The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
180
|
structure length |
180
|
Chain Sequence |
PIKASGVLIGDSVLVTDVEQARSLYSCGYYGQPLDVEKPRGADFEGPLRLSLIESLYLAEKGVLEVAKPDGSSVGVEDLRTAVRGNPRFSMLYNIYRDLRERGFVVRSGLKFGSDFAVYRLGPGIDHAPFIVHAYSPEDNIDPVEIVRAGRLSHSVRKKFVFAVTRGGDVSYLMIDWFRP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Cleavage of intron from the standard or non-standard position of the precursor tRNA by the splicing endonuclease of Aeropyrum pernix, a hyper-thermophilic Crenarchaeon, involves a novel RNA recognition site in the Crenarchaea specific loop
pubmed doi rcsb |
| molecule keywords |
Putative uncharacterized protein
|
| molecule tags |
Hydrolase
|
| source organism |
Aeropyrum pernix
|
| total genus |
46
|
| structure length |
180
|
| sequence length |
180
|
| chains with identical sequence |
D, F, H, J, L
|
| ec nomenclature |
ec
4.6.1.16: tRNA-intron lyase. |
| pdb deposition date | 2010-10-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF01974 | tRNA_int_endo | tRNA intron endonuclease, catalytic C-terminal domain |
| B | PF02778 | tRNA_int_endo_N | tRNA intron endonuclease, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | MutS, DNA mismatch repair protein, domain I | tRNA intron endonuclease, N-terminal domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 1GEF A; 1ZP7 A; 3DNX A; 4QBL A; 1Y88 A; 1Y1O A; 1F1Z A; 3AJV B; 4QBN A; 1R11 A; 2OKF A; 1T0F A; 4QBO A; 3AJV A; 2CV8 A; 4FZ2 A; 1IPI A; 2WCZ A; 2WIZ A; 3P1Z B; 5FDK A; 1HH1 A; 2WCW A; 2FCO A; 3P1Z A; 1OB9 A; 3FOV A; 1A79 A; 2INB A; 2WIW A; 3IEY A; 2VLD A; 2EO0 A; 2WJ0 A; 1OB8 A; 1RLV A; 2GJW A; 4TKD A; 1RZN A; 2ZYZ B; 3P1Y A; 2OST A; 1XMX A; 2GW6 A; 4TKK A; 2ZYZ A; 1R0V A; #chains in the Genus database with same CATH topology 1W7A A; 1NNE A; 1Y1O A; 1UWV A; 2O8E A; 1FW6 A; 3AJV A; 1OH6 A; 2CV8 A; 3THX A; 3THW B; 3IEY B; 2O8C A; 1OB9 A; 2BH2 A; 1OH5 A; 1NG9 A; 3ZLJ A; 2VLD A; 2O8D B; 2IXS A; 2FL3 A; 4TKD A; 3K0S A; 2JJQ A; 2ZYZ B; 2O8B A; 4E6Z A; 2WIW A; 1R0V A; 4LQE A; 3AJV B; 4QBN A; 2VS1 A; 1OH8 A; 1R11 A; 1E3M A; 1T0F A; 2FWR A; 2WTU A; 1IPI A; 2FKH B; 1OH7 A; 2FCO A; 2FZ4 A; 3P1Z A; 4G6U A; 2CZR A; 1A79 A; 2INB A; 2Z0R A; 2O8F B; 2EO0 A; 1EWQ A; 1OB8 A; 4ZQU A; 2O8B B; 1RLV A; 2GJW A; 2OST A; 1XMX A; 1GEF A; 1ZP7 A; 4QBL A; 2O8E B; 2OKF A; 4QBO A; 4EV1 A; 3THY A; 3THX B; 2WCZ A; 3BT7 A; 2WIZ A; 2O8C B; 5FDK A; 1HH1 A; 1WBD A; 1WBB A; 1WB9 A; 3THW A; 3FOV A; 2WJ0 A; 3P1Y A; 4TKK A; 2ZYZ A; 3DNX A; 1Y88 A; 1F1Z A; 4G6V A; 4DAP A; 3THY B; 2FLC A; 4FZ2 A; 3P1Z B; 2FKC A; 2WCW A; 3IEY A; 2DBS A; 3IF0 X; 2O8F A; 1YNM A; 2W8M A; 4DAV A; 2O8D A; 1RZN A; 4DA2 A; 2GW6 A; #chains in the Genus database with same CATH homology 1GEF A; 1ZP7 A; 3DNX A; 4QBL A; 4LQE A; 1Y88 A; 1Y1O A; 1F1Z A; 3AJV B; 1UWV A; 4G6V A; 2VS1 A; 4QBN A; 1R11 A; 4DAP A; 2OKF A; 1T0F A; 4QBO A; 3AJV A; 4EV1 A; 2FLC A; 2CV8 A; 4FZ2 A; 1IPI A; 2WCZ A; 2FKH B; 3BT7 A; 2WIZ A; 3P1Z B; 5FDK A; 2FKC A; 1HH1 A; 2WCW A; 3IEY B; 2FCO A; 3P1Z A; 1OB9 A; 4G6U A; 2BH2 A; 2CZR A; 3FOV A; 1A79 A; 2INB A; 2Z0R A; 3IEY A; 4E6Z A; 2WIW A; 2DBS A; 2VLD A; 2EO0 A; 2WJ0 A; 1OB8 A; 2IXS A; 4ZQU A; 3IF0 X; 1RLV A; 2GJW A; 2FL3 A; 1YNM A; 2W8M A; 4DAV A; 4TKD A; 1RZN A; 2JJQ A; 2ZYZ B; 4DA2 A; 3P1Y A; 2OST A; 1XMX A; 2GW6 A; 4TKK A; 2ZYZ A; 1R0V A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...