3ZY5A 2DR0A 2VATA 4G56A 1EVKA 4NZPA 3W5HA 1RQGA 1QK3A 4W8GA 2GCOA 3O3CA 2J5XA 5DP2A 5LP6A 4F4IA 2ZYWX 4FZ5A 4ALNA 2CMKA 2A1UA 1RWNA 2BN4A 2COKA 2KJQA 3QLUC 1E6EA 1ZINA 3OMWA 4LHEA 2QM8A 1WCV1 4CM3A 3ZHBA 1KYVA 4JELA 4F2WA 1P4GA 3COVA 2J3HA 4AF8A 1G9TA 2PWAA 4U7TB 4WW0A 1VG0B 2FWPA 2EHJA 2BPOA 2ZU0C 3CLSD 3AR2A 2H4YA 1U9ZA 5T7BA 2WF7A 4HGOA 5TV2A 2J3KA 2WINI 1TZ2A 3MUEA 4Q3EA 3SQDA 4D9FA 2A9FA 1EZ1A 1GPWB 1NBHA 1T3LA 3FB4A 5TR9A 3C6QA 4JB3A 4TMYA 1QK4A 2COUA 4DLPA 5B36A 1IULA 4GPEA 4TSKA 3GLGA 1EX6A 3MF4A 4TYQA 3W5UA 5I8WA 2IS4A 2P9YA 4UUAA 4MDFA 2CD9A 2B2XA 2RAUA 2IEDA 2W83A 3EDCA 3OVMA 1PV2A 3EULA 4MZDA 5FOSA 1I4EB 1U3UA 3NYIA 1A50B 1R10A 2JGDB 4LHZA 5EUCA 2IHVA 3DMTA 4B34A 2CYCA 3HP4A 3ENQA 1Q17A 4YHBA 1T13A 3TNDA 3D64A 2OHXA 5IJWA 5HIAA 5D5PA 2O7RA 6REQA 1D09A 1ZJ4A 3LCVB 3O38A 4OI1A 1QUFA 3MTAA 4ZU6X 1YZHA 4RY9A 1CRPA 4OYYA 1CYEA 4ARZB 2O57A 4IJQA 4EFNA 1TTPB 1BS1A 2VPZA 2W6NA 1A9TA 5FWXA 4FQ7A 1CR4A 4N65A 1P44A 3W5VA 1T8RA 2FUG6 3VPFA 5ADVA 2ECQA 2X19A 1B3BA 2ZRLA 4HFRA 4LRQA 4NBUA 2ZBPA 2ZPTX 4LHSA 4V0MA 4ZO8A 4EELA 2X76A 3SQLA 4LBYA 1H2ZA 5KTMA 2DTXA 3FZQA 2BFEA 2CW5A 3C8MA 3HDVA 4PLWA 4QOSA 2XSZA 3KKMA 3ED1A 4PINA 2J7KA 3OPMA 4LGCA 2WUFA 1EA7A 3DD5A 4IZOA 1KDRA 4NQZA 2ORED 4D45A 2NOAA 3N75A 2R25B 2J32A 4UHEA 4C14A 3ZU2A 2VPIA 2ZWMA 3GA7A 1NMEA 1I4DD 2CCKA 4G01B 1TF2A 3RBZA 5C1IA 2FR8A 4S12A 2VP0A 2VP5A 2X3FA 1CUFA 3BH7A 3NONA 3UMSA 4EHHA 3UGJA 1U04A 1OI3A 2DKFA 2FWJA 2GLXA 2R44A 3NAZA 5JS2A 4UUBA 2XIQA 4I1OA 2QVLA 2VQ6A 1WUJS 3VH2A 5E1DA 3AC0A 4DCUA 2BHTA 5G2OA 2B2CA 2FHPA 2ODWA 1BSVA 2RSLA 3Q7SA 2I2WA 3RFTA 1JE1A 1Q83A 1K5HA 1D9ZA 1YZQA 5BUZA 3S2EA 1XYGA 5DSXA 1FUKA 2X0NA 5EXEA 2JGAA 1NXWA 2Q46A 4XM0A 4FDMA 3QVGA 3TQSA 3T5AA 3LT4A 4LK3A 2JHCA 3JTMA 1F0NA 1KC1A 1RXUA 2JEOA 2W5UA 2XZLA 3LGSA 3KQQA 3BRCA 2UVPB 3I0ZA 4INJA 3DE2X 2QPOA 2G06A 3UHJA 4AWXA 1V11B 2VRCA 4XWYA 3EUAA 3QVOA 1ZRNA 2WWIA 2Q9CA 3QJYA 3V00A 3H5WA 3H8JA 4PYOA 3HFRA 4M2LA 4P58A 4XAQA 5A3VA 3UXEA 3THYB 3B6ZA 3L0BA 2WOJA 1OIVA 2PKQO 5BP7A 2PD4A 3BQNB 3O6VA 4GQIA 4K86A 4CR8A 1PT6A 2XBUA 4CIBA 3GEEA 4Y2SA 3L92A 3FNRA 5CK4A 1WE2A 3LF2A 3PDJA 1MC5A 2C5FA 4BLOA 2NTYC 3N8NA 2CYAA 2CUZA 2C9ZA 3CZ9A 4K9MA 1DAPA 3FMPB 3CF4G 3H0CA 3IAM1 3OX4A 2G9UA 3NQ41 1GAJA 2O9JA 3SYRA 3TRHA 2ILTA 2FF7A 5HKBA 4W5TA 1UWVA 2GEDA 4YIHA 5HXAA 1VPDA 4K88A 1WSBA 1SXJC 1Z15A 1H4TA 1SIUA 2JGFA 1V7ZA 1ZIOA 2JLSA 1E6MA 3TD2A 3D3QA 2O0LA 2C3UA 3H9QA 3NC4A 4IF6A 5ALQA 1JF8A 1H6CA 2Q9UA 4JLKA 5C32A 1XMQB 1OLSA 1OXTA 4N9WA 4ALJA 4OPMA 2XITA 4O4JF 4RGYA 5CFMA 1GZ7A 5CVTA 2G04A 3T5CA 3WLKX 5ALGA 4R9VA 4GX5A 3UMGA 4MV8A 3KOXA 1E2EA 5CFPA 2JJMA 2OPHA 2OR3A 1M76A 4HEJA 3Q1KA 3S6JA 3UB4A 2YVKA 1PZXA 4UXJA 1G38A 1GUDA 2IX9A 2X2FA 3NJ8A 1W93A 4GI2A 3E05A 5E4TA 5EEGA 4LFBB 3DEJA 1CR0A 1G55A 5F5XA 2G28A 2OBXA 5BR4A 4UU1A 4NTZA 2ZOSA 3ENWA 4XTCS 4KO8A 4W99A 4D0GA 1ISHA 2FSVA 1FW8A 4KRFA 3HCBA 2GESA